F326746

General Info

Members Datasets Scaffolds Average Seq Length
215 153 209 139

Family's Representative Sequence

Representative Sequence 3300044659|Ga0466973_0524676|Ga0466973_0524676_48_521
Length 157
Sequence MTWHAGAARAGRRRVVDMMQQVSVITLGTTDLARSRRFYGDGFGWTPVFENDEIIFYQMNGLVLGTFLKAALEEDMNRAGLEQRGAFALAHNVAARELVAPLMERLVAAGGALLRPADAPPHGGFRGYVADPDEHAWEIAWNPGFAIDDEGRVRFGL

Samples

Sample ID Description Type Environment
1 2643221629 Devosia sp. Root105 Isolate Unclassified
2 2643221662 Devosia sp. Root413D1 Isolate Unclassified
3 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
4 2773857925 Microvirga vignae BR3299 Isolate Unclassified
5 2837651117 Pseudohoeflea suaedae YC6898 Isolate Unclassified
6 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
7 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
8 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
9 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
10 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
11 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
44 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
46 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
47 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
48 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
49 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
50 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
51 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
52 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
53 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
54 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
55 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
56 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
57 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
58 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
59 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
60 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
61 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
62 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
96 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
97 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
98 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
99 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
100 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
101 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
102 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
103 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
104 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
105 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
106 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
107 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
108 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
109 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
110 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
111 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
112 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
113 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
114 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
115 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
116 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
117 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
118 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
119 3300044659 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E Metagenome Unclassified
120 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
121 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
122 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
123 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
124 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
125 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
126 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
127 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
128 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
129 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
130 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
131 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
132 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
133 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
134 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
135 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
136 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
138 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
139 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
140 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
141 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
142 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
144 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
145 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
146 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
147 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
148 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
149 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
150 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
151 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
152 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
153 8054563764 Acuticoccus kalidii M5D2P5 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.21
Metatranscriptomes 0
Isolates 2.79

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.02
Nodule 0
Rhizoplane 1.4
Rhizosphere 78.14
Stem 0
Stem Tuber 0
Unclassified 7.44

