F326626

General Info

Members Datasets Scaffolds Average Seq Length
215 88 215 65

Family's Representative Sequence

Representative Sequence 3300032168|Ga0316593_10000325|Ga0316593_100003256
Length 71
Sequence MDAKELRTKNEVQLKEELQGLLREQFNLRMQKGTGQLSNTARMKSVRRDVARVMTIMNEKKMNEKSAGDAE

Samples

Sample ID Description Type Environment
1 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
2 3300003305 Avena fatua rhizosphere microbial communities - H3_Rhizo_Litter_13 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
6 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
7 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
8 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
9 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
10 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
11 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
12 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
13 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
14 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
15 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
16 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
17 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
18 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
19 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
20 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
21 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
22 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
23 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
24 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
25 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
26 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
27 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
28 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
29 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
30 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
31 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
32 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
33 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
34 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
35 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
36 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
37 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
38 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
39 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
40 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
41 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
42 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
43 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
44 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
45 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
46 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
47 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
48 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
49 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
50 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
51 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
52 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
53 3300041446 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaT Metatranscriptome Rhizoplane
54 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
55 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
56 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
57 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
58 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
59 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
60 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
61 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
62 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
63 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
64 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
65 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
66 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
67 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
68 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
69 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
70 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
71 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
72 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
73 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
74 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
75 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
76 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
77 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
78 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
79 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
80 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
81 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
82 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
83 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
84 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
85 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
86 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
87 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
88 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 67.91
Metatranscriptomes 32.09
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.33
Nodule 0
Rhizoplane 2.79
Rhizosphere 83.72
Stem 0
Stem Tuber 0
Unclassified 11.16

