F326524

General Info

Members Datasets Scaffolds Average Seq Length
215 167 430 281

Family's Representative Sequence

Representative Sequence 3300025944|Ga0207661_10099064|Ga0207661_100990643
Length 308
Sequence MSDRKLSSRPISWGSKRGSLRSTVLEMAKLATPTTLEQKLDHARDLFQQWGSVLVCFSGGIDSTLVLSLAQRALGEHAVGLTAVSPSLPASERADAERLATALGARHLFVDSHEIDRPGYVQNGPDRCFHCKSELYVIAQRKAEELGLAAIANGTNLDDLGDYRPGLEAARQAGVKSPLVEAGFGKQDVRDAARVLGIAAWDKPAAACLSSRIPYGTSVTPERLARIGGFEAELKALGFRQVRVRFHDEIARIEVALDELARLLEAGVRDRALEAGKRHGFRYVTLDLGGYRQGSHNEVLAGRSLRLV

Samples

Sample ID Description Type Environment
1 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
22 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
26 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
27 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
28 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
29 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
30 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
31 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
32 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
33 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
34 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
35 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
36 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
39 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
40 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
41 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
42 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
43 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
44 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
45 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
63 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
64 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
65 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
66 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
67 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
68 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
69 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
70 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
71 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
72 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
73 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
74 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
75 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
76 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
77 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
78 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
79 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
80 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
81 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
82 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
83 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
84 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
85 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
86 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
87 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
88 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
89 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
90 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
91 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
92 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
93 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
94 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
95 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
96 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
97 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
98 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
99 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
100 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
101 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
102 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
103 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
104 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
105 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
106 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
107 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
108 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
109 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
110 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
111 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
112 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
113 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
114 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
115 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
116 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
117 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
118 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
119 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
120 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
121 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
122 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
123 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
124 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
125 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
126 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
127 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
128 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
129 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
130 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
131 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
132 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
133 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
134 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
135 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
136 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
138 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
139 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
140 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
141 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
142 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
143 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
144 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
145 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
146 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
147 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
148 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
149 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
150 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
151 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
152 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
153 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
154 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
155 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
156 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
157 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
158 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
159 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
160 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
161 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
162 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
163 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
164 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
165 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
166 2711768088 Sporolactobacillus terrae DSM 11697 Isolate Rhizosphere
167 2881633906 Lactiplantibacillus garii FI11369 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.07
Metatranscriptomes 0
Isolates 0.93

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.4
Nodule 0
Rhizoplane 0.93
Rhizosphere 89.77
Stem 0
Stem Tuber 0
Unclassified 5.58

