F325764

General Info

Members Datasets Scaffolds Average Seq Length
214 85 428 258

Family's Representative Sequence

Representative Sequence 3300050509|nmdc:mga0qj67_246750_c1|nmdc:mga0qj67_246750_c1_572_1438
Length 288
Sequence LKEAVSSITTDQGIVHYEVYGRGRPVILLHGWLGSWGLWQETMAYLGRYYRTYALDFWGFGESGKKRETYAVQDFVSLVNQFMEQLGIVHAPLVGHSMGGTVSLSVAIRYPERVSKVVVVGSPMVGSSLAPLLKIAGYRPSAFVIFNMMGPFRAFMKYYYSRVICSDPRFPAMMDRDLSRTTLESFLRSIASLRRTDLRPMLDQVKVPAMGMYGDRDKIVHPKQWQPMLKGIPQAFIERFPLAGHFPMLEEPQNFSEKLKMFLDKEYESPVLQAQSSPIPAPSVTLAP

Samples

Sample ID Description Type Environment
1 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
2 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
3 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
10 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
11 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
12 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
13 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
14 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
15 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
16 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
17 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
18 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
19 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
20 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
21 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
22 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
23 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
24 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
25 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
26 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
27 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
28 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
29 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
30 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
31 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
32 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
33 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
34 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
35 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
36 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
39 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
42 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
43 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
44 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
45 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
46 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
47 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
48 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
49 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
50 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
51 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
52 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
53 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
54 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
55 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
56 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
57 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
58 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
59 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
60 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
61 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
62 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
63 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
64 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
65 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
66 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
67 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
68 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
69 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
70 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
71 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
72 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
73 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
74 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
75 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
76 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
77 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
78 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
79 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
80 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
81 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
82 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
83 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
84 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
85 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.53
Metatranscriptomes 0.47
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 98.6
Stem 0
Stem Tuber 0
Unclassified 22.9