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24735J21928_10021322 3300002067 Bacteria 1979
2 Ga0006770J48903_1007534 3300003305 Bacteria 6179
3 Ga0070658_10251686 3300005327 Bacteria 1499
4 Ga0070676_11165033 3300005328 Bacteria 585
5 Ga0075369_10209693 3300006186 Bacteria 900
6 Ga0075366_10828202 3300006195 Bacteria 576
7 Ga0207656_10417651 3300025321 Bacteria 676
8 Ga0207710_10174200 3300025900 Bacteria 1053
9 Ga0207671_10439485 3300025914 Bacteria 1038
10 Ga0207659_11370535 3300025926 Bacteria 606
11 Ga0207711_10787703 3300025941 Bacteria 886
12 Ga0207689_10507090 3300025942 Bacteria 1011
13 Ga0207667_10384500 3300025949 Bacteria 1430
14 Ga0207668_10133378 3300025972 Bacteria 1899
15 Ga0207658_10391411 3300025986 Bacteria 1219
16 Ga0207703_11957846 3300026035 Bacteria 562
17 Ga0207641_10210105 3300026088 Bacteria 1799
18 Ga0207698_12079661 3300026142 Bacteria 582
19 Ga0268266_10000001 3300028379 Bacteria 4040580
20 Ga0268266_11830821 3300028379 Bacteria 581
21 Ga0268265_10000444 3300028380 Bacteria 43696
22 Ga0268264_10008596 3300028381 Bacteria 8483
23 Ga0268264_10528301 3300028381 Bacteria 1154
24 Ga0307515_10915654 3300028794 Bacteria 509
25 Ga0265327_10174245 3300031251 Bacteria 987
26 Ga0307509_10056806 3300031507 Bacteria 4153
27 Ga0316575_10008308 3300031665 Bacteria 3777
28 Ga0316575_10019440 3300031665 Bacteria 2597
29 Ga0316575_10156269 3300031665 Bacteria 942
30 Ga0316575_10288068 3300031665 Bacteria 693
31 Ga0316575_10476323 3300031665 Bacteria 540
32 Ga0316579_10001358 3300031691 Bacteria 8860
33 Ga0316579_10070414 3300031691 Bacteria 1656
34 Ga0316579_10167856 3300031691 Bacteria 1061
35 Ga0316579_10477040 3300031691 Bacteria 603
36 Ga0316576_10057546 3300031727 Bacteria 2841
37 Ga0316576_10138081 3300031727 Bacteria 1834
38 Ga0316576_10182028 3300031727 Bacteria 1585
39 Ga0316576_10239571 3300031727 Bacteria 1363
40 Ga0316576_10459028 3300031727 Bacteria 940
41 Ga0316576_10851841 3300031727 Bacteria 654
42 Ga0316578_10010128 3300031728 Bacteria 4880
43 Ga0316578_10139542 3300031728 Bacteria 1460
44 Ga0316578_10222918 3300031728 Bacteria 1133
45 Ga0316578_10618266 3300031728 Bacteria 634
46 Ga0316578_10740835 3300031728 Bacteria 571
47 Ga0316578_10754134 3300031728 Bacteria 565
48 Ga0307516_10007119 3300031730 Bacteria 12924
49 Ga0316577_10007369 3300031733 Bacteria 5868
50 Ga0316577_10010745 3300031733 Bacteria 4947
51 Ga0316577_10018529 3300031733 Bacteria 3851
52 Ga0316577_10126121 3300031733 Bacteria 1439
53 Ga0307414_10233161 3300032004 Bacteria 1519
54 Ga0316583_10008555 3300032133 Bacteria 3690
55 Ga0316583_10073918 3300032133 Bacteria 1192
56 Ga0316583_10132732 3300032133 Bacteria 868
57 Ga0316583_10230824 3300032133 Bacteria 641
58 Ga0316585_10060190 3300032137 Bacteria 1226
59 Ga0316585_10090170 3300032137 Bacteria 1002
60 Ga0316585_10092229 3300032137 Bacteria 990
61 Ga0316585_10111834 3300032137 Bacteria 897
62 Ga0316585_10315985 3300032137 Bacteria 519
63 Ga0316580_10100669 3300032139 Bacteria 884
64 Ga0316593_10000027 3300032168 Bacteria 15426
65 Ga0316593_10000111 3300032168 Bacteria 10694
66 Ga0316593_10000325 3300032168 Bacteria 8199
67 Ga0316593_10000968 3300032168 Bacteria 5933
68 Ga0316593_10000996 3300032168 Bacteria 5864
69 Ga0316593_10001014 3300032168 Bacteria 5811
70 Ga0316593_10001440 3300032168 Bacteria 5247
71 Ga0316593_10002233 3300032168 Bacteria 4536
