F326593

General Info

Members Datasets Scaffolds Average Seq Length
215 171 215 125

Family's Representative Sequence

Representative Sequence 3300031712|Ga0265342_10399082|Ga0265342_103990822
Length 146
Sequence MNDGHRFAADVAAWKHEEKMARILVAEDEEALRTLVARALKGAGHDVITAADGGAALDCLTREEGRFDLLLTDIKMPVMDGIAVALAAARDYPDLVILLMTGYADQRERALNLDALIHDVVSKPFTLAEIKTAVADALAVKAARAG

Samples

Sample ID Description Type Environment
1 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
2 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
3 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
4 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
5 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
6 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
7 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
8 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
12 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
15 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
16 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
17 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
18 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
19 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
20 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
21 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
22 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
23 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
24 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
25 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
26 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
27 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
28 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
29 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
30 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
31 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
32 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
33 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
34 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
35 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
36 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
37 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
38 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
40 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
42 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
43 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
44 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
45 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
46 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
47 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
48 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
49 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
50 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
51 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
77 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
78 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
79 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
80 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
81 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
82 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
83 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
84 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
85 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
86 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
87 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
88 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
89 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
90 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
91 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
92 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
93 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
94 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
95 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
96 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
97 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
98 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
99 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
100 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
101 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
102 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
103 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
104 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
105 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
106 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
107 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
108 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
109 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
110 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
111 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
112 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
113 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
114 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
115 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
116 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
117 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
118 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
119 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
120 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
121 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
122 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
123 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
124 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
125 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
126 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
127 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
128 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
129 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
130 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
131 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
132 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
133 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
134 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
135 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
136 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
137 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
138 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
139 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
141 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
142 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
143 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
144 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
145 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
146 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
147 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
148 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
149 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
150 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
151 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
152 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
153 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
154 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
155 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
156 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
157 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
158 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
159 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
160 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
161 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
162 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
163 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
164 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
165 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
166 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
167 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
168 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
169 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
170 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
171 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.21
Metatranscriptomes 2.79
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.51
Nodule 0
Rhizoplane 8.37
Rhizosphere 84.19
Stem 0
Stem Tuber 0
Unclassified 0.93