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga0qj67_246750_c1 3300050509 Unclassified 1449
2 SwRhRL3b_contig_4546601 2162886006 Bacteria 3917
3 SwRhRL2b_contig_1662820 2162886007 Bacteria 13559
4 Ga0065704_10070436 3300005289 Bacteria 24901
5 Ga0065712_10130871 3300005290 Bacteria 1546
6 Ga0065715_10102629 3300005293 Unclassified 3097
7 Ga0065707_10081813 3300005295 Bacteria 36984
8 Ga0065707_10083172 3300005295 Bacteria 10121
9 Ga0065707_10083192 3300005295 Bacteria 10070
10 Ga0065707_10088499 3300005295 Unclassified 4641
11 Ga0065707_10105968 3300005295 Bacteria 2620
12 Ga0065707_10161827 3300005295 Unclassified 1556
13 Ga0065707_10231235 3300005295 Bacteria 1188
14 Ga0070680_100114091 3300005336 Bacteria 2251
15 Ga0070705_100083610 3300005440 Unclassified 1968
16 Ga0070694_100031614 3300005444 Bacteria 3471
17 Ga0070694_100065978 3300005444 Unclassified 2482
18 Ga0070694_100116655 3300005444 Bacteria 1910
19 Ga0070706_100060960 3300005467 Bacteria 3483
20 Ga0070706_100149533 3300005467 Bacteria 2180
21 Ga0070706_100343713 3300005467 Unclassified 1391
22 Ga0070707_100006505 3300005468 Bacteria 10849
23 Ga0070707_100046307 3300005468 Bacteria 4162
24 Ga0070707_100185910 3300005468 Bacteria 2026
25 Ga0070698_100002370 3300005471 Bacteria 20791
26 Ga0070698_100615838 3300005471 Bacteria 1026
27 Ga0070699_100006613 3300005518 Bacteria 10080
28 Ga0070699_100010343 3300005518 Bacteria 8069
29 Ga0070699_100147625 3300005518 Unclassified 2078
30 Ga0070697_100126490 3300005536 Unclassified 2141
31 Ga0070686_100027420 3300005544 Unclassified 3448
32 Ga0070695_100106196 3300005545 Unclassified 1899
33 Ga0070696_100325501 3300005546 Unclassified 1184
34 Ga0070704_100061130 3300005549 Unclassified 2694
35 Ga0068857_100464343 3300005577 Unclassified 1185
36 Ga0068859_100017279 3300005617 Bacteria 7245
37 Ga0068859_100024664 3300005617 Bacteria 6035
38 Ga0068859_100230244 3300005617 Bacteria 1941
39 Ga0068861_100109680 3300005719 Bacteria 2209
40 Ga0068861_100325273 3300005719 Bacteria 1340
41 Ga0068862_100116587 3300005844 Bacteria 2349
42 Ga0068862_100206064 3300005844 Unclassified 1775
43 Ga0081539_10001161 3300005985 Bacteria 47662
44 Ga0081539_10006506 3300005985 Bacteria 11168
45 Ga0075428_100131496 3300006844 Unclassified 2722
46 Ga0075428_100134818 3300006844 Bacteria 2685
47 Ga0075428_100150310 3300006844 Bacteria 2530
48 Ga0075430_100100037 3300006846 Unclassified 2422
49 Ga0075431_100030104 3300006847 Bacteria 5589
50 Ga0075431_100052475 3300006847 Bacteria 4205
51 Ga0075431_100618121 3300006847 Unclassified 1066
52 Ga0075429_100043974 3300006880 Unclassified 3885
53 Ga0075429_100046201 3300006880 Bacteria 3789
54 Ga0075429_100171525 3300006880 Bacteria 1900
55 Ga0097620_100017279 3300006931 Bacteria 7245
56 Ga0097620_100024663 3300006931 Bacteria 6035
57 Ga0097620_100230247 3300006931 Bacteria 1941
58 Ga0111539_10028519 3300009094 Bacteria 6809
59 Ga0114129_10001409 3300009147 Bacteria 32415
60 Ga0114129_10003228 3300009147 Bacteria 22877
61 Ga0114129_10006964 3300009147 Bacteria 16086
62 Ga0114129_10014119 3300009147 Bacteria 11377
63 Ga0114129_10055637 3300009147 Bacteria 5544
64 Ga0114129_10240372 3300009147 Bacteria 2434
65 Ga0105243_10004321 3300009148 Bacteria 11254
66 Ga0105243_10170615 3300009148 Bacteria 1884
67 Ga0105242_10360692 3300009176 Unclassified 1345
68 Ga0105249_10051139 3300009553 Bacteria 3768
69 Ga0105246_10011261 3300011119 Bacteria 5548
70 Ga0207646_10515163 3300025922 Bacteria 1077
71 Ga0207709_10035208 3300025935 Bacteria 2959
72 Ga0207674_10383407 3300026116 Unclassified 1359
73 Ga0207675_100046165 3300026118 Bacteria 4068
74 Ga0207675_100512961 3300026118 Bacteria 1194
75 Ga0268265_10010061 3300028380 Bacteria 6385
76 Ga0265334_10018671 3300028573 Bacteria 2859
77 Ga0265318_10005800 3300028577 Bacteria 5757
78 Ga0265323_10050139 3300028653 Bacteria 1485
79 Ga0265338_10026048 3300028800 Bacteria 5913
80 Ga0265330_10052971 3300031235 Bacteria 1777
81 Ga0265340_10000742 3300031247 Bacteria 18517
82 Ga0265331_10010734 3300031250 Bacteria 5048
83 Ga0265327_10043907 3300031251 Bacteria 2387
84 Ga0307408_100213537 3300031548 Bacteria 1570
85 Ga0316575_10001905 3300031665 Bacteria 6888
86 Ga0316575_10002710 3300031665 Bacteria 5977
87 Ga0316579_10012635 3300031691 Bacteria 3617
88 Ga0316579_10073705 3300031691 Bacteria 1620
89 Ga0316579_10085121 3300031691 Unclassified 1508
90 Ga0316579_10111354 3300031691 Unclassified 1314
91 Ga0316576_10052440 3300031727 Bacteria 2970
92 Ga0316576_10141466 3300031727 Bacteria 1812