72 Ga0316593_10004408 3300032168 Bacteria 3612
73 Ga0316593_10007446 3300032168 Bacteria 3009
74 Ga0316593_10007460 3300032168 Bacteria 3007
75 Ga0316593_10017241 3300032168 Bacteria 2201
76 Ga0316593_10024635 3300032168 Bacteria 1910
77 Ga0316593_10025516 3300032168 Bacteria 1882
78 Ga0316593_10048202 3300032168 Bacteria 1434
79 Ga0316593_10080026 3300032168 Bacteria 1139
80 Ga0316593_10084810 3300032168 Bacteria 1110
81 Ga0316593_10094272 3300032168 Bacteria 1056
82 Ga0316593_10105565 3300032168 Bacteria 1003
83 Ga0316593_10164915 3300032168 Bacteria 810
84 Ga0316593_10175007 3300032168 Bacteria 788
85 Ga0316593_10223428 3300032168 Bacteria 700
86 Ga0316593_10241231 3300032168 Bacteria 675
87 Ga0316593_10348613 3300032168 Bacteria 566
88 Ga0316593_10447235 3300032168 Bacteria 504
89 Ga0307507_10039101 3300033179 Bacteria 4794
90 Ga0316592_1000006 3300033524 Bacteria 14706
91 Ga0316592_1003435 3300033524 Bacteria 2852
92 Ga0316592_1006806 3300033524 Bacteria 2213
93 Ga0316592_1151455 3300033524 Bacteria 547
94 Ga0316586_1000040 3300033527 Bacteria 8841
95 Ga0316586_1017886 3300033527 Bacteria 1147
96 Ga0316586_1036463 3300033527 Bacteria 855
97 Ga0316586_1039729 3300033527 Bacteria 825
98 Ga0316586_1065392 3300033527 Bacteria 665
99 Ga0316588_1021426 3300033528 Bacteria 1471
100 Ga0316588_1023318 3300033528 Bacteria 1419
101 Ga0316588_1032437 3300033528 Bacteria 1229
102 Ga0316588_1061356 3300033528 Bacteria 918
103 Ga0316588_1084893 3300033528 Bacteria 786
104 Ga0316587_1000021 3300033529 Bacteria 9386
105 Ga0316587_1001046 3300033529 Bacteria 3221
106 Ga0316587_1003352 3300033529 Bacteria 2236
107 Ga0316587_1014182 3300033529 Bacteria 1313
108 Ga0316587_1022652 3300033529 Bacteria 1078
109 Ga0316587_1022726 3300033529 Bacteria 1076
110 Ga0316587_1027561 3300033529 Bacteria 994
111 Ga0316587_1075974 3300033529 Bacteria 632
112 Ga0316587_1122247 3300033529 Unclassified 511
113 Ga0316596_1000016 3300033541 Bacteria 15149
114 Ga0316596_1000061 3300033541 Bacteria 12225
115 Ga0316596_1000070 3300033541 Bacteria 11847
116 Ga0316596_1000323 3300033541 Bacteria 7744
117 Ga0316596_1000651 3300033541 Bacteria 6226
118 Ga0316596_1001409 3300033541 Bacteria 4831
119 Ga0316596_1002088 3300033541 Bacteria 4213
120 Ga0316596_1002164 3300033541 Bacteria 4160
121 Ga0316596_1003277 3300033541 Bacteria 3527
122 Ga0316596_1004823 3300033541 Bacteria 3049
123 Ga0316596_1010023 3300033541 Bacteria 2285
124 Ga0316596_1012307 3300033541 Bacteria 2103
125 Ga0316596_1012710 3300033541 Bacteria 2074
126 Ga0316596_1020593 3300033541 Bacteria 1678
127 Ga0316596_1041022 3300033541 Bacteria 1216
128 Ga0316596_1129083 3300033541 Bacteria 690
129 Ga0316596_1212606 3300033541 Bacteria 540
130 Ga0316596_1216602 3300033541 Bacteria 535
131 Ga0316574_0005225 3300035398 Bacteria 6904
132 Ga0316574_0046734 3300035398 Bacteria 2685
133 Ga0316574_0101014 3300035398 Bacteria 1846
134 Ga0316574_0126201 3300035398 Bacteria 1645
135 Ga0316574_0165528 3300035398 Bacteria 1424
136 Ga0316574_0170847 3300035398 Bacteria 1400
137 Ga0316574_0454274 3300035398 Bacteria 802
138 Ga0316574_0544390 3300035398 Bacteria 721
139 Ga0316574_0715697 3300035398 Bacteria 613
140 Ga0316574_0808067 3300035398 Bacteria 571
141 Ga0316574_0837227 3300035398 Bacteria 559
142 Ga0316582_0000535 3300036647 Bacteria 14503
143 Ga0316582_0001466 3300036647 Bacteria 10378
