F327284

General Info

Members Datasets Scaffolds Average Seq Length
216 154 430 152

Family's Representative Sequence

Representative Sequence 3300005365|Ga0070688_100315360|Ga0070688_1003153602
Length 178
Sequence MTAPTGPKTGPNEPIAESERPIPTPSGAGARPFRVLGLQQIAIGGASKAALRGLWVDLFGLPAIGTFRSERENVDEDILSLAGVEIDLMQPIDPAGKPRVHEPPLNHIGLWVDDLRAAVAWLTAQGMRFTPGGIRRGAAGHDVCFIHPKGDTNAPRSGEGVLIELVQAPPDVIARLGG

Samples

Sample ID Description Type Environment
1 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
13 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
14 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
19 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
20 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
21 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
22 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
23 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
24 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
25 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
26 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
27 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
28 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
29 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
30 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
31 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
32 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
33 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
34 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
35 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
36 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
37 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
38 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
39 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
40 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
41 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
42 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
43 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
44 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
45 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
46 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
47 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
68 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
69 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
70 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
71 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
72 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
73 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
74 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
75 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
76 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
77 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
78 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
79 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
80 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
81 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
82 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
83 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
84 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
85 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
86 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
87 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
88 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
89 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
90 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
91 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
92 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
93 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
94 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
95 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
96 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
97 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
98 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
99 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
100 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
101 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
102 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
103 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
104 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
105 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
106 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
107 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
108 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
109 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
110 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
111 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
112 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
113 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
114 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
115 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
116 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
117 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
118 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
119 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
120 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
121 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
122 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
123 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
124 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
125 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
126 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
127 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
128 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
129 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
130 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
131 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
132 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
133 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
134 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
135 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
136 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
137 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
138 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
139 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
140 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
141 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
142 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
143 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
144 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
145 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
146 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
147 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
148 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
149 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
150 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
151 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
152 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
153 2643221660 Methylibium sp. Root1272 Isolate Unclassified
154 2721755523 Delftia sp. HK171 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.61
Metatranscriptomes 0
Isolates 1.39

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.26
Nodule 0
Rhizoplane 3.7
Rhizosphere 76.39
Stem 0
Stem Tuber 0
Unclassified 1.85