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25153J46596_10040469 3300003215 Bacteria 1444
2 Ga0055536_1010696 3300003781 Bacteria 3607
3 Ga0055536_1066073 3300003781 Bacteria 730
4 Ga0055534_1002506 3300003784 Bacteria 6311
5 Ga0055530_10002430 3300003791 Bacteria 12047
6 Ga0055530_10086947 3300003791 Bacteria 647
7 Ga0055531_10001198 3300003794 Bacteria 19883
8 Ga0055531_10027713 3300003794 Bacteria 1978
9 Ga0065165_1150694 3300005262 Bacteria 543
10 Ga0070658_10020356 3300005327 Bacteria 5317
11 Ga0070683_100009758 3300005329 Bacteria 8223
12 Ga0070670_100154090 3300005331 Bacteria 1989
13 Ga0070670_100171074 3300005331 Bacteria 1884
14 Ga0070666_10015127 3300005335 Bacteria 4920
15 Ga0070660_100004695 3300005339 Bacteria 9459
16 Ga0070660_100946530 3300005339 Bacteria 727
17 Ga0070661_100097241 3300005344 Bacteria 2186
18 Ga0070661_100279844 3300005344 Bacteria 1294
19 Ga0070668_100000006 3300005347 Bacteria 176486
20 Ga0070671_100000310 3300005355 Bacteria 33094
21 Ga0070674_100331501 3300005356 Bacteria 1223
22 Ga0070659_101087971 3300005366 Bacteria 704
23 Ga0070667_100000003 3300005367 Bacteria 447715
24 Ga0070713_100098227 3300005436 Bacteria 2532
25 Ga0070710_10421782 3300005437 Bacteria 899
26 Ga0070663_100044660 3300005455 Bacteria 3126
27 Ga0070662_100720051 3300005457 Bacteria 845
28 Ga0070681_10208007 3300005458 Bacteria 1873
29 Ga0070681_10753205 3300005458 Bacteria 890
30 Ga0070679_100263164 3300005530 Bacteria 1680
31 Ga0070684_100059111 3300005535 Bacteria 3351
32 Ga0068853_100186524 3300005539 Bacteria 1883
33 Ga0070665_100044389 3300005548 Bacteria 4463
34 Ga0070665_100592173 3300005548 Bacteria 1122
35 Ga0068855_100000398 3300005563 Bacteria 53640
36 Ga0070664_100011511 3300005564 Bacteria 7180
37 Ga0070664_100271739 3300005564 Bacteria 1527
38 Ga0068854_100761374 3300005578 Bacteria 841
39 Ga0068852_100121725 3300005616 Bacteria 2390
40 Ga0068859_100031919 3300005617 Bacteria 5291
41 Ga0068859_100536461 3300005617 Bacteria 1265
42 Ga0068864_100002014 3300005618 Bacteria 16753
43 Ga0068861_100372381 3300005719 Bacteria 1259
44 Ga0068863_100004449 3300005841 Bacteria 13822
45 Ga0068863_100007661 3300005841 Bacteria 10562
46 Ga0068858_100004181 3300005842 Bacteria 14205
47 Ga0068860_100000068 3300005843 Bacteria 179208
48 Ga0068862_100000075 3300005844 Bacteria 117819
49 Ga0068862_100000160 3300005844 Bacteria 74917
50 Ga0075362_10051999 3300006177 Bacteria 1835
51 Ga0097620_100031919 3300006931 Bacteria 5291
52 Ga0097620_100536434 3300006931 Bacteria 1265
53 Ga0105240_10003426 3300009093 Bacteria 24643
54 Ga0105240_10101305 3300009093 Bacteria 3503
55 Ga0105240_10329204 3300009093 Unclassified 1739
56 Ga0105247_10002664 3300009101 Bacteria 12019
57 Ga0105247_11765613 3300009101 Bacteria 514
58 Ga0105241_10204884 3300009174 Bacteria 1650
59 Ga0105241_10264116 3300009174 Bacteria 1464
60 Ga0105238_10059378 3300009551 Bacteria 3832
61 Ga0105238_10070699 3300009551 Bacteria 3489
62 Ga0105249_10000389 3300009553 Bacteria 43107
63 Ga0105239_10496084 3300010375 Bacteria 1388
64 Ga0157371_10082580 3300013102 Bacteria 2275
65 Ga0157370_10667064 3300013104 Bacteria 950
66 Ga0157370_10684338 3300013104 Bacteria 936
67 Ga0157370_10791523 3300013104 Bacteria 863
68 Ga0157369_10171064 3300013105 Bacteria 2289
69 Ga0157369_10833990 3300013105 Bacteria 947