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070690_100099802 3300005330 Bacteria 1924
2 Ga0070670_100010415 3300005331 Bacteria 7935
3 Ga0070668_101874234 3300005347 Bacteria 552
4 Ga0070675_100829206 3300005354 Bacteria 846
5 Ga0070671_100000307 3300005355 Bacteria 33302
6 Ga0070673_100680455 3300005364 Bacteria 943
7 Ga0070688_100358465 3300005365 Bacteria 1069
8 Ga0070709_10771208 3300005434 Bacteria 753
9 Ga0070714_100209349 3300005435 Bacteria 1787
10 Ga0070714_101543278 3300005435 Bacteria 649
11 Ga0070713_100255305 3300005436 Bacteria 1600
12 Ga0070713_101847862 3300005436 Bacteria 586
13 Ga0070711_100054713 3300005439 Bacteria 2754
14 Ga0070662_100197329 3300005457 Bacteria 1595
15 Ga0070681_10072861 3300005458 Bacteria 3397
16 Ga0070679_100849653 3300005530 Bacteria 856
17 Ga0070695_101040328 3300005545 Bacteria 668
18 Ga0070665_100100615 3300005548 Bacteria 2895
19 Ga0070664_100207416 3300005564 Bacteria 1750
20 Ga0068854_101749239 3300005578 Bacteria 569
21 Ga0068861_100696213 3300005719 Bacteria 944
22 Ga0068863_100443741 3300005841 Bacteria 1273
23 Ga0068858_100281061 3300005842 Bacteria 1585
24 Ga0081455_10250051 3300005937 Bacteria 1297
25 Ga0081538_10014646 3300005981 Bacteria 6128
26 Ga0081538_10022407 3300005981 Bacteria 4577
27 Ga0081540_1000168 3300005983 Bacteria 68153
28 Ga0081540_1001188 3300005983 Bacteria 22800
29 Ga0070717_10303901 3300006028 Bacteria 1419
30 Ga0075368_10135463 3300006042 Bacteria 1025
31 Ga0075364_10201001 3300006051 Bacteria 1351
32 Ga0070712_100135574 3300006175 Bacteria 1871
33 Ga0075367_10272673 3300006178 Bacteria 1063
34 Ga0075366_10154072 3300006195 Bacteria 1392
35 Ga0075428_101147608 3300006844 Bacteria 820
36 Ga0075430_100018442 3300006846 Bacteria 5937
37 Ga0075431_101730048 3300006847 Bacteria 582
38 Ga0075434_102318447 3300006871 Bacteria 539
39 Ga0075429_100236784 3300006880 Bacteria 1599
40 Ga0068865_100598959 3300006881 Bacteria 931
41 Ga0099795_10301266 3300007788 Bacteria 705
42 Ga0111539_10894424 3300009094 Bacteria 1033
43 Ga0105247_11035744 3300009101 Bacteria 643
44 Ga0114129_10002965 3300009147 Bacteria 23749
45 Ga0105237_10149391 3300009545 Bacteria 2332
46 Ga0105238_10375674 3300009551 Bacteria 1412
47 Ga0105246_10397929 3300011119 Bacteria 1143
48 Ga0157378_10263061 3300013297 Bacteria 1656
49 Ga0157378_11818980 3300013297 Bacteria 657
50 Ga0157372_12664004 3300013307 Bacteria 574
51 Ga0157380_10223926 3300014326 Bacteria 1685
52 Ga0157380_10978850 3300014326 Bacteria 878
53 Ga0157377_11565801 3300014745 Bacteria 526
54 Ga0157379_10481910 3300014968 Bacteria 1148
55 Ga0157379_10861173 3300014968 Bacteria 858
56 Ga0157379_12410874 3300014968 Bacteria 525
57 Ga0206353_10362294 3300020082 Bacteria 1147
58 Ga0228598_1032713 3300024227 Bacteria 1025
59 Ga0228598_1068399 3300024227 Bacteria 709
60 Ga0207680_10516438 3300025903 Bacteria 851
61 Ga0207699_10141811 3300025906 Bacteria 1580
62 Ga0207645_10491920 3300025907 Bacteria 830
63 Ga0207707_10181730 3300025912 Bacteria 1836
64 Ga0207671_11588533 3300025914 Bacteria 503
65 Ga0207693_10402809 3300025915 Bacteria 1070
66 Ga0207693_10404963 3300025915 Bacteria 1066
67 Ga0207657_10194081 3300025919 Bacteria 1636
68 Ga0207681_10427660 3300025923 Bacteria 1074
69 Ga0207650_10011030 3300025925 Bacteria 6213
70 Ga0207659_10264116 3300025926 Bacteria 1402
71 Ga0207687_11751770 3300025927 Bacteria 532