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070688_100315360 3300005365 Bacteria 1134
2 Ga0070658_10057159 3300005327 Bacteria 3173
3 Ga0070683_100506050 3300005329 Bacteria 1154
4 Ga0070690_100017113 3300005330 Bacteria 4353
5 Ga0068869_100092077 3300005334 Bacteria 2282
6 Ga0070666_11121552 3300005335 Bacteria 585
7 Ga0070682_100432998 3300005337 Bacteria 1003
8 Ga0068868_100715522 3300005338 Bacteria 897
9 Ga0068868_101522654 3300005338 Bacteria 627
10 Ga0070689_101468897 3300005340 Bacteria 617
11 Ga0070668_100411927 3300005347 Bacteria 1156
12 Ga0070688_100067022 3300005365 Bacteria 2286
13 Ga0070667_101441930 3300005367 Bacteria 646
14 Ga0070701_10256047 3300005438 Bacteria 1059
15 Ga0070701_10619196 3300005438 Bacteria 719
16 Ga0070708_100290466 3300005445 Bacteria 1539
17 Ga0070678_100001489 3300005456 Bacteria 12508
18 Ga0070681_11568671 3300005458 Bacteria 583
19 Ga0070698_100371183 3300005471 Bacteria 1363
20 Ga0070679_100005242 3300005530 Bacteria 12004
21 Ga0070679_100158020 3300005530 Bacteria 2242
22 Ga0070695_101134785 3300005545 Bacteria 641
23 Ga0070665_100189712 3300005548 Bacteria 2056
24 Ga0068855_100208542 3300005563 Bacteria 2197
25 Ga0068856_100032671 3300005614 Bacteria 5095
26 Ga0068859_100180614 3300005617 Bacteria 2193
27 Ga0068864_100081258 3300005618 Bacteria 2841
28 Ga0068864_101313388 3300005618 Bacteria 724
29 Ga0068861_100610737 3300005719 Bacteria 1002
30 Ga0068863_100036321 3300005841 Bacteria 4694
31 Ga0068863_100364274 3300005841 Bacteria 1410
32 Ga0068860_101188117 3300005843 Bacteria 783
33 Ga0081455_10002573 3300005937 Bacteria 21513
34 Ga0081455_10024109 3300005937 Bacteria 5643
35 Ga0070717_10068490 3300006028 Bacteria 2954
36 Ga0075366_10440413 3300006195 Bacteria 804
37 Ga0075428_100168548 3300006844 Bacteria 2375
38 Ga0075430_100409484 3300006846 Bacteria 1119
39 Ga0075431_100403347 3300006847 Bacteria 1368
40 Ga0097620_100180625 3300006931 Bacteria 2193
41 Ga0105245_10005405 3300009098 Bacteria 11226
42 Ga0105243_10065203 3300009148 Bacteria 2925
43 Ga0105243_10557062 3300009148 Bacteria 1096
44 Ga0105248_10713851 3300009177 Bacteria 1131
45 Ga0105248_11356644 3300009177 Bacteria 804
46 Ga0105249_10166654 3300009553 Bacteria 2133
47 Ga0157369_12335636 3300013105 Bacteria 542
48 Ga0157374_10022508 3300013296 Bacteria 5622
49 Ga0157374_10201819 3300013296 Bacteria 1947
50 Ga0157378_10666198 3300013297 Bacteria 1057
51 Ga0157375_10303467 3300013308 Bacteria 1760
52 Ga0163163_11557548 3300014325 Bacteria 722
53 Ga0163163_11803171 3300014325 Bacteria 672
54 Ga0157380_10369402 3300014326 Bacteria 1349
55 Ga0157380_10609004 3300014326 Bacteria 1082
56 Ga0157376_10135074 3300014969 Bacteria 2206
57 Ga0163161_10160920 3300017792 Bacteria 1712
58 Ga0213876_10040610 3300021384 Bacteria 2458
59 Ga0207705_10999575 3300025909 Bacteria 646
60 Ga0207662_10462774 3300025918 Bacteria 869
61 Ga0207652_10579063 3300025921 Bacteria 1007
62 Ga0207652_10995289 3300025921 Bacteria 737
63 Ga0207687_10000275 3300025927 Bacteria 35308
64 Ga0207687_10335571 3300025927 Bacteria 1227
65 Ga0207704_10085853 3300025938 Bacteria 2051
66 Ga0207711_10419327 3300025941 Bacteria 1245
67 Ga0207689_10006488 3300025942 Bacteria 10336
68 Ga0207689_10643371 3300025942 Bacteria 893
69 Ga0207667_10691808 3300025949 Bacteria 1023
70 Ga0207712_11169869 3300025961 Bacteria 686
71 Ga0207677_10281358 3300026023 Bacteria 1366
72 Ga0207677_10803743 3300026023 Bacteria 842
73 Ga0207708_10363767 3300026075 Bacteria 1189
74 Ga0207702_10045813 3300026078 Bacteria 3679
75 Ga0207641_10348355 3300026088 Bacteria 1411
76 Ga0207676_10050392 3300026095 Bacteria 3246
77 Ga0207676_11161671 3300026095 Bacteria 764
78 Ga0207674_10118052 3300026116 Bacteria 2623
79 Ga0207674_11708631 3300026116 Bacteria 597