70 Ga0157372_10647542 3300013307 Bacteria 1231
71 Ga0182008_10040687 3300014497 Bacteria 2320
72 Ga0157376_10946578 3300014969 Bacteria 882
73 Ga0213876_10006188 3300021384 Bacteria 6530
74 Ga0209148_1030435 3300025254 Bacteria 808
75 Ga0209675_1000135 3300025291 Bacteria 100154
76 Ga0209676_1003165 3300025292 Bacteria 10482
77 Ga0209676_1006910 3300025292 Bacteria 5479
78 Ga0209758_1001260 3300025297 Bacteria 31379
79 Ga0209050_1000073 3300025298 Bacteria 292046
80 Ga0209050_1065675 3300025298 Bacteria 834
81 Ga0209257_1000099 3300025304 Bacteria 255304
82 Ga0209257_1003291 3300025304 Bacteria 14079
83 Ga0207692_10100051 3300025898 Bacteria 1589
84 Ga0207710_10002312 3300025900 Bacteria 8904
85 Ga0207680_10014350 3300025903 Bacteria 4096
86 Ga0207680_10236195 3300025903 Bacteria 1258
87 Ga0207647_10717682 3300025904 Bacteria 544
88 Ga0207705_10001867 3300025909 Bacteria 16531
89 Ga0207707_10800894 3300025912 Bacteria 785
90 Ga0207695_10007009 3300025913 Bacteria 14458
91 Ga0207695_10338838 3300025913 Bacteria 1392
92 Ga0207695_10371605 3300025913 Bacteria 1316
93 Ga0207657_10019967 3300025919 Bacteria 6347
94 Ga0207657_10729821 3300025919 Bacteria 768
95 Ga0207649_10123398 3300025920 Bacteria 1749
96 Ga0207681_10095130 3300025923 Bacteria 2136
97 Ga0207694_10083444 3300025924 Bacteria 2513
98 Ga0207694_10210778 3300025924 Bacteria 1583
99 Ga0207650_10014845 3300025925 Bacteria 5418
100 Ga0207650_10060315 3300025925 Bacteria 2831
101 Ga0207650_10320680 3300025925 Bacteria 1269
102 Ga0207644_10000124 3300025931 Bacteria 56579
103 Ga0207644_10129110 3300025931 Bacteria 1933
104 Ga0207690_10138244 3300025932 Bacteria 1792
105 Ga0207690_10715766 3300025932 Bacteria 824
106 Ga0207711_10344127 3300025941 Bacteria 1380
107 Ga0207661_10217122 3300025944 Bacteria 1688
108 Ga0207679_10011629 3300025945 Bacteria 5712
109 Ga0207679_10341821 3300025945 Bacteria 1302
110 Ga0207667_10006774 3300025949 Bacteria 13837
111 Ga0207667_10101922 3300025949 Bacteria 2961
112 Ga0207667_10998866 3300025949 Bacteria 824
113 Ga0207712_10000012 3300025961 Bacteria 392363
114 Ga0207668_10000026 3300025972 Bacteria 128309
115 Ga0207640_10442798 3300025981 Bacteria 1069
116 Ga0207658_10000002 3300025986 Bacteria 1364188
117 Ga0207703_10002381 3300026035 Bacteria 16348
118 Ga0207678_10012743 3300026067 Bacteria 7384
119 Ga0207641_10000179 3300026088 Bacteria 88061
120 Ga0207641_10027742 3300026088 Bacteria 4677
121 Ga0207641_10338326 3300026088 Bacteria 1431
122 Ga0207676_10003561 3300026095 Bacteria 11002
123 Ga0207675_100417487 3300026118 Bacteria 1325
124 Ga0207698_10020805 3300026142 Bacteria 4524
125 Ga0207698_10047577 3300026142 Bacteria 3251
126 Ga0207698_10070970 3300026142 Bacteria 2762
127 Ga0268266_10025857 3300028379 Bacteria 4994
128 Ga0268266_11644219 3300028379 Bacteria 618
129 Ga0268265_10000087 3300028380 Bacteria 117852
130 Ga0268265_10001260 3300028380 Bacteria 21840
131 Ga0268264_10000103 3300028381 Bacteria 222439
132 Ga0265334_10026290 3300028573 Bacteria 2350
133 Ga0265331_10493575 3300031250 Bacteria 551
134 Ga0307513_10005418 3300031456 Bacteria 16866
135 Ga0265342_10113929 3300031712 Bacteria 1528
136 Ga0307516_10000115 3300031730 Bacteria 92959
137 Ga0307413_10258214 3300031824 Bacteria 1297
138 Ga0307410_11774779 3300031852 Bacteria 548
139 Ga0307406_11540028 3300031901 Bacteria 586