72 Ga0207700_10068652 3300025928 Bacteria 2717
73 Ga0207700_10568422 3300025928 Bacteria 1007
74 Ga0207664_10319608 3300025929 Bacteria 1369
75 Ga0207644_10122067 3300025931 Bacteria 1984
76 Ga0207644_11489305 3300025931 Bacteria 568
77 Ga0207706_10146415 3300025933 Bacteria 2078
78 Ga0207670_10024624 3300025936 Bacteria 3764
79 Ga0207670_10161604 3300025936 Bacteria 1672
80 Ga0207679_10145359 3300025945 Bacteria 1922
81 Ga0207651_10029282 3300025960 Bacteria 3487
82 Ga0207668_10390373 3300025972 Bacteria 1174
83 Ga0207703_11026298 3300026035 Bacteria 791
84 Ga0207703_11157348 3300026035 Bacteria 743
85 Ga0207639_10516921 3300026041 Bacteria 1093
86 Ga0207641_10379339 3300026088 Bacteria 1354
87 Ga0207648_11349135 3300026089 Bacteria 670
88 Ga0207676_11240043 3300026095 Bacteria 740
89 Ga0268266_10014975 3300028379 Bacteria 6657
90 Ga0265318_10129401 3300028577 Bacteria 928
91 Ga0265763_1005326 3300030763 Bacteria 1077
92 Ga0265770_1003871 3300030878 Bacteria 2036
93 Ga0265770_1091025 3300030878 Bacteria 609
94 Ga0265760_10068230 3300031090 Bacteria 1088
95 Ga0265760_10154690 3300031090 Bacteria 754
96 Ga0265330_10025636 3300031235 Bacteria 2672
97 Ga0265332_10183051 3300031238 Bacteria 872
98 Ga0265325_10065962 3300031241 Bacteria 1826
99 Ga0265325_10101493 3300031241 Bacteria 1408
100 Ga0265329_10030174 3300031242 Bacteria 1768
101 Ga0265340_10155594 3300031247 Bacteria 1040
102 Ga0265340_10347475 3300031247 Bacteria 655
103 Ga0265339_10318989 3300031249 Bacteria 737
104 Ga0265331_10044695 3300031250 Bacteria 2140
105 Ga0265316_10202455 3300031344 Bacteria 1471
106 Ga0265316_10986366 3300031344 Bacteria 586
107 Ga0265313_10060906 3300031595 Bacteria 1768
108 Ga0265313_10134121 3300031595 Bacteria 1070
109 Ga0265314_10025141 3300031711 Bacteria 4499
110 Ga0265342_10399082 3300031712 Bacteria 710
111 Ga0373956_0099803 3300035119 Bacteria 1346
112 Ga0373946_0358839 3300035171 Bacteria 730
113 Ga0373937_0040408 3300036401 Bacteria 4251
114 Ga0373937_0448655 3300036401 Bacteria 1225
115 Ga0373925_0599276 3300037068 Bacteria 907
116 Ga0436365_0739414 3300039437 Bacteria 902
117 Ga0436360_1292194 3300039438 Bacteria 516
118 Ga0436361_0155457 3300039447 Bacteria 637
119 Ga0436363_0870860 3300039450 Bacteria 539
120 Ga0439451_067463 3300042009 Bacteria 716
121 Ga0466966_0084708 3300044684 Bacteria 1971
122 Ga0466961_0334398 3300044693 Bacteria 923
123 Ga0466963_0074125 3300044694 Bacteria 2295
124 Ga0466959_0516814 3300045049 Bacteria 806
125 Ga0466958_0002799 3300045836 Bacteria 8878
126 Ga0495653_0262591 3300046463 Bacteria 1141
127 Ga0495584_0038648 3300046491 Bacteria 2412
128 Ga0495585_0311790 3300046492 Bacteria 771
129 Ga0495618_0294614 3300046514 Bacteria 1009
130 Ga0495631_0204674 3300046518 Bacteria 844
131 Ga0495652_0304153 3300046529 Bacteria 1158
132 Ga0495645_0393909 3300046543 Bacteria 884
133 Ga0495667_0116259 3300046559 Bacteria 1728
134 Ga0495656_0066025 3300046615 Bacteria 1593
135 Ga0495659_0126405 3300046664 Bacteria 1011
136 Ga0495657_0145274 3300046675 Bacteria 1476
137 Ga0495646_0376142 3300046680 Bacteria 741
138 Ga0495613_1016972 3300046689 Bacteria 532
139 Ga0495671_0512618 3300046692 Bacteria 572
140 Ga0495684_0017708 3300047471 Bacteria 5487
141 Ga0495593_0176569 3300047673 Bacteria 1076
142 Ga0495602_0360649 3300048088 Bacteria 1046
143 Ga0495626_0414064 3300048091 Bacteria 520
144 Ga0496100_0158380 3300048903 Bacteria 1621