80 Ga0207675_100422428 3300026118 Bacteria 1317
81 Ga0207675_100466712 3300026118 Bacteria 1253
82 Ga0207683_10012864 3300026121 Bacteria 7142
83 Ga0207698_11062598 3300026142 Bacteria 821
84 Ga0268266_10007057 3300028379 Bacteria 10199
85 Ga0268264_11069226 3300028381 Bacteria 815
86 Ga0307517_10113054 3300028786 Bacteria 2051
87 Ga0307515_10129211 3300028794 Bacteria 2796
88 Ga0265338_10008357 3300028800 Bacteria 12584
89 Ga0265338_10261726 3300028800 Bacteria 1271
90 Ga0265339_10216054 3300031249 Bacteria 940
91 Ga0307513_10018536 3300031456 Bacteria 8314
92 Ga0307509_10000280 3300031507 Bacteria 84178
93 Ga0307509_10028023 3300031507 Bacteria 6264
94 Ga0307509_10054834 3300031507 Bacteria 4241
95 Ga0307509_10086468 3300031507 Bacteria 3224
96 Ga0307509_10517528 3300031507 Bacteria 875
97 Ga0307509_10947512 3300031507 Bacteria 526
98 Ga0307508_10094552 3300031616 Bacteria 2579
99 Ga0316575_10163175 3300031665 Bacteria 922
100 Ga0316576_10021801 3300031727 Bacteria 4437
101 Ga0316576_10046238 3300031727 Bacteria 3149
102 Ga0316576_10195046 3300031727 Unclassified 1526
103 Ga0316576_10320883 3300031727 Bacteria 1155
104 Ga0316578_10024896 3300031728 Bacteria 3360
105 Ga0316578_10030566 3300031728 Bacteria 3063
106 Ga0316578_10069037 3300031728 Bacteria 2091
107 Ga0316578_10276691 3300031728 Bacteria 1005
108 Ga0316578_10355890 3300031728 Unclassified 871
109 Ga0307516_10045933 3300031730 Bacteria 4311
110 Ga0316577_10005285 3300031733 Bacteria 6763
111 Ga0307406_10216641 3300031901 Bacteria 1420
112 Ga0307416_100322480 3300032002 Bacteria 1548
113 Ga0307415_100031643 3300032126 Bacteria 3411
114 Ga0307415_100181391 3300032126 Bacteria 1652
115 Ga0316585_10130466 3300032137 Bacteria 828
116 Ga0316580_10051728 3300032139 Bacteria 1266
117 Ga0373944_0226959 3300035089 Bacteria 683
118 Ga0373949_0002814 3300035090 Bacteria 4324
119 Ga0373939_0015253 3300035114 Bacteria 2008
120 Ga0373961_0000104 3300035241 Bacteria 44660
121 Ga0316574_0022859 3300035398 Bacteria 3728
122 Ga0316574_0025235 3300035398 Bacteria 3566
123 Ga0316574_0440932 3300035398 Bacteria 817
124 Ga0316574_0515626 3300035398 Bacteria 744
125 Ga0316582_0036210 3300036647 Bacteria 3053
126 Ga0316582_0243289 3300036647 Bacteria 1233
127 Ga0316582_0289744 3300036647 Bacteria 1124
128 Ga0316584_0000475 3300036712 Bacteria 21070
129 Ga0316584_0088044 3300036712 Bacteria 2325
130 Ga0316584_0155946 3300036712 Bacteria 1698
131 Ga0395899_0203866 3300037312 Bacteria 1377
132 Ga0395899_0217506 3300037312 Bacteria 1325
133 Ga0395900_0028629 3300037418 Bacteria 5710
134 Ga0395905_0166462 3300037471 Bacteria 2072
135 Ga0395905_0513662 3300037471 Bacteria 1098
136 Ga0395905_0778317 3300037471 Bacteria 860
137 Ga0395901_0474016 3300038443 Bacteria 1277
138 Ga0400483_014093 3300039062 Bacteria 1027
139 Ga0400483_015477 3300039062 Bacteria 2256
140 Ga0400483_238989 3300039062 Bacteria 3082
141 Ga0400483_286416 3300039062 Bacteria 1760
142 Ga0436365_1276763 3300039437 Bacteria 2479
143 Ga0436365_1457573 3300039437 Bacteria 861
144 Ga0436363_0932783 3300039450 Bacteria 839
145 Ga0436362_1208414 3300039453 Bacteria 962
146 Ga0451789_1272865 3300041443 Bacteria 1451
147 Ga0451791_1559677 3300041451 Bacteria 1196
148 Ga0451793_1750199 3300041452 Bacteria 2147
149 Ga0451797_1066231 3300041453 Bacteria 2333
150 Ga0451807_0889901 3300041486 Bacteria 9672
151 Ga0451807_0915378 3300041486 Bacteria 546
152 Ga0451807_2215253 3300041486 Unclassified 560
153 Ga0451837_1791215 3300041494 Bacteria 728
154 Ga0451577_0033338 3300042876 Bacteria 4642
155 Ga0451577_0961029 3300042876 Bacteria 768
156 Ga0453684_0204254 3300044712 Bacteria 2301
157 Ga0453684_0494694 3300044712 Bacteria 1355
158 Ga0495603_0275436 3300046455 Bacteria 968