144 Ga0316582_0004346 3300036647 Bacteria 7138
145 Ga0316582_0015971 3300036647 Bacteria 4307
146 Ga0316582_0027328 3300036647 Bacteria 3445
147 Ga0316582_0182476 3300036647 Bacteria 1428
148 Ga0316582_0533759 3300036647 Bacteria 808
149 Ga0316584_0002043 3300036712 Bacteria 12624
150 Ga0316584_0004999 3300036712 Bacteria 8833
151 Ga0316584_0015064 3300036712 Bacteria 5524
152 Ga0316584_0074355 3300036712 Bacteria 2547
153 Ga0316584_0129983 3300036712 Bacteria 1881
154 Ga0316584_0316770 3300036712 Bacteria 1126
155 Ga0316584_0588561 3300036712 Bacteria 773
156 Ga0316584_0874948 3300036712 Bacteria 606
157 Ga0316584_1033160 3300036712 Bacteria 548
158 Ga0316581_0001208 3300037588 Bacteria 5686
159 Ga0400484_44058 3300038725 Bacteria 9517
160 Ga0400490_07361 3300038726 Bacteria 19331
161 Ga0400485_02770 3300038735 Bacteria 7937
162 Ga0400485_19181 3300038735 Bacteria 55141
163 Ga0400488_27230 3300038741 Bacteria 2642
164 Ga0400488_44096 3300038741 Bacteria 1247
165 Ga0400486_25543 3300038742 Bacteria 57720
166 Ga0400486_25694 3300038742 Bacteria 15655
167 Ga0400486_30433 3300038742 Bacteria 1160
168 Ga0400483_049234 3300039062 Bacteria 1481
169 Ga0400483_085385 3300039062 Bacteria 1023
170 Ga0400483_141649 3300039062 Bacteria 8613
171 Ga0400483_153100 3300039062 Bacteria 13456
172 Ga0400483_208501 3300039062 Bacteria 3936
173 Ga0400483_211411 3300039062 Bacteria 9795
174 Ga0400483_238886 3300039062 Bacteria 2459
175 Ga0400487_02246 3300039110 Bacteria 22294
176 Ga0400487_07519 3300039110 Bacteria 4533
177 Ga0400487_13697 3300039110 Bacteria 2071
178 Ga0451794_22033 3300041446 Bacteria 572
179 Ga0451791_0721271 3300041451 Bacteria 769
180 Ga0451800_0821226 3300041459 Bacteria 1021
181 Ga0451853_3169985 3300041512 Bacteria 590
182 Ga0453684_1187460 3300044712 Bacteria 802
183 Ga0495632_0005327 3300046519 Bacteria 8538
184 Ga0495622_0530621 3300046557 Bacteria 502
185 Ga0495615_0152985 3300048090 Bacteria 688
186 Ga0496100_0824905 3300048903 Bacteria 727
187 Ga0496101_1127215 3300048904 Bacteria 616
188 Ga0496107_0417284 3300048910 Bacteria 998
189 Ga0501307_000537 3300049162 Bacteria 2662
190 Ga0501032_0126347 3300049569 Bacteria 1689
191 Ga0501033_0014950 3300049570 Bacteria 5891
192 Ga0501034_0010161 3300049571 Bacteria 9819
193 Ga0501034_1276599 3300049571 Bacteria 611
194 Ga0501036_1485865 3300049572 Bacteria 548
195 Ga0501037_0731805 3300049573 Bacteria 656
196 Ga0501038_0005917 3300049574 Bacteria 11307
197 Ga0501039_0010315 3300049575 Bacteria 7126
198 Ga0501042_1274395 3300049578 Bacteria 536
199 Ga0501043_0004937 3300049579 Bacteria 10784
200 Ga0501046_0015318 3300049580 Bacteria 6448
201 Ga0501047_0352756 3300049581 Bacteria 1307
202 Ga0501048_0121718 3300049582 Bacteria 1844
203 Ga0501067_0114653 3300049583 Bacteria 1499
204 Ga0501068_0392719 3300049584 Bacteria 894
205 Ga0501069_0298853 3300049585 Bacteria 944
206 Ga0501073_0008863 3300049589 Bacteria 7436
207 Ga0501080_0011521 3300049742 Bacteria 8096
208 Ga0501080_0457198 3300049742 Bacteria 1144
209 Ga0501083_0478422 3300049744 Bacteria 810
210 Ga0501035_0043348 3300049822 Bacteria 4055
211 Ga0501044_0036733 3300049823 Bacteria 5123
212 nmdc:mga0k408_524558_c1 3300050493 Bacteria 701
213 Ga0500651_0000131 3300053093 Bacteria 46394
214 Ga0500557_199626 3300053105 Bacteria 644
215 Ga0501082_0365595 3300060353 Bacteria 1258