145 Ga0496101_0127330 3300048904 Bacteria 1931
146 Ga0496106_0751181 3300048909 Bacteria 775
147 Ga0496108_0345749 3300048911 Bacteria 1298
148 Ga0496109_0330823 3300048912 Bacteria 1438
149 Ga0496109_1639602 3300048912 Bacteria 577
150 Ga0496110_0059420 3300048913 Bacteria 3370
151 Ga0496110_0456483 3300048913 Bacteria 1164
152 Ga0496112_0171245 3300048915 Bacteria 2136
153 Ga0496112_0245880 3300048915 Bacteria 1741
154 Ga0496112_0278207 3300048915 Bacteria 1621
155 Ga0496113_0299787 3300048916 Bacteria 1287
156 Ga0496113_0603350 3300048916 Bacteria 879
157 Ga0496114_0017809 3300048917 Bacteria 5741
158 Ga0496114_1059890 3300048917 Bacteria 695
159 Ga0496115_0316391 3300048918 Bacteria 1277
160 Ga0496115_0395884 3300048918 Bacteria 1121
161 Ga0496115_0613354 3300048918 Bacteria 864
162 Ga0501033_0716513 3300049570 Bacteria 680
163 Ga0501034_0394842 3300049571 Bacteria 1307
164 Ga0501036_1021340 3300049572 Bacteria 677
165 Ga0501039_1208993 3300049575 Bacteria 584
166 Ga0501040_0432185 3300049576 Bacteria 947
167 Ga0501042_0134350 3300049578 Bacteria 1784
168 Ga0501046_0801509 3300049580 Bacteria 660
169 Ga0501047_0684300 3300049581 Bacteria 844
170 Ga0501048_0521625 3300049582 Bacteria 852
171 Ga0501048_0632037 3300049582 Bacteria 769
172 Ga0501068_0215860 3300049584 Bacteria 1219
173 Ga0501069_0008691 3300049585 Bacteria 5349
174 Ga0501071_0229939 3300049587 Bacteria 1397
175 Ga0501071_0598383 3300049587 Bacteria 848
176 Ga0501071_1096790 3300049587 Bacteria 615
177 Ga0501073_0198612 3300049589 Bacteria 1387
178 Ga0501076_1526295 3300049592 Bacteria 548
179 Ga0501077_0151562 3300049593 Bacteria 1471
180 Ga0501079_0169415 3300049741 Bacteria 1703
181 Ga0501080_0059532 3300049742 Bacteria 3554
182 Ga0501080_1514616 3300049742 Bacteria 570
183 Ga0501081_0662952 3300049743 Bacteria 782
184 Ga0501083_0192281 3300049744 Bacteria 1332
185 Ga0501044_0745346 3300049823 Bacteria 862
186 nmdc:mga00v17_1020068_c1 3300050491 Bacteria 520
187 nmdc:mga00v17_245484_c1 3300050491 Bacteria 1161
188 nmdc:mga0k408_189113_c1 3300050493 Bacteria 1228
189 nmdc:mga06z11_689938_c1 3300050494 Bacteria 622
190 nmdc:mga07m45_458402_c1 3300050496 Bacteria 739
191 nmdc:mga05p37_20361_c1 3300050507 Bacteria 8027
192 nmdc:mga05p37_93388_c1 3300050507 Bacteria 2501
193 nmdc:mga09592_1026499_c1 3300050508 Bacteria 688
194 nmdc:mga0qj67_1186820_c1 3300050509 Bacteria 594
195 nmdc:mga0qj67_14764_c1 3300050509 Bacteria 5905
196 nmdc:mga0n895_944053_c1 3300050512 Bacteria 846
197 nmdc:mga08x19_236593_c1 3300050514 Bacteria 1258
198 nmdc:mga0a205_386590_c1 3300050515 Bacteria 1264
199 nmdc:mga0a205_469437_c1 3300050515 Bacteria 1117
200 Ga0495601_0362093 3300053077 Bacteria 942
201 Ga0495655_0061023 3300053083 Bacteria 1028
202 Ga0500593_226356 3300053117 Bacteria 652
203 Ga0500593_310231 3300053117 Bacteria 500
204 Ga0500634_0000017 3300053161 Bacteria 111983
205 Ga0500634_0081898 3300053161 Bacteria 1661
206 Ga0500611_019041 3300053727 Bacteria 1275
207 Ga0501084_0291697 3300054114 Bacteria 1378
208 Ga0501082_0000428 3300060353 Bacteria 37284
209 Ga0501082_0354720 3300060353 Bacteria 1279
210 Ga0501082_0544043 3300060353 Bacteria 1015
211 Ga0501082_0876429 3300060353 Unclassified 785
212 Ga0501082_0947084 3300060353 Bacteria 753
213 Ga0501082_1773879 3300060353 Bacteria 538
214 Ga0466962_0140207 3300061719 Bacteria 1171
215 Ga0530510_1003167 3300061734 Bacteria 639