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207661_10099064 3300025944 Unclassified 2444
2 rootH2_10035728 3300003320 Bacteria 7297
3 rootL2_10080055 3300003322 Bacteria 2585
4 rootH1_10101855 3300003323 Bacteria 2852
5 Ga0070683_100021031 3300005329 Bacteria 5819
6 Ga0070670_100070569 3300005331 Bacteria 2999
7 Ga0070677_10019920 3300005333 Bacteria 2437
8 Ga0070682_100002382 3300005337 Bacteria 10414
9 Ga0068868_100004578 3300005338 Bacteria 9705
10 Ga0068868_100156451 3300005338 Bacteria 1880
11 Ga0070661_100264875 3300005344 Bacteria 1329
12 Ga0070675_100013936 3300005354 Bacteria 6328
13 Ga0070667_100386882 3300005367 Unclassified 1271
14 Ga0070709_10011093 3300005434 Bacteria 5011
15 Ga0070709_10056837 3300005434 Unclassified 2476
16 Ga0070714_100033453 3300005435 Bacteria 4297
17 Ga0070714_100060332 3300005435 Bacteria 3255
18 Ga0070713_100000487 3300005436 Bacteria 25295
19 Ga0070713_100289129 3300005436 Bacteria 1506
20 Ga0070710_10043206 3300005437 Bacteria 2495
21 Ga0070710_10072812 3300005437 Unclassified 1985
22 Ga0070711_100291091 3300005439 Bacteria 1295
23 Ga0070694_100158232 3300005444 Bacteria 1660
24 Ga0070663_100065681 3300005455 Bacteria 2627
25 Ga0070678_100067733 3300005456 Bacteria 2658
26 Ga0070706_100086144 3300005467 Bacteria 2911
27 Ga0070672_100000141 3300005543 Bacteria 38703
28 Ga0070665_100626293 3300005548 Bacteria 1089
29 Ga0068855_100024276 3300005563 Bacteria 7259
30 Ga0068856_100019098 3300005614 Bacteria 6652
31 Ga0068856_100284853 3300005614 Bacteria 1669
32 Ga0070717_10024308 3300006028 Unclassified 4809
33 Ga0070712_100005352 3300006175 Bacteria 7948
34 Ga0075366_10033178 3300006195 Bacteria 3041
35 Ga0075366_10141701 3300006195 Bacteria 1454
36 Ga0097621_100065157 3300006237 Bacteria 2997
37 Ga0097621_100230649 3300006237 Bacteria 1616
38 Ga0075428_100317156 3300006844 Bacteria 1675
39 Ga0075430_100099699 3300006846 Bacteria 2426
40 Ga0075433_10046510 3300006852 Bacteria 3775
41 Ga0075434_100182729 3300006871 Bacteria 2118
42 Ga0097620_100057141 3300006931 Bacteria 3930
43 Ga0075435_100014316 3300007076 Bacteria 5924
44 Ga0111539_10005338 3300009094 Bacteria 16624
45 Ga0114129_10002212 3300009147 Bacteria 26821
46 Ga0105242_10072608 3300009176 Bacteria 2858
47 Ga0157371_10457624 3300013102 Unclassified 939
48 Ga0157375_10479434 3300013308 Unclassified 1409
49 Ga0157380_10005134 3300014326 Bacteria 9149
50 Ga0157380_10335134 3300014326 Unclassified 1408
51 Ga0157376_10112053 3300014969 Bacteria 2403
52 Ga0157376_10278782 3300014969 Bacteria 1574
53 Ga0213874_10000060 3300021377 Bacteria 15959
54 Ga0213875_10008252 3300021388 Bacteria 5342
55 Ga0213875_10008761 3300021388 Bacteria 5163
56 Ga0207682_10110375 3300025893 Bacteria 1210
57 Ga0207699_10128250 3300025906 Bacteria 1651
58 Ga0207684_10047324 3300025910 Bacteria 3647
59 Ga0207663_10197764 3300025916 Bacteria 1448
60 Ga0207659_10098116 3300025926 Bacteria 2202
61 Ga0207700_10004896 3300025928 Bacteria 7956
62 Ga0207664_10016803 3300025929 Bacteria 5347
63 Ga0207664_10061567 3300025929 Unclassified 2995
64 Ga0207644_10023669 3300025931 Bacteria 4210
65 Ga0207686_10096245 3300025934 Bacteria 1966
66 Ga0207691_10003213 3300025940 Bacteria 15941
67 Ga0207691_10030997 3300025940 Bacteria 4993
68 Ga0207661_10011073 3300025944 Bacteria 6520
69 Ga0207679_10153369 3300025945 Bacteria 1878
70 Ga0207667_10000085 3300025949 Bacteria 151830
71 Ga0207667_10041599 3300025949 Bacteria 4886
72 Ga0207677_10001539 3300026023 Bacteria 12195
73 Ga0207678_10115033 3300026067 Bacteria 2295
74 Ga0207641_10710419 3300026088 Bacteria 990
75 Ga0207648_10358652 3300026089 Bacteria 1315
76 Ga0207683_10062894 3300026121 Bacteria 3269
77 Ga0207428_10077050 3300027907 Bacteria 2610
78 Ga0265337_1001353 3300028556 Bacteria 12090
79 Ga0265320_10000601 3300031240 Bacteria 27549