159 Ga0495650_0034738 3300046471 Bacteria 2228
160 Ga0495596_0089949 3300046500 Bacteria 1191
161 Ga0495649_0339489 3300046694 Bacteria 760
162 Ga0495676_0536008 3300047321 Bacteria 766
163 Ga0495686_0003386 3300047472 Bacteria 13880
164 Ga0495686_0099426 3300047472 Bacteria 1756
165 Ga0496115_0819285 3300048918 Bacteria 723
166 Ga0501299_144786 3300049522 Bacteria 594
167 Ga0501031_0541200 3300049568 Bacteria 750
168 Ga0501034_0074771 3300049571 Bacteria 3396
169 Ga0501034_0472563 3300049571 Bacteria 1170
170 Ga0501034_0502696 3300049571 Bacteria 1126
171 Ga0501037_0250359 3300049573 Bacteria 1240
172 Ga0501042_0121124 3300049578 Bacteria 1884
173 Ga0501047_0011415 3300049581 Bacteria 8408
174 Ga0501047_0304696 3300049581 Bacteria 1435
175 Ga0501067_0326578 3300049583 Bacteria 854
176 Ga0501069_0375519 3300049585 Bacteria 839
177 Ga0501070_0012683 3300049586 Bacteria 7108
178 Ga0501070_0114568 3300049586 Bacteria 2227
179 Ga0501070_0571343 3300049586 Bacteria 903
180 Ga0501072_0153708 3300049588 Bacteria 1835
181 Ga0501073_0118858 3300049589 Bacteria 1832
182 Ga0501077_0699196 3300049593 Bacteria 652
183 Ga0501227_135197 3300049665 Bacteria 673
184 Ga0501225_0279450 3300049705 Bacteria 559
185 Ga0501080_0177332 3300049742 Bacteria 1963
186 Ga0501080_1356211 3300049742 Unclassified 608
187 Ga0501083_0066143 3300049744 Bacteria 2407
188 Ga0501280_000723 3300049776 Bacteria 7284
189 Ga0501044_0235764 3300049823 Bacteria 1775
190 nmdc:mga0qj67_381817_c1 3300050509 Bacteria 1138
191 nmdc:mga06r32_393595_c1 3300050510 Bacteria 1368
192 nmdc:mga0rr50_725105_c1 3300050513 Bacteria 848
193 Ga0500646_0219637 3300053090 Bacteria 659
194 Ga0500583_0125473 3300053092 Bacteria 1271
195 Ga0500566_0001243 3300053094 Bacteria 14889
196 Ga0500566_0008808 3300053094 Bacteria 5969
197 Ga0500566_0144346 3300053094 Bacteria 1259
198 Ga0500640_012203 3300053095 Bacteria 3523
199 Ga0500554_000201 3300053102 Bacteria 12649
200 Ga0500562_031570 3300053108 Bacteria 1398
201 Ga0500595_000239 3300053119 Bacteria 37131
202 Ga0500597_074074 3300053120 Bacteria 1473
203 Ga0500607_204944 3300053121 Bacteria 842
204 Ga0500614_000774 3300053123 Bacteria 8101
205 Ga0500559_0002878 3300053136 Bacteria 8688
206 Ga0500603_002451 3300053150 Bacteria 4068
207 Ga0500639_131204 3300053163 Bacteria 1187
208 Ga0500636_0248329 3300053177 Bacteria 909
209 Ga0500637_0113848 3300053178 Bacteria 1569
210 Ga0500637_0157274 3300053178 Bacteria 1311
211 Ga0500601_009483 3300053737 Bacteria 1086
212 Ga0501082_0553635 3300060353 Bacteria 1006
213 2644221463 2643221639 Bacteria 6649903
214 2644338309 2643221660 Bacteria 4208257
215 2722883686 2721755523 Bacteria 6430384
216 Ga0070688_100315360
217 Ga0070658_10057159
218 Ga0070683_100506050
219 Ga0070690_100017113
220 Ga0068869_100092077
221 Ga0070666_11121552
222 Ga0070682_100432998
223 Ga0068868_100715522
224 Ga0068868_101522654
225 Ga0070689_101468897
226 Ga0070668_100411927
227 Ga0070688_100067022
228 Ga0070667_101441930
229 Ga0070701_10256047
230 Ga0070701_10619196
231 Ga0070708_100290466
232 Ga0070678_100001489
233 Ga0070681_11568671
234 Ga0070698_100371183
235 Ga0070679_100005242
236 Ga0070679_100158020
237 Ga0070695_101134785
238 Ga0070665_100189712
239 Ga0068855_100208542
240 Ga0068856_100032671
241 Ga0068859_100180614
242 Ga0068864_100081258
243 Ga0068864_101313388
244 Ga0068861_100610737
245 Ga0068863_100036321
246 Ga0068863_100364274
247 Ga0068860_101188117
248 Ga0081455_10002573
249 Ga0081455_10024109
250 Ga0070717_10068490
251 Ga0075366_10440413
252 Ga0075428_100168548
253 Ga0075430_100409484
254 Ga0075431_100403347
255 Ga0097620_100180625
256 Ga0105245_10005405
257 Ga0105243_10065203
258 Ga0105243_10557062
259 Ga0105248_10713851
260 Ga0105248_11356644
261 Ga0105249_10166654
262 Ga0157369_12335636