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049584 Ga0501068_0215860 Ga0501068_0215860_310_669 119
2 3300049585 Ga0501069_0008691 Ga0501069_0008691_2830_3189 119
3 3300049589 Ga0501073_0198612 Ga0501073_0198612_321_680 119
4 3300049742 Ga0501080_0059532 Ga0501080_0059532_71_430 119
5 3300060353 Ga0501082_0876429 Ga0501082_0876429_232_591 119
6 3300048091 Ga0495626_0414064 Ga0495626_0414064_117_479 120
7 3300053727 Ga0500611_019041 Ga0500611_019041_655_1017 120
8 3300060353 Ga0501082_0354720 Ga0501082_0354720_289_651 120
9 3300025931 Ga0207644_11489305 Ga0207644_114893052 121
10 3300013297 Ga0157378_11818980 Ga0157378_118189802 122
11 3300026089 Ga0207648_11349135 Ga0207648_113491352 122
12 3300006880 Ga0075429_100236784 Ga0075429_1002367842 123
13 3300006881 Ga0068865_100598959 Ga0068865_1005989592 123
14 3300014745 Ga0157377_11565801 Ga0157377_115658011 123
15 3300046518 Ga0495631_0204674 Ga0495631_0204674_366_737 123
16 3300050493 nmdc:mga0k408_189113_c1 nmdc:mga0k408_189113_c1_128_499 123
17 3300050507 nmdc:mga05p37_93388_c1 nmdc:mga05p37_93388_c1_1474_1845 123
18 3300005436 Ga0070713_101847862 Ga0070713_1018478622 124
19 3300005458 Ga0070681_10072861 Ga0070681_100728613 124
20 3300005530 Ga0070679_100849653 Ga0070679_1008496531 124
21 3300005841 Ga0068863_100443741 Ga0068863_1004437413 124
22 3300006042 Ga0075368_10135463 Ga0075368_101354632 124
23 3300006051 Ga0075364_10201001 Ga0075364_102010012 124
24 3300006178 Ga0075367_10272673 Ga0075367_102726732 124
25 3300006195 Ga0075366_10154072 Ga0075366_101540722 124
26 3300007788 Ga0099795_10301266 Ga0099795_103012662 124
27 3300009551 Ga0105238_10375674 Ga0105238_103756742 124
28 3300013307 Ga0157372_12664004 Ga0157372_126640042 124
29 3300014968 Ga0157379_10481910 Ga0157379_104819101 124
30 3300020082 Ga0206353_10362294 Ga0206353_103622942 124
31 3300025912 Ga0207707_10181730 Ga0207707_101817302 124
32 3300026035 Ga0207703_11157348 Ga0207703_111573481 124
33 3300026041 Ga0207639_10516921 Ga0207639_105169212 124
34 3300035119 Ga0373956_0099803 Ga0373956_0099803_797_1171 124
35 3300035171 Ga0373946_0358839 Ga0373946_0358839_130_504 124
36 3300036401 Ga0373937_0448655 Ga0373937_0448655_812_1186 124
37 3300037068 Ga0373925_0599276 Ga0373925_0599276_267_641 124
38 3300046463 Ga0495653_0262591 Ga0495653_0262591_641_1015 124
39 3300046529 Ga0495652_0304153 Ga0495652_0304153_638_1012 124
40 3300046543 Ga0495645_0393909 Ga0495645_0393909_208_582 124
41 3300046559 Ga0495667_0116259 Ga0495667_0116259_283_657 124
42 3300046675 Ga0495657_0145274 Ga0495657_0145274_1010_1384 124
43 3300046680 Ga0495646_0376142 Ga0495646_0376142_43_417 124
44 3300047471 Ga0495684_0017708 Ga0495684_0017708_743_1117 124
45 3300047673 Ga0495593_0176569 Ga0495593_0176569_671_1045 124
46 3300048088 Ga0495602_0360649 Ga0495602_0360649_47_421 124
47 3300048913 Ga0496110_0059420 Ga0496110_0059420_1690_2064 124
48 3300048918 Ga0496115_0316391 Ga0496115_0316391_810_1184 124
49 3300049572 Ga0501036_1021340 Ga0501036_1021340_160_534 124
50 3300049575 Ga0501039_1208993 Ga0501039_1208993_94_468 124
51 3300049582 Ga0501048_0632037 Ga0501048_0632037_264_638 124
52 3300049587 Ga0501071_0229939 Ga0501071_0229939_36_410 124
53 3300049587 Ga0501071_1096790 Ga0501071_1096790_57_431 124
54 3300050491 nmdc:mga00v17_245484_c1 nmdc:mga00v17_245484_c1_653_1027 124
55 3300050494 nmdc:mga06z11_689938_c1 nmdc:mga06z11_689938_c1_145_519 124
56 3300050496 nmdc:mga07m45_458402_c1 nmdc:mga07m45_458402_c1_14_388 124
57 3300050514 nmdc:mga08x19_236593_c1 nmdc:mga08x19_236593_c1_76_450 124
58 3300050515 nmdc:mga0a205_386590_c1 nmdc:mga0a205_386590_c1_773_1147 124
59 3300050515 nmdc:mga0a205_469437_c1 nmdc:mga0a205_469437_c1_664_1038 124
60 3300060353 Ga0501082_0947084 Ga0501082_0947084_151_525 124
61 3300060353 Ga0501082_1773879 Ga0501082_1773879_143_517 124
62 3300061734 Ga0530510_1003167 Ga0530510_1003167_28_402 124
63 3300005331 Ga0070670_100010415 Ga0070670_1000104153 125
64 3300005347 Ga0070668_101874234 Ga0070668_1018742341 125
65 3300005354 Ga0070675_100829206 Ga0070675_1008292062 125
66 3300005355 Ga0070671_100000307 Ga0070671_10000030711 125
67 3300005364 Ga0070673_100680455 Ga0070673_1006804552 125
68 3300005365 Ga0070688_100358465 Ga0070688_1003584652 125
69 3300005434 Ga0070709_10771208 Ga0070709_107712081 125
70 3300005435 Ga0070714_100209349 Ga0070714_1002093492 125
71 3300005435 Ga0070714_101543278 Ga0070714_1015432782 125