140 Ga0307407_10387987 3300031903 Unclassified 999
141 Ga0307409_100084106 3300031995 Bacteria 2583
142 Ga0307416_102476419 3300032002 Bacteria 618
143 Ga0307414_10002995 3300032004 Bacteria 8950
144 Ga0307414_10006869 3300032004 Bacteria 6368
145 Ga0307414_10173987 3300032004 Bacteria 1724
146 Ga0307414_11080808 3300032004 Unclassified 740
147 Ga0307411_10030394 3300032005 Bacteria 3311
148 Ga0307411_10568935 3300032005 Bacteria 970
149 Ga0373940_0092877 3300035088 Bacteria 906
150 Ga0373939_0038544 3300035114 Bacteria 1426
151 Ga0373937_0313877 3300036401 Bacteria 1483
152 Ga0373925_0775527 3300037068 Bacteria 790
153 Ga0395899_0008999 3300037312 Bacteria 7676
154 Ga0395899_0116766 3300037312 Bacteria 1914
155 Ga0395900_0013056 3300037418 Bacteria 8491
156 Ga0395900_0022071 3300037418 Bacteria 6511
157 Ga0395900_0034833 3300037418 Bacteria 5186
158 Ga0395900_0630665 3300037418 Bacteria 1010
159 Ga0395898_0114492 3300037466 Bacteria 2584
160 Ga0395898_0209489 3300037466 Bacteria 1859
161 Ga0395905_0869038 3300037471 Bacteria 805
162 Ga0395905_1673112 3300037471 Bacteria 541
163 Ga0395901_0001419 3300038443 Bacteria 24996
164 Ga0395901_0043932 3300038443 Bacteria 4634
165 Ga0395901_0443489 3300038443 Bacteria 1328
166 Ga0436365_1614905 3300039437 Bacteria 8956
167 Ga0451841_0351403 3300041498 Bacteria 574
168 Ga0466973_0524676 3300044659 Bacteria 657
169 Ga0495638_0019313 3300046460 Bacteria 4509
170 Ga0495606_0440054 3300046507 Bacteria 670
171 Ga0495644_0427397 3300046523 Bacteria 526
172 Ga0495648_0243592 3300046524 Bacteria 872
173 Ga0495686_0007267 3300047472 Bacteria 8330
174 Ga0495686_0021831 3300047472 Bacteria 4243
175 Ga0495686_0068917 3300047472 Bacteria 2182
176 Ga0496102_1869647 3300048905 Unclassified 517
177 Ga0496106_0508729 3300048909 Bacteria 967
178 Ga0496109_0511926 3300048912 Bacteria 1133
179 Ga0496117_0250297 3300048920 Unclassified 967
180 Ga0496119_0000916 3300048922 Bacteria 38180
181 Ga0496122_0007420 3300048925 Bacteria 12190
182 Ga0496123_0000792 3300048926 Bacteria 51045
183 Ga0496125_0296372 3300048928 Bacteria 993
184 Ga0495678_157518 3300049459 Bacteria 728
185 Ga0501033_0311819 3300049570 Bacteria 1106
186 Ga0501034_0358338 3300049571 Bacteria 1386
187 Ga0501034_0525737 3300049571 Bacteria 1094
188 Ga0501034_1442989 3300049571 Bacteria 563
189 Ga0501043_0046049 3300049579 Bacteria 3429
190 Ga0501046_0988452 3300049580 Bacteria 584
191 Ga0501047_0000888 3300049581 Bacteria 30514
192 Ga0501047_0648312 3300049581 Bacteria 875
193 Ga0501069_0540702 3300049585 Bacteria 697
194 Ga0501070_0756162 3300049586 Bacteria 766
195 Ga0501083_0845595 3300049744 Unclassified 595
196 Ga0501035_0217105 3300049822 Bacteria 1634
197 Ga0501044_0084417 3300049823 Bacteria 3210
198 Ga0501044_0735992 3300049823 Bacteria 869
199 Ga0501044_1006012 3300049823 Unclassified 705
200 nmdc:mga03683_51239_c1 3300050489 Bacteria 1722
201 Ga0500556_0000033 3300053104 Bacteria 147801
202 Ga0500658_0517564 3300053134 Bacteria 539
203 Ga0500559_0014974 3300053136 Bacteria 3278
204 Ga0500568_0021075 3300053139 Bacteria 2810
205 Ga0500616_0019053 3300053153 Bacteria 3874
206 Ga0500616_0344617 3300053153 Bacteria 607
207 Ga0500638_264960 3300053162 Bacteria 683
208 Ga0500645_005274 3300053730 Bacteria 4789
209 Ga0501082_0050842 3300060353 Bacteria 3574