263 Ga0157374_10022508
264 Ga0157374_10201819
265 Ga0157378_10666198
266 Ga0157375_10303467
267 Ga0163163_11557548
268 Ga0163163_11803171
269 Ga0157380_10369402
270 Ga0157380_10609004
271 Ga0157376_10135074
272 Ga0163161_10160920
273 Ga0213876_10040610
274 Ga0207705_10999575
275 Ga0207662_10462774
276 Ga0207652_10579063
277 Ga0207652_10995289
278 Ga0207687_10000275
279 Ga0207687_10335571
280 Ga0207704_10085853
281 Ga0207711_10419327
282 Ga0207689_10006488
283 Ga0207689_10643371
284 Ga0207667_10691808
285 Ga0207712_11169869
286 Ga0207677_10281358
287 Ga0207677_10803743
288 Ga0207708_10363767
289 Ga0207702_10045813
290 Ga0207641_10348355
291 Ga0207676_10050392
292 Ga0207676_11161671
293 Ga0207674_10118052
294 Ga0207674_11708631
295 Ga0207675_100422428
296 Ga0207675_100466712
297 Ga0207683_10012864
298 Ga0207698_11062598
299 Ga0268266_10007057
300 Ga0268264_11069226
301 Ga0307517_10113054
302 Ga0307515_10129211
303 Ga0265338_10008357
304 Ga0265338_10261726
305 Ga0265339_10216054
306 Ga0307513_10018536
307 Ga0307509_10000280
308 Ga0307509_10028023
309 Ga0307509_10054834
310 Ga0307509_10086468
311 Ga0307509_10517528
312 Ga0307509_10947512
313 Ga0307508_10094552
314 Ga0316575_10163175
315 Ga0316576_10021801
316 Ga0316576_10046238
317 Ga0316576_10195046
318 Ga0316576_10320883
319 Ga0316578_10024896
320 Ga0316578_10030566
321 Ga0316578_10069037
322 Ga0316578_10276691
323 Ga0316578_10355890
324 Ga0307516_10045933
325 Ga0316577_10005285
326 Ga0307406_10216641
327 Ga0307416_100322480
328 Ga0307415_100031643
329 Ga0307415_100181391
330 Ga0316585_10130466
331 Ga0316580_10051728
332 Ga0373944_0226959
333 Ga0373949_0002814
334 Ga0373939_0015253
335 Ga0373961_0000104
336 Ga0316574_0022859
337 Ga0316574_0025235
338 Ga0316574_0440932
339 Ga0316574_0515626
340 Ga0316582_0036210
341 Ga0316582_0243289
342 Ga0316582_0289744
343 Ga0316584_0000475
344 Ga0316584_0088044
345 Ga0316584_0155946
346 Ga0395899_0203866
347 Ga0395899_0217506
348 Ga0395900_0028629
349 Ga0395905_0166462
350 Ga0395905_0513662
351 Ga0395905_0778317
352 Ga0395901_0474016
353 Ga0400483_014093
354 Ga0400483_015477
355 Ga0400483_238989
356 Ga0400483_286416
357 Ga0436365_1276763
358 Ga0436365_1457573
359 Ga0436363_0932783
360 Ga0436362_1208414
361 Ga0451789_1272865
362 Ga0451791_1559677
363 Ga0451793_1750199
364 Ga0451797_1066231
365 Ga0451807_0889901
366 Ga0451807_0915378
367 Ga0451807_2215253
368 Ga0451837_1791215
369 Ga0451577_0033338
370 Ga0451577_0961029
371 Ga0453684_0204254
372 Ga0453684_0494694
373 Ga0495603_0275436
374 Ga0495650_0034738
375 Ga0495596_0089949
376 Ga0495649_0339489
377 Ga0495676_0536008
378 Ga0495686_0003386
379 Ga0495686_0099426
380 Ga0496115_0819285
381 Ga0501299_144786
382 Ga0501031_0541200
383 Ga0501034_0074771
384 Ga0501034_0472563
385 Ga0501034_0502696
386 Ga0501037_0250359
387 Ga0501042_0121124
388 Ga0501047_0011415
389 Ga0501047_0304696
390 Ga0501067_0326578
391 Ga0501069_0375519
392 Ga0501070_0012683
393 Ga0501070_0114568
394 Ga0501070_0571343
395 Ga0501072_0153708
396 Ga0501073_0118858
397 Ga0501077_0699196
398 Ga0501227_135197
399 Ga0501225_0279450
400 Ga0501080_0177332
401 Ga0501080_1356211
402 Ga0501083_0066143
403 Ga0501280_000723
404 Ga0501044_0235764
405 nmdc:mga0qj67_381817_c1
406 nmdc:mga06r32_393595_c1
407 nmdc:mga0rr50_725105_c1
408 Ga0500646_0219637
409 Ga0500583_0125473
410 Ga0500566_0001243
411 Ga0500566_0008808
412 Ga0500566_0144346
413 Ga0500640_012203
414 Ga0500554_000201
415 Ga0500562_031570
416 Ga0500595_000239
417 Ga0500597_074074
418 Ga0500607_204944
419 Ga0500614_000774
420 Ga0500559_0002878
421 Ga0500603_002451
422 Ga0500639_131204
423 Ga0500636_0248329
424 Ga0500637_0113848
425 Ga0500637_0157274
426 Ga0500601_009483
427 Ga0501082_0553635
428 2644221463
429 2644338309
430 2722883686