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300033541 Ga0316596_1004823 Ga0316596_10048235 58
2 3300038735 Ga0400485_02770 Ga0400485_02770_3501_3698 60
3 3300038742 Ga0400486_25694 Ga0400486_25694_9424_9621 60
4 3300039062 Ga0400483_049234 Ga0400483_049234_867_1064 60
5 3300039062 Ga0400483_238886 Ga0400483_238886_1788_1985 60
6 3300039110 Ga0400487_13697 Ga0400487_13697_37_234 60
7 3300002067 JGI24735J21928_10021322 JGI24735J21928_100213223 61
8 3300003305 Ga0006770J48903_1007534 Ga0006770J48903_100753410 61
9 3300005327 Ga0070658_10251686 Ga0070658_102516863 61
10 3300005328 Ga0070676_11165033 Ga0070676_111650332 61
11 3300006186 Ga0075369_10209693 Ga0075369_102096933 61
12 3300006195 Ga0075366_10828202 Ga0075366_108282022 61
13 3300025321 Ga0207656_10417651 Ga0207656_104176512 61
14 3300025900 Ga0207710_10174200 Ga0207710_101742001 61
15 3300025914 Ga0207671_10439485 Ga0207671_104394852 61
16 3300025926 Ga0207659_11370535 Ga0207659_113705352 61
17 3300025941 Ga0207711_10787703 Ga0207711_107877032 61
18 3300025942 Ga0207689_10507090 Ga0207689_105070902 61
19 3300025949 Ga0207667_10384500 Ga0207667_103845003 61
20 3300025972 Ga0207668_10133378 Ga0207668_101333782 61
21 3300025986 Ga0207658_10391411 Ga0207658_103914113 61
22 3300026035 Ga0207703_11957846 Ga0207703_119578462 61
23 3300026088 Ga0207641_10210105 Ga0207641_102101055 61
24 3300026142 Ga0207698_12079661 Ga0207698_120796612 61
25 3300028379 Ga0268266_10000001 Ga0268266_100000013277 61
26 3300028379 Ga0268266_11830821 Ga0268266_118308212 61
27 3300028380 Ga0268265_10000444 Ga0268265_100004446 61
28 3300028381 Ga0268264_10008596 Ga0268264_100085968 61
29 3300028381 Ga0268264_10528301 Ga0268264_105283012 61
30 3300028794 Ga0307515_10915654 Ga0307515_109156542 61
31 3300031251 Ga0265327_10174245 Ga0265327_101742452 61
32 3300031507 Ga0307509_10056806 Ga0307509_100568068 61
33 3300031665 Ga0316575_10008308 Ga0316575_100083087 61
34 3300031665 Ga0316575_10019440 Ga0316575_100194403 61
35 3300031665 Ga0316575_10156269 Ga0316575_101562692 61
36 3300031665 Ga0316575_10288068 Ga0316575_102880682 61
37 3300031665 Ga0316575_10476323 Ga0316575_104763232 61
38 3300031691 Ga0316579_10001358 Ga0316579_100013588 61
39 3300031691 Ga0316579_10070414 Ga0316579_100704143 61
40 3300031691 Ga0316579_10167856 Ga0316579_101678563 61
41 3300031691 Ga0316579_10477040 Ga0316579_104770402 61
42 3300031727 Ga0316576_10057546 Ga0316576_100575463 61
43 3300031727 Ga0316576_10138081 Ga0316576_101380815 61
44 3300031727 Ga0316576_10182028 Ga0316576_101820285 61
45 3300031727 Ga0316576_10239571 Ga0316576_102395711 61
46 3300031727 Ga0316576_10459028 Ga0316576_104590282 61
47 3300031727 Ga0316576_10851841 Ga0316576_108518412 61
48 3300031728 Ga0316578_10010128 Ga0316578_100101287 61
49 3300031728 Ga0316578_10139542 Ga0316578_101395424 61
50 3300031728 Ga0316578_10222918 Ga0316578_102229182 61
51 3300031728 Ga0316578_10618266 Ga0316578_106182662 61
52 3300031728 Ga0316578_10740835 Ga0316578_107408351 61
53 3300031728 Ga0316578_10754134 Ga0316578_107541342 61
54 3300031730 Ga0307516_10007119 Ga0307516_100071192 61
55 3300031733 Ga0316577_10007369 Ga0316577_1000736910 61
56 3300031733 Ga0316577_10010745 Ga0316577_100107454 61
57 3300031733 Ga0316577_10018529 Ga0316577_100185295 61
58 3300031733 Ga0316577_10126121 Ga0316577_101261213 61
59 3300032004 Ga0307414_10233161 Ga0307414_102331612 61
60 3300032133 Ga0316583_10008555 Ga0316583_100085556 61
61 3300032133 Ga0316583_10073918 Ga0316583_100739183 61
62 3300032133 Ga0316583_10132732 Ga0316583_101327323 61
63 3300032133 Ga0316583_10230824 Ga0316583_102308242 61
64 3300032137 Ga0316585_10060190 Ga0316585_100601902 61
65 3300032137 Ga0316585_10090170 Ga0316585_100901702 61
66 3300032137 Ga0316585_10092229 Ga0316585_100922293 61
67 3300032137 Ga0316585_10111834 Ga0316585_101118342 61
68 3300032137 Ga0316585_10315985 Ga0316585_103159852 61
69 3300032139 Ga0316580_10100669 Ga0316580_101006692 61
70 3300032168 Ga0316593_10000027 Ga0316593_1000002719 61
71 3300032168 Ga0316593_10000111 Ga0316593_1000011111 61
72 3300032168 Ga0316593_10000325 Ga0316593_100003256 61
73 3300032168 Ga0316593_10000968 Ga0316593_100009685 61
74 3300032168 Ga0316593_10000996 Ga0316593_100009962 61