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005844 Ga0068862_100000075 Ga0068862_1000000755 122
2 3300028380 Ga0268265_10000087 Ga0268265_100000874 122
3 3300037068 Ga0373925_0775527 Ga0373925_0775527_17_418 122
4 3300005841 Ga0068863_100007661 Ga0068863_1000076611 123
5 3300009553 Ga0105249_10000389 Ga0105249_1000038934 123
6 3300025961 Ga0207712_10000012 Ga0207712_10000012381 123
7 3300026088 Ga0207641_10338326 Ga0207641_103383262 123
8 3300005436 Ga0070713_100098227 Ga0070713_1000982274 129
9 3300005437 Ga0070710_10421782 Ga0070710_104217822 129
10 3300025898 Ga0207692_10100051 Ga0207692_101000512 129
11 3300005262 Ga0065165_1150694 Ga0065165_11506941 134
12 3300005331 Ga0070670_100154090 Ga0070670_1001540901 134
13 3300005335 Ga0070666_10015127 Ga0070666_100151275 134
14 3300005347 Ga0070668_100000006 Ga0070668_10000000663 134
15 3300005355 Ga0070671_100000310 Ga0070671_10000031013 134
16 3300005367 Ga0070667_100000003 Ga0070667_100000003169 134
17 3300005617 Ga0068859_100031919 Ga0068859_1000319192 134
18 3300005842 Ga0068858_100004181 Ga0068858_1000041813 134
19 3300005843 Ga0068860_100000068 Ga0068860_10000006815 134
20 3300005844 Ga0068862_100000160 Ga0068862_10000016016 134
21 3300006931 Ga0097620_100031919 Ga0097620_1000319195 134
22 3300025903 Ga0207680_10014350 Ga0207680_100143501 134
23 3300025925 Ga0207650_10014845 Ga0207650_100148452 134
24 3300025931 Ga0207644_10000124 Ga0207644_1000012435 134
25 3300025972 Ga0207668_10000026 Ga0207668_1000002627 134
26 3300025986 Ga0207658_10000002 Ga0207658_100000021071 134
27 3300026035 Ga0207703_10002381 Ga0207703_100023815 134
28 3300026088 Ga0207641_10027742 Ga0207641_100277426 134
29 3300028380 Ga0268265_10001260 Ga0268265_1000126018 134
30 3300028381 Ga0268264_10000103 Ga0268264_1000010361 134
31 iso_pu_bacteria 8054563764 8054565457 135
32 3300005719 Ga0068861_100372381 Ga0068861_1003723812 136
33 3300026118 Ga0207675_100417487 Ga0207675_1004174872 136
34 iso_pu_bacteria 2643221629 2644168929 136
35 iso_pu_bacteria 2643221662 2644347481 136
36 iso_pu_bacteria 2758568016 2758643035 136
37 iso_pu_bacteria 2773857925 2774870983 136
38 iso_pu_bacteria 2837651117 2837653002 136
39 3300003781 Ga0055536_1010696 Ga0055536_10106965 139
40 3300005327 Ga0070658_10020356 Ga0070658_100203562 139
41 3300005339 Ga0070660_100004695 Ga0070660_10000469512 139
42 3300005366 Ga0070659_101087971 Ga0070659_1010879712 139
43 3300005455 Ga0070663_100044660 Ga0070663_1000446603 139
44 3300005457 Ga0070662_100720051 Ga0070662_1007200512 139
45 3300005564 Ga0070664_100271739 Ga0070664_1002717391 139
46 3300009101 Ga0105247_11765613 Ga0105247_117656131 139
47 3300013102 Ga0157371_10082580 Ga0157371_100825803 139
48 3300013104 Ga0157370_10667064 Ga0157370_106670642 139
49 3300025292 Ga0209676_1003165 Ga0209676_10031658 139
50 3300025909 Ga0207705_10001867 Ga0207705_1000186710 139
51 3300025919 Ga0207657_10019967 Ga0207657_100199675 139
52 3300025932 Ga0207690_10138244 Ga0207690_101382442 139
53 3300025945 Ga0207679_10341821 Ga0207679_103418213 139
54 3300025981 Ga0207640_10442798 Ga0207640_104427981 139
55 3300026067 Ga0207678_10012743 Ga0207678_100127439 139
56 3300026142 Ga0207698_10047577 Ga0207698_100475773 139
57 3300026142 Ga0207698_10070970 Ga0207698_100709705 139
58 3300031824 Ga0307413_10258214 Ga0307413_102582142 139
59 3300031903 Ga0307407_10387987 Ga0307407_103879872 139
60 3300031995 Ga0307409_100084106 Ga0307409_1000841064 139
61 3300032002 Ga0307416_102476419 Ga0307416_1024764191 139
62 3300032004 Ga0307414_10173987 Ga0307414_101739872 139
63 3300032005 Ga0307411_10030394 Ga0307411_100303942 139
64 3300037312 Ga0395899_0008999 Ga0395899_0008999_5349_5768 139
65 3300037418 Ga0395900_0013056 Ga0395900_0013056_748_1167 139
66 3300037418 Ga0395900_0630665 Ga0395900_0630665_181_600 139
67 3300037466 Ga0395898_0209489 Ga0395898_0209489_1334_1753 139
68 3300038443 Ga0395901_0443489 Ga0395901_0443489_681_1100 139
69 3300046460 Ga0495638_0019313 Ga0495638_0019313_3602_4021 139
70 3300046507 Ga0495606_0440054 Ga0495606_0440054_208_627 139
71 3300047472 Ga0495686_0021831 Ga0495686_0021831_61_480 139
72 3300048912 Ga0496109_0511926 Ga0496109_0511926_517_939 139
73 3300053136 Ga0500559_0014974 Ga0500559_0014974_1665_2084 139