80 Ga0265339_10008148 3300031249 Bacteria 6689
81 Ga0265316_10003068 3300031344 Bacteria 17042
82 Ga0307513_10121091 3300031456 Unclassified 2584
83 Ga0307408_100013040 3300031548 Bacteria 5513
84 Ga0307408_100034504 3300031548 Bacteria 3544
85 Ga0265314_10000001 3300031711 Bacteria 3792860
86 Ga0265314_10028952 3300031711 Bacteria 4122
87 Ga0307516_10003246 3300031730 Bacteria 21096
88 Ga0307405_10001792 3300031731 Bacteria 9188
89 Ga0307405_10004501 3300031731 Bacteria 6596
90 Ga0307413_10002578 3300031824 Bacteria 7408
91 Ga0307413_10002798 3300031824 Bacteria 7183
92 Ga0307413_10230570 3300031824 Bacteria 1360
93 Ga0307410_10001397 3300031852 Bacteria 10869
94 Ga0307410_10002143 3300031852 Bacteria 9375
95 Ga0307410_10090464 3300031852 Bacteria 2171
96 Ga0307410_10152931 3300031852 Bacteria 1720
97 Ga0307406_10011265 3300031901 Bacteria 5072
98 Ga0307406_10015888 3300031901 Bacteria 4365
99 Ga0307406_10023633 3300031901 Bacteria 3660
100 Ga0307407_10002057 3300031903 Bacteria 7696
101 Ga0307407_10002122 3300031903 Bacteria 7621
102 Ga0307412_10016606 3300031911 Bacteria 4390
103 Ga0307412_10113145 3300031911 Bacteria 1941
104 Ga0307409_100000525 3300031995 Bacteria 16581
105 Ga0307409_100327279 3300031995 Bacteria 1436
106 Ga0307416_100012057 3300032002 Bacteria 5802
107 Ga0307416_100023454 3300032002 Bacteria 4478
108 Ga0307414_10076661 3300032004 Bacteria 2430
109 Ga0307411_10001088 3300032005 Bacteria 10561
110 Ga0307415_100004701 3300032126 Bacteria 7143
111 Ga0307415_100241778 3300032126 Bacteria 1461
112 Ga0307507_10045628 3300033179 Bacteria 4308
113 Ga0373934_0001394 3300035086 Bacteria 8817
114 Ga0373923_0005282 3300035111 Bacteria 4378
115 Ga0373953_0001725 3300035117 Bacteria 6445
116 Ga0373954_0007669 3300035118 Bacteria 4727
117 Ga0373956_0001473 3300035119 Bacteria 9725
118 Ga0373955_0000409 3300035172 Bacteria 18249
119 Ga0373931_0251516 3300035691 Bacteria 1075
120 Ga0373935_0022761 3300035692 Bacteria 3847
121 Ga0373927_0015490 3300035695 Bacteria 5037
122 Ga0373933_0000834 3300035724 Bacteria 18838
123 Ga0373937_0000144 3300036401 Bacteria 68655
124 Ga0373937_0411406 3300036401 Bacteria 1283
125 Ga0373925_0035049 3300037068 Bacteria 3701
126 Ga0436364_1236958 3300037853 Bacteria 15906
127 Ga0436363_0037010 3300039450 Bacteria 21575
128 Ga0436363_0266319 3300039450 Archaea 986
129 Ga0436363_0807389 3300039450 Bacteria 2859
130 Ga0436363_1419936 3300039450 Bacteria 1607
131 Ga0436363_1657689 3300039450 Bacteria 2705
132 Ga0439465_0072312 3300041413 Bacteria 1157
133 Ga0451797_0301052 3300041453 Unclassified 2371
134 Ga0451807_1244616 3300041486 Bacteria 1142
135 Ga0439445_0002834 3300042004 Bacteria 3874
136 Ga0451577_0000134 3300042876 Bacteria 165856
137 Ga0451577_0000382 3300042876 Bacteria 82167
138 Ga0451577_0031357 3300042876 Bacteria 4796
139 Ga0453683_0006674 3300044673 Bacteria 7897
140 Ga0466963_0473412 3300044694 Bacteria 884
141 Ga0453684_0000426 3300044712 Bacteria 172005
142 Ga0453684_0000776 3300044712 Bacteria 110037
143 Ga0453684_0016923 3300044712 Bacteria 11339
144 Ga0453684_0203920 3300044712 Bacteria 2303
145 Ga0453684_0460880 3300044712 Bacteria 1413
146 Ga0466970_0226993 3300044765 Bacteria 1043
147 Ga0466960_0035549 3300044901 Bacteria 2329
148 Ga0466960_0098026 3300044901 Bacteria 1505
149 Ga0451576_0036021 3300045051 Bacteria 5249
150 Ga0451576_0042264 3300045051 Bacteria 4813
151 Ga0466958_0035251 3300045836 Bacteria 2989
152 Ga0466967_0077914 3300045976 Bacteria 2985
153 Ga0466967_0351203 3300045976 Bacteria 1427
154 Ga0466967_0897304 3300045976 Bacteria 881
155 Ga0495592_0002871 3300046454 Bacteria 12254
156 Ga0495629_0019648 3300046459 Bacteria 4823
157 Ga0495651_0000208 3300046462 Bacteria 44905
158 Ga0495653_0001088 3300046463 Bacteria 20973