75 3300032168 Ga0316593_10001014 Ga0316593_100010146 61
76 3300032168 Ga0316593_10001440 Ga0316593_1000144011 61
77 3300032168 Ga0316593_10002233 Ga0316593_100022336 61
78 3300032168 Ga0316593_10004408 Ga0316593_100044086 61
79 3300032168 Ga0316593_10007446 Ga0316593_100074465 61
80 3300032168 Ga0316593_10007460 Ga0316593_100074605 61
81 3300032168 Ga0316593_10017241 Ga0316593_100172413 61
82 3300032168 Ga0316593_10024635 Ga0316593_100246352 61
83 3300032168 Ga0316593_10025516 Ga0316593_100255163 61
84 3300032168 Ga0316593_10048202 Ga0316593_100482022 61
85 3300032168 Ga0316593_10080026 Ga0316593_100800263 61
86 3300032168 Ga0316593_10084810 Ga0316593_100848104 61
87 3300032168 Ga0316593_10094272 Ga0316593_100942723 61
88 3300032168 Ga0316593_10105565 Ga0316593_101055652 61
89 3300032168 Ga0316593_10164915 Ga0316593_101649152 61
90 3300032168 Ga0316593_10175007 Ga0316593_101750072 61
91 3300032168 Ga0316593_10223428 Ga0316593_102234282 61
92 3300032168 Ga0316593_10241231 Ga0316593_102412311 61
93 3300032168 Ga0316593_10348613 Ga0316593_103486132 61
94 3300032168 Ga0316593_10447235 Ga0316593_104472352 61
95 3300033179 Ga0307507_10039101 Ga0307507_100391019 61
96 3300033524 Ga0316592_1000006 Ga0316592_100000611 61
97 3300033524 Ga0316592_1003435 Ga0316592_10034353 61
98 3300033524 Ga0316592_1006806 Ga0316592_10068062 61
99 3300033524 Ga0316592_1151455 Ga0316592_11514552 61
100 3300033527 Ga0316586_1000040 Ga0316586_100004010 61
101 3300033527 Ga0316586_1017886 Ga0316586_10178863 61
102 3300033527 Ga0316586_1036463 Ga0316586_10364633 61
103 3300033527 Ga0316586_1039729 Ga0316586_10397293 61
104 3300033527 Ga0316586_1065392 Ga0316586_10653922 61
105 3300033528 Ga0316588_1021426 Ga0316588_10214264 61
106 3300033528 Ga0316588_1023318 Ga0316588_10233182 61
107 3300033528 Ga0316588_1032437 Ga0316588_10324372 61
108 3300033528 Ga0316588_1061356 Ga0316588_10613562 61
109 3300033528 Ga0316588_1084893 Ga0316588_10848931 61
110 3300033529 Ga0316587_1000021 Ga0316587_100002111 61
111 3300033529 Ga0316587_1001046 Ga0316587_10010466 61
112 3300033529 Ga0316587_1003352 Ga0316587_10033521 61
113 3300033529 Ga0316587_1014182 Ga0316587_10141823 61
114 3300033529 Ga0316587_1022652 Ga0316587_10226521 61
115 3300033529 Ga0316587_1022726 Ga0316587_10227263 61
116 3300033529 Ga0316587_1027561 Ga0316587_10275612 61
117 3300033529 Ga0316587_1075974 Ga0316587_10759742 61
118 3300033529 Ga0316587_1122247 Ga0316587_11222472 61
119 3300033541 Ga0316596_1000016 Ga0316596_100001619 61
120 3300033541 Ga0316596_1000061 Ga0316596_10000617 61
121 3300033541 Ga0316596_1000070 Ga0316596_10000708 61
122 3300033541 Ga0316596_1000323 Ga0316596_100032312 61
123 3300033541 Ga0316596_1000651 Ga0316596_100065110 61
124 3300033541 Ga0316596_1001409 Ga0316596_10014099 61
125 3300033541 Ga0316596_1002088 Ga0316596_100208810 61
126 3300033541 Ga0316596_1002164 Ga0316596_10021647 61
127 3300033541 Ga0316596_1003277 Ga0316596_10032773 61
128 3300033541 Ga0316596_1010023 Ga0316596_10100232 61
129 3300033541 Ga0316596_1012307 Ga0316596_10123075 61
130 3300033541 Ga0316596_1012710 Ga0316596_10127102 61
131 3300033541 Ga0316596_1020593 Ga0316596_10205931 61
132 3300033541 Ga0316596_1041022 Ga0316596_10410222 61
133 3300033541 Ga0316596_1129083 Ga0316596_11290832 61
134 3300033541 Ga0316596_1212606 Ga0316596_12126062 61
135 3300033541 Ga0316596_1216602 Ga0316596_12166022 61
136 3300035398 Ga0316574_0005225 Ga0316574_0005225_2003_2206 61
137 3300035398 Ga0316574_0046734 Ga0316574_0046734_262_450 61
138 3300035398 Ga0316574_0101014 Ga0316574_0101014_906_1109 61
139 3300035398 Ga0316574_0126201 Ga0316574_0126201_776_976 61
140 3300035398 Ga0316574_0165528 Ga0316574_0165528_300_500 61
141 3300035398 Ga0316574_0170847 Ga0316574_0170847_426_614 61
142 3300035398 Ga0316574_0454274 Ga0316574_0454274_164_367 61
143 3300035398 Ga0316574_0544390 Ga0316574_0544390_45_248 61
144 3300035398 Ga0316574_0715697 Ga0316574_0715697_194_397 61
145 3300035398 Ga0316574_0808067 Ga0316574_0808067_55_249 61
146 3300035398 Ga0316574_0837227 Ga0316574_0837227_71_271 61
147 3300036647 Ga0316582_0000535 Ga0316582_0000535_11036_11236 61
148 3300036647 Ga0316582_0001466 Ga0316582_0001466_4785_4988 61