72 3300005436 Ga0070713_100255305 Ga0070713_1002553052 125
73 3300005439 Ga0070711_100054713 Ga0070711_1000547133 125
74 3300005457 Ga0070662_100197329 Ga0070662_1001973292 125
75 3300005545 Ga0070695_101040328 Ga0070695_1010403281 125
76 3300005548 Ga0070665_100100615 Ga0070665_1001006152 125
77 3300005564 Ga0070664_100207416 Ga0070664_1002074162 125
78 3300005578 Ga0068854_101749239 Ga0068854_1017492392 125
79 3300005719 Ga0068861_100696213 Ga0068861_1006962132 125
80 3300005842 Ga0068858_100281061 Ga0068858_1002810612 125
81 3300005983 Ga0081540_1000168 Ga0081540_100016837 125
82 3300006028 Ga0070717_10303901 Ga0070717_103039011 125
83 3300006175 Ga0070712_100135574 Ga0070712_1001355742 125
84 3300009101 Ga0105247_11035744 Ga0105247_110357441 125
85 3300009545 Ga0105237_10149391 Ga0105237_101493912 125
86 3300011119 Ga0105246_10397929 Ga0105246_103979292 125
87 3300014326 Ga0157380_10223926 Ga0157380_102239262 125
88 3300014326 Ga0157380_10978850 Ga0157380_109788502 125
89 3300014968 Ga0157379_12410874 Ga0157379_124108741 125
90 3300024227 Ga0228598_1032713 Ga0228598_10327132 125
91 3300024227 Ga0228598_1068399 Ga0228598_10683991 125
92 3300025903 Ga0207680_10516438 Ga0207680_105164381 125
93 3300025906 Ga0207699_10141811 Ga0207699_101418112 125
94 3300025914 Ga0207671_11588533 Ga0207671_115885332 125
95 3300025915 Ga0207693_10402809 Ga0207693_104028091 125
96 3300025915 Ga0207693_10404963 Ga0207693_104049632 125
97 3300025919 Ga0207657_10194081 Ga0207657_101940812 125
98 3300025923 Ga0207681_10427660 Ga0207681_104276602 125
99 3300025925 Ga0207650_10011030 Ga0207650_100110302 125
100 3300025926 Ga0207659_10264116 Ga0207659_102641162 125
101 3300025927 Ga0207687_11751770 Ga0207687_117517702 125
102 3300025928 Ga0207700_10068652 Ga0207700_100686521 125
103 3300025928 Ga0207700_10568422 Ga0207700_105684222 125
104 3300025929 Ga0207664_10319608 Ga0207664_103196082 125
105 3300025931 Ga0207644_10122067 Ga0207644_101220673 125
106 3300025933 Ga0207706_10146415 Ga0207706_101464153 125
107 3300025936 Ga0207670_10024624 Ga0207670_100246245 125
108 3300025936 Ga0207670_10161604 Ga0207670_101616043 125
109 3300025945 Ga0207679_10145359 Ga0207679_101453592 125
110 3300025960 Ga0207651_10029282 Ga0207651_100292824 125
111 3300025972 Ga0207668_10390373 Ga0207668_103903732 125
112 3300026035 Ga0207703_11026298 Ga0207703_110262982 125
113 3300026088 Ga0207641_10379339 Ga0207641_103793392 125
114 3300026095 Ga0207676_11240043 Ga0207676_112400432 125
115 3300028379 Ga0268266_10014975 Ga0268266_100149757 125
116 3300028577 Ga0265318_10129401 Ga0265318_101294011 125
117 3300030763 Ga0265763_1005326 Ga0265763_10053262 125
118 3300030878 Ga0265770_1091025 Ga0265770_10910252 125
119 3300031090 Ga0265760_10068230 Ga0265760_100682302 125
120 3300031090 Ga0265760_10154690 Ga0265760_101546902 125
121 3300031247 Ga0265340_10155594 Ga0265340_101555942 125
122 3300031595 Ga0265313_10134121 Ga0265313_101341212 125
123 3300036401 Ga0373937_0040408 Ga0373937_0040408_3784_4161 125
124 3300039438 Ga0436360_1292194 Ga0436360_1292194_37_414 125
125 3300039447 Ga0436361_0155457 Ga0436361_0155457_139_516 125
126 3300044684 Ga0466966_0084708 Ga0466966_0084708_666_1043 125
127 3300044693 Ga0466961_0334398 Ga0466961_0334398_288_665 125
128 3300044694 Ga0466963_0074125 Ga0466963_0074125_628_1005 125
129 3300045049 Ga0466959_0516814 Ga0466959_0516814_193_570 125
130 3300045836 Ga0466958_0002799 Ga0466958_0002799_7406_7783 125
131 3300046514 Ga0495618_0294614 Ga0495618_0294614_334_711 125
132 3300048903 Ga0496100_0158380 Ga0496100_0158380_410_787 125
133 3300048909 Ga0496106_0751181 Ga0496106_0751181_297_674 125
134 3300048911 Ga0496108_0345749 Ga0496108_0345749_689_1066 125
135 3300048912 Ga0496109_1639602 Ga0496109_1639602_189_566 125
136 3300048913 Ga0496110_0456483 Ga0496110_0456483_306_683 125
137 3300048915 Ga0496112_0171245 Ga0496112_0171245_597_974 125
138 3300048915 Ga0496112_0245880 Ga0496112_0245880_1183_1560 125
139 3300048915 Ga0496112_0278207 Ga0496112_0278207_593_970 125
140 3300048916 Ga0496113_0299787 Ga0496113_0299787_439_816 125
141 3300048916 Ga0496113_0603350 Ga0496113_0603350_375_752 125
142 3300048917 Ga0496114_1059890 Ga0496114_1059890_11_388 125
143 3300048918 Ga0496115_0613354 Ga0496115_0613354_255_632 125
144 3300049571 Ga0501034_0394842 Ga0501034_0394842_43_420 125