74 3300003781 Ga0055536_1066073 Ga0055536_10660731 140
75 3300003784 Ga0055534_1002506 Ga0055534_10025062 140
76 3300003791 Ga0055530_10086947 Ga0055530_100869471 140
77 3300003794 Ga0055531_10027713 Ga0055531_100277131 140
78 3300005329 Ga0070683_100009758 Ga0070683_1000097586 140
79 3300005331 Ga0070670_100171074 Ga0070670_1001710742 140
80 3300005339 Ga0070660_100946530 Ga0070660_1009465301 140
81 3300005344 Ga0070661_100097241 Ga0070661_1000972412 140
82 3300005344 Ga0070661_100279844 Ga0070661_1002798442 140
83 3300005356 Ga0070674_100331501 Ga0070674_1003315011 140
84 3300005458 Ga0070681_10208007 Ga0070681_102080071 140
85 3300005458 Ga0070681_10753205 Ga0070681_107532051 140
86 3300005530 Ga0070679_100263164 Ga0070679_1002631642 140
87 3300005535 Ga0070684_100059111 Ga0070684_1000591112 140
88 3300005539 Ga0068853_100186524 Ga0068853_1001865243 140
89 3300005548 Ga0070665_100044389 Ga0070665_1000443894 140
90 3300005548 Ga0070665_100592173 Ga0070665_1005921731 140
91 3300005563 Ga0068855_100000398 Ga0068855_10000039818 140
92 3300005564 Ga0070664_100011511 Ga0070664_1000115115 140
93 3300005578 Ga0068854_100761374 Ga0068854_1007613741 140
94 3300005616 Ga0068852_100121725 Ga0068852_1001217253 140
95 3300005617 Ga0068859_100536461 Ga0068859_1005364612 140
96 3300005618 Ga0068864_100002014 Ga0068864_1000020148 140
97 3300005841 Ga0068863_100004449 Ga0068863_1000044498 140
98 3300006177 Ga0075362_10051999 Ga0075362_100519993 140
99 3300006931 Ga0097620_100536434 Ga0097620_1005364342 140
100 3300009093 Ga0105240_10003426 Ga0105240_100034268 140
101 3300009093 Ga0105240_10101305 Ga0105240_101013054 140
102 3300009093 Ga0105240_10329204 Ga0105240_103292042 140
103 3300009101 Ga0105247_10002664 Ga0105247_100026645 140
104 3300009174 Ga0105241_10204884 Ga0105241_102048842 140
105 3300009174 Ga0105241_10264116 Ga0105241_102641162 140
106 3300009551 Ga0105238_10059378 Ga0105238_100593784 140
107 3300009551 Ga0105238_10070699 Ga0105238_100706993 140
108 3300010375 Ga0105239_10496084 Ga0105239_104960842 140
109 3300013104 Ga0157370_10684338 Ga0157370_106843382 140
110 3300013104 Ga0157370_10791523 Ga0157370_107915231 140
111 3300013105 Ga0157369_10171064 Ga0157369_101710642 140
112 3300013105 Ga0157369_10833990 Ga0157369_108339902 140
113 3300013307 Ga0157372_10647542 Ga0157372_106475422 140
114 3300014497 Ga0182008_10040687 Ga0182008_100406873 140
115 3300014969 Ga0157376_10946578 Ga0157376_109465782 140
116 3300021384 Ga0213876_10006188 Ga0213876_100061889 140
117 3300025254 Ga0209148_1030435 Ga0209148_10304352 140
118 3300025291 Ga0209675_1000135 Ga0209675_100013553 140
119 3300025292 Ga0209676_1006910 Ga0209676_10069104 140
120 3300025298 Ga0209050_1065675 Ga0209050_10656751 140
121 3300025304 Ga0209257_1003291 Ga0209257_10032911 140
122 3300025900 Ga0207710_10002312 Ga0207710_1000231212 140
123 3300025903 Ga0207680_10236195 Ga0207680_102361951 140
124 3300025904 Ga0207647_10717682 Ga0207647_107176822 140
125 3300025912 Ga0207707_10800894 Ga0207707_108008942 140
126 3300025913 Ga0207695_10007009 Ga0207695_1000700910 140
127 3300025913 Ga0207695_10338838 Ga0207695_103388382 140
128 3300025913 Ga0207695_10371605 Ga0207695_103716052 140
129 3300025919 Ga0207657_10729821 Ga0207657_107298211 140
130 3300025920 Ga0207649_10123398 Ga0207649_101233982 140
131 3300025923 Ga0207681_10095130 Ga0207681_100951302 140
132 3300025924 Ga0207694_10083444 Ga0207694_100834444 140
133 3300025924 Ga0207694_10210778 Ga0207694_102107781 140
134 3300025925 Ga0207650_10060315 Ga0207650_100603152 140
135 3300025925 Ga0207650_10320680 Ga0207650_103206802 140
136 3300025931 Ga0207644_10129110 Ga0207644_101291101 140
137 3300025932 Ga0207690_10715766 Ga0207690_107157662 140
138 3300025941 Ga0207711_10344127 Ga0207711_103441271 140
139 3300025944 Ga0207661_10217122 Ga0207661_102171222 140
140 3300025945 Ga0207679_10011629 Ga0207679_100116294 140
141 3300025949 Ga0207667_10006774 Ga0207667_100067742 140
142 3300025949 Ga0207667_10101922 Ga0207667_101019224 140
143 3300025949 Ga0207667_10998866 Ga0207667_109988662 140
144 3300026088 Ga0207641_10000179 Ga0207641_1000017960 140
145 3300026095 Ga0207676_10003561 Ga0207676_100035617 140
146 3300026142 Ga0207698_10020805 Ga0207698_100208054 140
147 3300028379 Ga0268266_10025857 Ga0268266_100258574 140