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13669

Glyoxalase_4

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

39

145

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
3oa4-assembly1.cif.gz_A-2 crystal structure of hypothetical protein bh1468 from bacillus halodurans c-125 0.8491 5 142
6qh4-assembly2.cif.gz_B crystal structure of human methylmalonyl-coa epimerase (mcee) p.arg143cys variant 0.8244 7 141
6qh4-assembly2.cif.gz_D-2 crystal structure of human methylmalonyl-coa epimerase (mcee) p.arg143cys variant 0.822 8 141
6qh4-assembly1.cif.gz_A crystal structure of human methylmalonyl-coa epimerase (mcee) p.arg143cys variant 0.8201 8 141
6qh4-assembly1.cif.gz_C crystal structure of human methylmalonyl-coa epimerase (mcee) p.arg143cys variant 0.8187 8 141
ID Description Score Start End Superfamily
af_Q7KRR5_243_283_3.10.620.30 Alpha Beta;Roll;C8orf32 fold; 0.8568 34 62 3.10.620.30
3oa4A01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8491 5 142 3.10.180.10
3oa4A01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8373 5 142 3.10.180.10
af_L7N6B1_8_152_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8223 8 142 3.10.180.10
6qh4A00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8201 8 141 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A4Q3PYH1-F1-model_v4 deleted 1.001 80 145
AF-A0A418AES6-F1-model_v4 VOC domain-containing protein 0.9989 87 145
AF-A0A2N1V9T6-F1-model_v4 VOC domain-containing protein 0.9886 4 145 GO:0009058
GO:0016779
AF-A0A060NI05-F1-model_v4 Lactoylglutathione lyase and related lyase 0.9759 4 145 GO:0004493
GO:0016829
GO:0046491
GO:0046872
AF-A0A1G9VIK3-F1-model_v4 Lactoylglutathione lyase 0.9738 3 145 GO:0004493
GO:0016829
GO:0046491
GO:0046872

Map