145 3300049581 Ga0501047_0684300 Ga0501047_0684300_270_647 125
146 3300049823 Ga0501044_0745346 Ga0501044_0745346_270_647 125
147 3300050491 nmdc:mga00v17_1020068_c1 nmdc:mga00v17_1020068_c1_63_440 125
148 3300053117 Ga0500593_226356 Ga0500593_226356_203_580 125
149 3300053117 Ga0500593_310231 Ga0500593_310231_12_389 125
150 3300061719 Ga0466962_0140207 Ga0466962_0140207_538_915 125
151 3300005937 Ga0081455_10250051 Ga0081455_102500512 126
152 3300005981 Ga0081538_10014646 Ga0081538_100146463 126
153 3300009147 Ga0114129_10002965 Ga0114129_100029653 126
154 3300030878 Ga0265770_1003871 Ga0265770_10038712 126
155 3300039450 Ga0436363_0870860 Ga0436363_0870860_112_492 126
156 3300046692 Ga0495671_0512618 Ga0495671_0512618_116_496 126
157 3300050507 nmdc:mga05p37_20361_c1 nmdc:mga05p37_20361_c1_7159_7539 126
158 3300005330 Ga0070690_100099802 Ga0070690_1000998022 127
159 3300005981 Ga0081538_10022407 Ga0081538_100224073 127
160 3300005983 Ga0081540_1001188 Ga0081540_10011883 127
161 3300006844 Ga0075428_101147608 Ga0075428_1011476082 127
162 3300006846 Ga0075430_100018442 Ga0075430_1000184424 127
163 3300006847 Ga0075431_101730048 Ga0075431_1017300481 127
164 3300006871 Ga0075434_102318447 Ga0075434_1023184471 127
165 3300009094 Ga0111539_10894424 Ga0111539_108944242 127
166 3300013297 Ga0157378_10263061 Ga0157378_102630613 127
167 3300014968 Ga0157379_10861173 Ga0157379_108611731 127
168 3300025907 Ga0207645_10491920 Ga0207645_104919202 127
169 3300031235 Ga0265330_10025636 Ga0265330_100256362 127
170 3300031238 Ga0265332_10183051 Ga0265332_101830511 127
171 3300031241 Ga0265325_10065962 Ga0265325_100659622 127
172 3300031241 Ga0265325_10101493 Ga0265325_101014932 127
173 3300031242 Ga0265329_10030174 Ga0265329_100301742 127
174 3300031247 Ga0265340_10347475 Ga0265340_103474751 127
175 3300031249 Ga0265339_10318989 Ga0265339_103189891 127
176 3300031250 Ga0265331_10044695 Ga0265331_100446952 127
177 3300031344 Ga0265316_10202455 Ga0265316_102024552 127
178 3300031344 Ga0265316_10986366 Ga0265316_109863661 127
179 3300031595 Ga0265313_10060906 Ga0265313_100609062 127
180 3300031711 Ga0265314_10025141 Ga0265314_100251416 127
181 3300031712 Ga0265342_10399082 Ga0265342_103990822 127
182 3300039437 Ga0436365_0739414 Ga0436365_0739414_256_651 127
183 3300042009 Ga0439451_067463 Ga0439451_067463_261_644 127
184 3300046491 Ga0495584_0038648 Ga0495584_0038648_1699_2082 127
185 3300046492 Ga0495585_0311790 Ga0495585_0311790_47_430 127
186 3300046615 Ga0495656_0066025 Ga0495656_0066025_68_451 127
187 3300046664 Ga0495659_0126405 Ga0495659_0126405_216_599 127
188 3300046689 Ga0495613_1016972 Ga0495613_1016972_53_436 127
189 3300048904 Ga0496101_0127330 Ga0496101_0127330_580_963 127
190 3300048912 Ga0496109_0330823 Ga0496109_0330823_257_640 127
191 3300048917 Ga0496114_0017809 Ga0496114_0017809_545_928 127
192 3300048918 Ga0496115_0395884 Ga0496115_0395884_224_607 127
193 3300049570 Ga0501033_0716513 Ga0501033_0716513_151_534 127
194 3300049576 Ga0501040_0432185 Ga0501040_0432185_143_526 127
195 3300049578 Ga0501042_0134350 Ga0501042_0134350_390_773 127
196 3300049580 Ga0501046_0801509 Ga0501046_0801509_228_611 127
197 3300049582 Ga0501048_0521625 Ga0501048_0521625_139_522 127
198 3300049587 Ga0501071_0598383 Ga0501071_0598383_225_608 127
199 3300049592 Ga0501076_1526295 Ga0501076_1526295_35_418 127
200 3300049593 Ga0501077_0151562 Ga0501077_0151562_609_992 127
201 3300049741 Ga0501079_0169415 Ga0501079_0169415_179_562 127
202 3300049742 Ga0501080_1514616 Ga0501080_1514616_119_523 127
203 3300049743 Ga0501081_0662952 Ga0501081_0662952_214_597 127
204 3300049744 Ga0501083_0192281 Ga0501083_0192281_277_669 127
205 3300050508 nmdc:mga09592_1026499_c1 nmdc:mga09592_1026499_c1_219_605 127
206 3300050509 nmdc:mga0qj67_1186820_c1 nmdc:mga0qj67_1186820_c1_118_504 127
207 3300050509 nmdc:mga0qj67_14764_c1 nmdc:mga0qj67_14764_c1_1982_2368 127
208 3300050512 nmdc:mga0n895_944053_c1 nmdc:mga0n895_944053_c1_322_705 127
209 3300053077 Ga0495601_0362093 Ga0495601_0362093_447_830 127
210 3300053083 Ga0495655_0061023 Ga0495655_0061023_43_432 127
211 3300053161 Ga0500634_0000017 Ga0500634_0000017_73853_74263 127
212 3300053161 Ga0500634_0081898 Ga0500634_0081898_284_694 127
213 3300054114 Ga0501084_0291697 Ga0501084_0291697_167_550 127
214 3300060353 Ga0501082_0000428 Ga0501082_0000428_13577_13969 127
215 3300060353 Ga0501082_0544043 Ga0501082_0544043_318_701 127