148 3300028379 Ga0268266_11644219 Ga0268266_116442192 140
149 3300028573 Ga0265334_10026290 Ga0265334_100262902 140
150 3300031250 Ga0265331_10493575 Ga0265331_104935751 140
151 3300031456 Ga0307513_10005418 Ga0307513_1000541815 140
152 3300031712 Ga0265342_10113929 Ga0265342_101139291 140
153 3300031730 Ga0307516_10000115 Ga0307516_1000011567 140
154 3300031852 Ga0307410_11774779 Ga0307410_117747791 140
155 3300031901 Ga0307406_11540028 Ga0307406_115400282 140
156 3300032004 Ga0307414_10002995 Ga0307414_100029957 140
157 3300032004 Ga0307414_10006869 Ga0307414_100068693 140
158 3300032004 Ga0307414_11080808 Ga0307414_110808081 140
159 3300035088 Ga0373940_0092877 Ga0373940_0092877_349_771 140
160 3300035114 Ga0373939_0038544 Ga0373939_0038544_819_1241 140
161 3300036401 Ga0373937_0313877 Ga0373937_0313877_658_1080 140
162 3300037312 Ga0395899_0116766 Ga0395899_0116766_429_851 140
163 3300037418 Ga0395900_0022071 Ga0395900_0022071_5129_5551 140
164 3300037471 Ga0395905_0869038 Ga0395905_0869038_337_771 140
165 3300038443 Ga0395901_0001419 Ga0395901_0001419_21331_21753 140
166 3300039437 Ga0436365_1614905 Ga0436365_1614905_5583_6005 140
167 3300041498 Ga0451841_0351403 Ga0451841_0351403_93_515 140
168 3300044659 Ga0466973_0524676 Ga0466973_0524676_48_521 140
169 3300046524 Ga0495648_0243592 Ga0495648_0243592_35_457 140
170 3300047472 Ga0495686_0007267 Ga0495686_0007267_260_682 140
171 3300047472 Ga0495686_0068917 Ga0495686_0068917_270_692 140
172 3300048905 Ga0496102_1869647 Ga0496102_1869647_31_453 140
173 3300048909 Ga0496106_0508729 Ga0496106_0508729_305_727 140
174 3300048920 Ga0496117_0250297 Ga0496117_0250297_61_483 140
175 3300048922 Ga0496119_0000916 Ga0496119_0000916_197_619 140
176 3300048925 Ga0496122_0007420 Ga0496122_0007420_3970_4392 140
177 3300048926 Ga0496123_0000792 Ga0496123_0000792_47131_47553 140
178 3300048928 Ga0496125_0296372 Ga0496125_0296372_237_662 140
179 3300049459 Ga0495678_157518 Ga0495678_157518_280_702 140
180 3300049570 Ga0501033_0311819 Ga0501033_0311819_25_447 140
181 3300049571 Ga0501034_0358338 Ga0501034_0358338_802_1224 140
182 3300049571 Ga0501034_0525737 Ga0501034_0525737_644_1066 140
183 3300049571 Ga0501034_1442989 Ga0501034_1442989_127_549 140
184 3300049579 Ga0501043_0046049 Ga0501043_0046049_628_1101 140
185 3300049580 Ga0501046_0988452 Ga0501046_0988452_29_451 140
186 3300049581 Ga0501047_0000888 Ga0501047_0000888_29447_29920 140
187 3300049581 Ga0501047_0648312 Ga0501047_0648312_53_475 140
188 3300049585 Ga0501069_0540702 Ga0501069_0540702_203_625 140
189 3300049586 Ga0501070_0756162 Ga0501070_0756162_217_639 140
190 3300049744 Ga0501083_0845595 Ga0501083_0845595_118_540 140
191 3300049822 Ga0501035_0217105 Ga0501035_0217105_551_1024 140
192 3300049823 Ga0501044_0084417 Ga0501044_0084417_2500_2973 140
193 3300049823 Ga0501044_0735992 Ga0501044_0735992_89_511 140
194 3300049823 Ga0501044_1006012 Ga0501044_1006012_59_481 140
195 3300050489 nmdc:mga03683_51239_c1 nmdc:mga03683_51239_c1_1236_1667 140
196 3300053104 Ga0500556_0000033 Ga0500556_0000033_116511_116933 140
197 3300053134 Ga0500658_0517564 Ga0500658_0517564_100_522 140
198 3300053139 Ga0500568_0021075 Ga0500568_0021075_2360_2782 140
199 3300053153 Ga0500616_0019053 Ga0500616_0019053_632_1054 140
200 3300053153 Ga0500616_0344617 Ga0500616_0344617_123_545 140
201 3300053162 Ga0500638_264960 Ga0500638_264960_100_522 140
202 3300053730 Ga0500645_005274 Ga0500645_005274_1296_1718 140
203 3300060353 Ga0501082_0050842 Ga0501082_0050842_1588_2010 140
204 3300003215 JGI25153J46596_10040469 JGI25153J46596_100404692 141
205 3300003791 Ga0055530_10002430 Ga0055530_1000243012 141
206 3300003794 Ga0055531_10001198 Ga0055531_100011989 141
207 3300025297 Ga0209758_1001260 Ga0209758_100126034 141
208 3300025298 Ga0209050_1000073 Ga0209050_100007345 141
209 3300025304 Ga0209257_1000099 Ga0209257_1000099252 141
210 3300032005 Ga0307411_10568935 Ga0307411_105689352 141
211 3300037418 Ga0395900_0034833 Ga0395900_0034833_69_494 141
212 3300037466 Ga0395898_0114492 Ga0395898_0114492_1829_2254 141
213 3300037471 Ga0395905_1673112 Ga0395905_1673112_87_512 141
214 3300038443 Ga0395901_0043932 Ga0395901_0043932_1017_1442 141
215 3300046523 Ga0495644_0427397 Ga0495644_0427397_54_479 141