149 3300036647 Ga0316582_0004346 Ga0316582_0004346_2110_2310 61
150 3300036647 Ga0316582_0015971 Ga0316582_0015971_1422_1625 61
151 3300036647 Ga0316582_0027328 Ga0316582_0027328_2384_2587 61
152 3300036647 Ga0316582_0182476 Ga0316582_0182476_665_868 61
153 3300036647 Ga0316582_0533759 Ga0316582_0533759_472_672 61
154 3300036712 Ga0316584_0002043 Ga0316584_0002043_10808_11011 61
155 3300036712 Ga0316584_0004999 Ga0316584_0004999_5615_5818 61
156 3300036712 Ga0316584_0015064 Ga0316584_0015064_1907_2110 61
157 3300036712 Ga0316584_0074355 Ga0316584_0074355_1980_2168 61
158 3300036712 Ga0316584_0129983 Ga0316584_0129983_1395_1595 61
159 3300036712 Ga0316584_0316770 Ga0316584_0316770_225_437 61
160 3300036712 Ga0316584_0588561 Ga0316584_0588561_482_685 61
161 3300036712 Ga0316584_0874948 Ga0316584_0874948_147_347 61
162 3300036712 Ga0316584_1033160 Ga0316584_1033160_327_527 61
163 3300037588 Ga0316581_0001208 Ga0316581_0001208_4678_4881 61
164 3300038725 Ga0400484_44058 Ga0400484_44058_1774_1974 61
165 3300038726 Ga0400490_07361 Ga0400490_07361_5424_5624 61
166 3300038735 Ga0400485_19181 Ga0400485_19181_50289_50489 61
167 3300038741 Ga0400488_27230 Ga0400488_27230_121_321 61
168 3300038741 Ga0400488_44096 Ga0400488_44096_1024_1224 61
169 3300038742 Ga0400486_25543 Ga0400486_25543_52868_53068 61
170 3300038742 Ga0400486_30433 Ga0400486_30433_250_450 61
171 3300039062 Ga0400483_085385 Ga0400483_085385_171_371 61
172 3300039062 Ga0400483_141649 Ga0400483_141649_3918_4118 61
173 3300039062 Ga0400483_153100 Ga0400483_153100_1788_1988 61
174 3300039062 Ga0400483_208501 Ga0400483_208501_1889_2089 61
175 3300039062 Ga0400483_211411 Ga0400483_211411_3733_3936 61
176 3300039110 Ga0400487_02246 Ga0400487_02246_21276_21476 61
177 3300039110 Ga0400487_07519 Ga0400487_07519_3231_3431 61
178 3300041446 Ga0451794_22033 Ga0451794_22033_281_466 61
179 3300041451 Ga0451791_0721271 Ga0451791_0721271_224_409 61
180 3300041459 Ga0451800_0821226 Ga0451800_0821226_666_851 61
181 3300041512 Ga0451853_3169985 Ga0451853_3169985_387_572 61
182 3300044712 Ga0453684_1187460 Ga0453684_1187460_231_422 61
183 3300046519 Ga0495632_0005327 Ga0495632_0005327_5111_5296 61
184 3300046557 Ga0495622_0530621 Ga0495622_0530621_60_245 61
185 3300048090 Ga0495615_0152985 Ga0495615_0152985_479_664 61
186 3300048903 Ga0496100_0824905 Ga0496100_0824905_77_262 61
187 3300048904 Ga0496101_1127215 Ga0496101_1127215_184_369 61
188 3300048910 Ga0496107_0417284 Ga0496107_0417284_322_507 61
189 3300049162 Ga0501307_000537 Ga0501307_000537_1932_2117 61
190 3300049569 Ga0501032_0126347 Ga0501032_0126347_492_692 61
191 3300049570 Ga0501033_0014950 Ga0501033_0014950_716_916 61
192 3300049571 Ga0501034_0010161 Ga0501034_0010161_4954_5154 61
193 3300049571 Ga0501034_1276599 Ga0501034_1276599_86_286 61
194 3300049572 Ga0501036_1485865 Ga0501036_1485865_260_460 61
195 3300049573 Ga0501037_0731805 Ga0501037_0731805_372_572 61
196 3300049574 Ga0501038_0005917 Ga0501038_0005917_7698_7898 61
197 3300049575 Ga0501039_0010315 Ga0501039_0010315_6181_6381 61
198 3300049578 Ga0501042_1274395 Ga0501042_1274395_254_454 61
199 3300049579 Ga0501043_0004937 Ga0501043_0004937_10098_10298 61
200 3300049580 Ga0501046_0015318 Ga0501046_0015318_4669_4869 61
201 3300049581 Ga0501047_0352756 Ga0501047_0352756_139_339 61
202 3300049582 Ga0501048_0121718 Ga0501048_0121718_14_214 61
203 3300049583 Ga0501067_0114653 Ga0501067_0114653_644_844 61
204 3300049584 Ga0501068_0392719 Ga0501068_0392719_269_469 61
205 3300049585 Ga0501069_0298853 Ga0501069_0298853_453_653 61
206 3300049589 Ga0501073_0008863 Ga0501073_0008863_4926_5126 61
207 3300049742 Ga0501080_0011521 Ga0501080_0011521_4918_5118 61
208 3300049742 Ga0501080_0457198 Ga0501080_0457198_787_972 61
209 3300049744 Ga0501083_0478422 Ga0501083_0478422_85_285 61
210 3300049822 Ga0501035_0043348 Ga0501035_0043348_1143_1343 61
211 3300049823 Ga0501044_0036733 Ga0501044_0036733_3370_3570 61
212 3300050493 nmdc:mga0k408_524558_c1 nmdc:mga0k408_524558_c1_296_481 61
213 3300053093 Ga0500651_0000131 Ga0500651_0000131_28403_28588 61
214 3300053105 Ga0500557_199626 Ga0500557_199626_114_299 61
215 3300060353 Ga0501082_0365595 Ga0501082_0365595_29_229 61