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00072

Response_reg

Response regulator receiver domain

23

135

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
3a0u-assembly1.cif.gz_A crystal structure of response regulator protein trra (tm1360) from thermotoga maritima in complex with mg(2+)-bef (wild type) 0.9317 1 117
8fk2-assembly1.cif.gz_B the n-terminal vicr from streptococcus mutans 0.9222 1 121
3jte-assembly1.cif.gz_A crystal structure of response regulator receiver domain protein from clostridium thermocellum 0.9218 1 123
6tne-assembly1.cif.gz_A crystal structure of receiver domain from hybrid histidine kinase ccka 0.9213 3 119
2a9r-assembly1.cif.gz_A-2 rr02-rec phosphate in the active site 0.9209 3 121
ID Description Score Start End Superfamily
af_I1NCE1_621_722_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.972 2 71 3.40.50.2300
af_A0A0P0W8Y3_12_90_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9544 3 78 3.40.50.2300
af_O69730_8_88_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9539 1 82 3.40.50.2300
af_O07776_22_102_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9489 1 82 3.40.50.2300
af_Q9KJN4_1_80_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9471 1 82 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A0S2ESV3-F1-model_v4 Response regulatory domain-containing protein 0.9908 1 119 GO:0000160
AF-A0A537LCA5-F1-model_v4 Response regulator 0.9907 1 122 GO:0000160
AF-A0A4Q9GI52-F1-model_v4 Response regulator 0.9904 1 122 GO:0000160
AF-A0A327JQK9-F1-model_v4 Response regulator 0.9898 1 122 GO:0000160
GO:0003677
AF-A0A0F5LUC4-F1-model_v4 MFS transporter (Response regulator receiver domain-containing protein) 0.9888 1 121 GO:0000160

Feature Viewer

pLDDT pTM Quality
85.66 0.77 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map