159 Ga0495608_0002865 3300046511 Bacteria 12344
160 Ga0495628_0000414 3300046516 Bacteria 39218
161 Ga0495630_0036930 3300046517 Bacteria 3652
162 Ga0495652_0013108 3300046529 Bacteria 7466
163 Ga0495587_0000166 3300046536 Bacteria 47900
164 Ga0495645_0000326 3300046543 Bacteria 33842
165 Ga0495667_0008451 3300046559 Bacteria 6987
166 Ga0495635_0001508 3300046663 Bacteria 15602
167 Ga0495657_0000359 3300046675 Bacteria 41984
168 Ga0495599_0018952 3300046678 Bacteria 4289
169 Ga0495623_0000312 3300046679 Bacteria 31331
170 Ga0495646_0003377 3300046680 Bacteria 9920
171 Ga0495613_0024672 3300046689 Bacteria 4480
172 Ga0495600_0000131 3300046809 Bacteria 42268
173 Ga0495604_0000528 3300047317 Bacteria 33758
174 Ga0495674_0005840 3300047319 Bacteria 11806
175 Ga0495680_0066972 3300047322 Bacteria 2746
176 Ga0495684_0000476 3300047471 Bacteria 32788
177 Ga0495602_0000999 3300048088 Bacteria 27489
178 Ga0496122_0089584 3300048925 Bacteria 2103
179 Ga0501034_0139245 3300049571 Bacteria 2407
180 Ga0501034_0439382 3300049571 Bacteria 1224
181 Ga0501038_0023457 3300049574 Bacteria 5515
182 Ga0501043_0024231 3300049579 Bacteria 4762
183 Ga0501047_0002553 3300049581 Bacteria 17354
184 Ga0501067_0002787 3300049583 Bacteria 9612
185 Ga0501068_0000154 3300049584 Bacteria 31816
186 Ga0501069_0003470 3300049585 Bacteria 8119
187 Ga0501070_0016991 3300049586 Bacteria 6105
188 Ga0501072_0000002 3300049588 Bacteria 319523
189 Ga0501073_0008395 3300049589 Bacteria 7662
190 Ga0501074_0003998 3300049590 Bacteria 10512
191 Ga0501074_0267038 3300049590 Bacteria 1216
192 Ga0501076_0009420 3300049592 Bacteria 7210
193 Ga0501077_0001475 3300049593 Bacteria 14172
194 Ga0501207_023219 3300049654 Bacteria 1006
195 Ga0501235_014022 3300049669 Bacteria 1767
196 Ga0501259_009536 3300049688 Bacteria 1577
197 Ga0501080_0011599 3300049742 Bacteria 8070
198 Ga0501083_0039892 3300049744 Bacteria 3188
199 nmdc:mga0k408_34337_c1 3300050493 Bacteria 2903
200 nmdc:mga05p37_1281_c1 3300050507 Bacteria 29212
201 nmdc:mga0qj67_88097_c1 3300050509 Bacteria 2492
202 nmdc:mga08y16_15804_c1 3300050511 Bacteria 7936
203 nmdc:mga0n895_436232_c1 3300050512 Bacteria 1323
204 nmdc:mga0rr50_114456_c1 3300050513 Bacteria 2139
205 nmdc:mga0a205_34733_c1 3300050515 Bacteria 4838
206 Ga0495612_0005786 3300053078 Bacteria 5104
207 Ga0495595_0015102 3300053084 Bacteria 3289
208 Ga0495619_0027357 3300053085 Bacteria 3671
209 Ga0501084_0000054 3300054114 Bacteria 90236
210 Ga0501084_0036694 3300054114 Bacteria 4095
211 Ga0501082_0000035 3300060353 Bacteria 96746
212 Ga0466962_0251278 3300061719 Unclassified 869
213 Ga0530510_0028074 3300061734 Bacteria 4035
214 2712197934 2711768088 Bacteria 3195027
215 2881634137 2881633906 Bacteria 2972201
216 Ga0207661_10099064
217 rootH2_10035728
218 rootL2_10080055
219 rootH1_10101855
220 Ga0070683_100021031
221 Ga0070670_100070569
222 Ga0070677_10019920
223 Ga0070682_100002382
224 Ga0068868_100004578
225 Ga0068868_100156451
226 Ga0070661_100264875
227 Ga0070675_100013936
228 Ga0070667_100386882
229 Ga0070709_10011093
230 Ga0070709_10056837
231 Ga0070714_100033453
232 Ga0070714_100060332
233 Ga0070713_100000487
234 Ga0070713_100289129
235 Ga0070710_10043206
236 Ga0070710_10072812
237 Ga0070711_100291091
238 Ga0070694_100158232
239 Ga0070663_100065681
240 Ga0070678_100067733
241 Ga0070706_100086144
242 Ga0070672_100000141
243 Ga0070665_100626293
244 Ga0068855_100024276
245 Ga0068856_100019098
246 Ga0068856_100284853
247 Ga0070717_10024308
248 Ga0070712_100005352
249 Ga0075366_10033178
250 Ga0075366_10141701
251 Ga0097621_100065157
252 Ga0097621_100230649
253 Ga0075428_100317156
254 Ga0075430_100099699
255 Ga0075433_10046510
256 Ga0075434_100182729
257 Ga0097620_100057141
258 Ga0075435_100014316
259 Ga0111539_10005338
260 Ga0114129_10002212
261 Ga0105242_10072608