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00831

Ribosomal_L29

Ribosomal L29 protein

4

60

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
7r81-assembly1.cif.gz_j1 structure of the translating neurospora crassa ribosome arrested by cycloheximide 0.9618 1 60
5mmi-assembly1.cif.gz_Z structure of the large subunit of the chloroplast ribosome 0.957 3 60
5t5h-assembly1.cif.gz_k structure and assembly model for the trypanosoma cruzi 60s ribosomal subunit 0.955 4 60
8fom-assembly2.cif.gz_Y2 crystal structure of trna^lys(suu) bound to uaa codon in the ribosomal p site 0.9538 3 60
4v7j-assembly2.cif.gz_B2 structure of rele nuclease bound to the 70s ribosome (precleavage state) 0.9532 3 60
ID Description Score Start End Superfamily
af_A0A1D6JR08_188_264_1.10.287.660 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Helix hairpin bin 0.9385 11 59 1.10.287.660
af_Q10QR4_157_230_1.10.287.660 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Helix hairpin bin 0.9377 11 59 1.10.287.660
5dm6V00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.9366 7 59 1.10.287.310
4hubV00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.9358 1 60 1.10.287.310
1yjwV00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.9343 1 60 1.10.287.310
ID Description Score Start End GO Terms
AF-X0W794-F1-model_v4 Ribosomal protein L29 0.997 3 60 GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-A0A1F5P582-F1-model_v4 Large ribosomal subunit protein uL29 0.9873 3 60 GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-A0A0G1L541-F1-model_v4 Large ribosomal subunit protein uL29 0.9829 1 60 GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-A0A1H9JQR5-F1-model_v4 Large ribosomal subunit protein uL29 0.9821 3 59 GO:0003735
GO:0006412
GO:0022625
AF-A0A522S0D7-F1-model_v4 Large ribosomal subunit protein uL29 0.9788 1 60 GO:0003735
GO:0006412
GO:0022625

Feature Viewer

pLDDT pTM Quality
84.44 0.67 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map