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

21

139

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
3bqx-assembly1.cif.gz_A-2 high resolution crystal structure of a glyoxalase-related enzyme from fulvimarina pelagi 0.948 3 139
3bqx-assembly1.cif.gz_A-2 high resolution crystal structure of a glyoxalase-related enzyme from fulvimarina pelagi 0.9283 3 139
2rbb-assembly1.cif.gz_B crystal structure of a glyoxalase/bleomycin resistance protein/dioxygenase family enzyme from burkholderia phytofirmans psjn 0.9075 3 124
4pav-assembly2.cif.gz_B structure of hypothetical protein sa1046 from s. aureus. 0.8713 1 124
4pav-assembly1.cif.gz_A structure of hypothetical protein sa1046 from s. aureus. 0.8685 1 124
ID Description Score Start End Superfamily
3bqxA00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9439 3 139 3.10.180.10
3bqxA00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9239 3 139 3.10.180.10
2kjzB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8897 70 125 3.30.720.110
2rbbB00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8838 3 124 3.10.180.10
4pavC00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8799 4 124 3.10.180.10
ID Description Score Start End GO Terms
AF-Q1YK37-F1-model_v4 Possible glyoxalase/bleomycin resistance protein 0.9428 1 138
AF-H0QKS0-F1-model_v4 Putative drug resistance protein 0.938 15 137
AF-A0A3C2E4E1-F1-model_v4 Glyoxalase 0.9375 34 141
AF-Q0G7J9-F1-model_v4 VOC domain-containing protein 0.9352 2 141
AF-A0A3C2E4E1-F1-model_v4 Glyoxalase 0.9292 34 141

Feature Viewer

pLDDT pTM Quality
92.21 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map