262 Ga0157371_10457624
263 Ga0157375_10479434
264 Ga0157380_10005134
265 Ga0157380_10335134
266 Ga0157376_10112053
267 Ga0157376_10278782
268 Ga0213874_10000060
269 Ga0213875_10008252
270 Ga0213875_10008761
271 Ga0207682_10110375
272 Ga0207699_10128250
273 Ga0207684_10047324
274 Ga0207663_10197764
275 Ga0207659_10098116
276 Ga0207700_10004896
277 Ga0207664_10016803
278 Ga0207664_10061567
279 Ga0207644_10023669
280 Ga0207686_10096245
281 Ga0207691_10003213
282 Ga0207691_10030997
283 Ga0207661_10011073
284 Ga0207679_10153369
285 Ga0207667_10000085
286 Ga0207667_10041599
287 Ga0207677_10001539
288 Ga0207678_10115033
289 Ga0207641_10710419
290 Ga0207648_10358652
291 Ga0207683_10062894
292 Ga0207428_10077050
293 Ga0265337_1001353
294 Ga0265320_10000601
295 Ga0265339_10008148
296 Ga0265316_10003068
297 Ga0307513_10121091
298 Ga0307408_100013040
299 Ga0307408_100034504
300 Ga0265314_10000001
301 Ga0265314_10028952
302 Ga0307516_10003246
303 Ga0307405_10001792
304 Ga0307405_10004501
305 Ga0307413_10002578
306 Ga0307413_10002798
307 Ga0307413_10230570
308 Ga0307410_10001397
309 Ga0307410_10002143
310 Ga0307410_10090464
311 Ga0307410_10152931
312 Ga0307406_10011265
313 Ga0307406_10015888
314 Ga0307406_10023633
315 Ga0307407_10002057
316 Ga0307407_10002122
317 Ga0307412_10016606
318 Ga0307412_10113145
319 Ga0307409_100000525
320 Ga0307409_100327279
321 Ga0307416_100012057
322 Ga0307416_100023454
323 Ga0307414_10076661
324 Ga0307411_10001088
325 Ga0307415_100004701
326 Ga0307415_100241778
327 Ga0307507_10045628
328 Ga0373934_0001394
329 Ga0373923_0005282
330 Ga0373953_0001725
331 Ga0373954_0007669
332 Ga0373956_0001473
333 Ga0373955_0000409
334 Ga0373931_0251516
335 Ga0373935_0022761
336 Ga0373927_0015490
337 Ga0373933_0000834
338 Ga0373937_0000144
339 Ga0373937_0411406
340 Ga0373925_0035049
341 Ga0436364_1236958
342 Ga0436363_0037010
343 Ga0436363_0266319
344 Ga0436363_0807389
345 Ga0436363_1419936
346 Ga0436363_1657689
347 Ga0439465_0072312
348 Ga0451797_0301052
349 Ga0451807_1244616
350 Ga0439445_0002834
351 Ga0451577_0000134
352 Ga0451577_0000382
353 Ga0451577_0031357
354 Ga0453683_0006674
355 Ga0466963_0473412
356 Ga0453684_0000426
357 Ga0453684_0000776
358 Ga0453684_0016923
359 Ga0453684_0203920
360 Ga0453684_0460880
361 Ga0466970_0226993
362 Ga0466960_0035549
363 Ga0466960_0098026
364 Ga0451576_0036021
365 Ga0451576_0042264
366 Ga0466958_0035251
367 Ga0466967_0077914
368 Ga0466967_0351203
369 Ga0466967_0897304
370 Ga0495592_0002871
371 Ga0495629_0019648
372 Ga0495651_0000208
373 Ga0495653_0001088
374 Ga0495608_0002865
375 Ga0495628_0000414
376 Ga0495630_0036930
377 Ga0495652_0013108
378 Ga0495587_0000166
379 Ga0495645_0000326
380 Ga0495667_0008451
381 Ga0495635_0001508
382 Ga0495657_0000359
383 Ga0495599_0018952
384 Ga0495623_0000312
385 Ga0495646_0003377
386 Ga0495613_0024672
387 Ga0495600_0000131
388 Ga0495604_0000528
389 Ga0495674_0005840
390 Ga0495680_0066972
391 Ga0495684_0000476
392 Ga0495602_0000999
393 Ga0496122_0089584
394 Ga0501034_0139245
395 Ga0501034_0439382
396 Ga0501038_0023457
397 Ga0501043_0024231
398 Ga0501047_0002553
399 Ga0501067_0002787
400 Ga0501068_0000154
401 Ga0501069_0003470
402 Ga0501070_0016991
403 Ga0501072_0000002
404 Ga0501073_0008395
405 Ga0501074_0003998
406 Ga0501074_0267038
407 Ga0501076_0009420
408 Ga0501077_0001475
409 Ga0501207_023219
410 Ga0501235_014022
411 Ga0501259_009536
412 Ga0501080_0011599
413 Ga0501083_0039892
414 nmdc:mga0k408_34337_c1
415 nmdc:mga05p37_1281_c1
416 nmdc:mga0qj67_88097_c1
417 nmdc:mga08y16_15804_c1
418 nmdc:mga0n895_436232_c1
419 nmdc:mga0rr50_114456_c1
420 nmdc:mga0a205_34733_c1
421 Ga0495612_0005786
422 Ga0495595_0015102
423 Ga0495619_0027357
424 Ga0501084_0000054
425 Ga0501084_0036694
426 Ga0501082_0000035
427 Ga0466962_0251278
428 Ga0530510_0028074
429 2712197934
430 2881634137

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02540

NAD_synthase

NAD synthase

35

126

0.84

PF00733

Asn_synthase

Asparagine synthase

35

119

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
5udw-assembly1.cif.gz_B lare, a sulfur transferase involved in synthesis of the cofactor for lactate racemase, in complex with nickel 0.9381 6 264
6dg3-assembly2.cif.gz_D lare, a sulfur transferase involved in synthesis of the cofactor for lactate racemase, in complex with caesium 0.9356 7 263
5udv-assembly1.cif.gz_B lare, a sulfur transferase involved in synthesis of the cofactor for lactate racemase, in complex with iron 0.9355 6 264
6utq-assembly1.cif.gz_B lare, a sulfur transferase involved in synthesis of the cofactor for lactate racemase in complex with cadmium 0.9345 6 264
5udw-assembly1.cif.gz_B lare, a sulfur transferase involved in synthesis of the cofactor for lactate racemase, in complex with nickel 0.9345 6 264
ID Description Score Start End Superfamily
af_Q58240_5_163_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9213 11 172 3.40.50.620
af_Q58240_5_163_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9104 11 172 3.40.50.620
af_O96136_47_161_3.40.50.10130 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.7905 38 82 3.40.50.10130
af_P77718_175_396_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.7634 24 178 3.40.50.620
af_Q58366_8_148_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.7457 19 161 3.40.50.620
ID Description Score Start End GO Terms
AF-A0A6P0T2Z9-F1-model_v4 ATP-dependent sacrificial sulfur transferase LarE 0.9921 7 220 GO:0016783
AF-A0A354BF41-F1-model_v4 ATP-dependent sacrificial sulfur transferase LarE 0.9904 8 208 GO:0004066
GO:0006529
GO:0016783
AF-A0A2V7ASI4-F1-model_v4 ATP-dependent sacrificial sulfur transferase LarE 0.9862 7 228 GO:0016783
AF-A0A0F9CUY8-F1-model_v4 NAD/GMP synthase domain-containing protein 0.9855 3 220 GO:0016783
AF-A0A349K7C3-F1-model_v4 ATP-dependent sacrificial sulfur transferase LarE 0.9853 1 191 GO:0016783

Map