93 Ga0316576_10172805 3300031727 Bacteria 1631
94 Ga0316578_10051804 3300031728 Bacteria 2404
95 Ga0316577_10006932 3300031733 Bacteria 6021
96 Ga0316577_10028343 3300031733 Bacteria 3124
97 Ga0316577_10079385 3300031733 Bacteria 1833
98 Ga0316577_10104715 3300031733 Unclassified 1587
99 Ga0316577_10137202 3300031733 Unclassified 1377
100 Ga0307407_10149058 3300031903 Bacteria 1518
101 Ga0307412_10136068 3300031911 Bacteria 1793
102 Ga0307409_100238491 3300031995 Bacteria 1654
103 Ga0316585_10007218 3300032137 Bacteria 3197
104 Ga0316593_10007995 3300032168 Bacteria 2930
105 Ga0373949_0034731 3300035090 Unclassified 1217
106 Ga0316574_0020095 3300035398 Bacteria 3949
107 Ga0316574_0039628 3300035398 Unclassified 2898
108 Ga0316574_0041922 3300035398 Bacteria 2822
109 Ga0316582_0000238 3300036647 Bacteria 18205
110 Ga0316582_0048253 3300036647 Unclassified 2692
111 Ga0316584_0001300 3300036712 Bacteria 14751
112 Ga0316584_0013693 3300036712 Bacteria 5750
113 Ga0316584_0027796 3300036712 Bacteria 4165
114 Ga0316584_0060611 3300036712 Unclassified 2834
115 Ga0316584_0095089 3300036712 Bacteria 2231
116 Ga0316581_0002784 3300037588 Bacteria 4252
117 Ga0316581_0006034 3300037588 Unclassified 3189
118 Ga0400490_27060 3300038726 Bacteria 1284
119 Ga0400489_77470 3300039093 Unclassified 1209
120 Ga0400487_32151 3300039110 Unclassified 1851
121 Ga0451577_0003866 3300042876 Bacteria 16255
122 Ga0451577_0014533 3300042876 Bacteria 7336
123 Ga0451577_0052278 3300042876 Bacteria 3648
124 Ga0451577_0097419 3300042876 Bacteria 2627
125 Ga0451577_0118254 3300042876 Bacteria 2374
126 Ga0451577_0178259 3300042876 Unclassified 1916
127 Ga0451577_0194541 3300042876 Bacteria 1830
128 Ga0451577_0233884 3300042876 Bacteria 1662
129 Ga0451577_0382313 3300042876 Bacteria 1278
130 Ga0451577_0502788 3300042876 Bacteria 1100
131 Ga0451577_0586358 3300042876 Bacteria 1012
132 Ga0453683_0006309 3300044673 Bacteria 8142
133 Ga0453683_0047452 3300044673 Bacteria 2693
134 Ga0453683_0086643 3300044673 Bacteria 1962
135 Ga0453683_0088769 3300044673 Unclassified 1938
136 Ga0453683_0113002 3300044673 Bacteria 1708
137 Ga0453683_0147091 3300044673 Unclassified 1488
138 Ga0453683_0181684 3300044673 Bacteria 1334
139 Ga0453683_0223518 3300044673 Unclassified 1198
140 Ga0453684_0000012 3300044712 Bacteria 1062512
141 Ga0453684_0000023 3300044712 Bacteria 857153
142 Ga0453684_0000162 3300044712 Bacteria 298154
143 Ga0453684_0000541 3300044712 Bacteria 143452
144 Ga0453684_0000627 3300044712 Bacteria 128570
145 Ga0453684_0001029 3300044712 Bacteria 89157
146 Ga0453684_0001517 3300044712 Bacteria 65158
147 Ga0453684_0005654 3300044712 Bacteria 24568
148 Ga0453684_0012754 3300044712 Bacteria 13798
149 Ga0453684_0013135 3300044712 Bacteria 13506
150 Ga0453684_0014283 3300044712 Bacteria 12734
151 Ga0453684_0035034 3300044712 Bacteria 6949
152 Ga0453684_0048669 3300044712 Bacteria 5599
153 Ga0453684_0058666 3300044712 Unclassified 4970
154 Ga0453684_0063933 3300044712 Bacteria 4703
155 Ga0453684_0066863 3300044712 Bacteria 4574
156 Ga0453684_0117760 3300044712 Bacteria 3214
157 Ga0453684_0133020 3300044712 Bacteria 2982
158 Ga0453684_0201776 3300044712 Bacteria 2318
159 Ga0453684_0205347 3300044712 Unclassified 2293
160 Ga0453684_0248889 3300044712 Bacteria 2042
161 Ga0453684_0260764 3300044712 Bacteria 1985
162 Ga0453684_0267246 3300044712 Unclassified 1956
163 Ga0453684_0284619 3300044712 Bacteria 1884
164 Ga0453684_0404047 3300044712 Bacteria 1529
165 Ga0453684_0437680 3300044712 Unclassified 1458
166 Ga0453684_0448642 3300044712 Bacteria 1436
167 Ga0453684_0472599 3300044712 Bacteria 1392
168 Ga0453684_0487413 3300044712 Bacteria 1367
169 Ga0453684_0674005 3300044712 Unclassified 1126
170 Ga0453684_0792029 3300044712 Bacteria 1023
171 Ga0453684_0972172 3300044712 Unclassified 905
172 Ga0451576_0011005 3300045051 Bacteria 10331
173 Ga0451576_0025800 3300045051 Bacteria 6330
174 Ga0451576_0053407 3300045051 Bacteria 4233
175 Ga0451576_0053915 3300045051 Bacteria 4210
176 Ga0451576_0061026 3300045051 Bacteria 3932
177 Ga0451576_0077289 3300045051 Bacteria 3464
178 Ga0451576_0107458 3300045051 Bacteria 2903
179 Ga0451576_0159895 3300045051 Bacteria 2350
180 Ga0451576_0325354 3300045051 Bacteria 1609
181 Ga0451576_0401087 3300045051 Bacteria 1438
182 Ga0451576_0526783 3300045051 Bacteria 1241
183 Ga0451576_0681345 3300045051 Bacteria 1080
184 Ga0451576_1153447 3300045051 Bacteria 810
185 Ga0495585_0251966 3300046492 Bacteria 881
186 Ga0501072_0265309 3300049588 Unclassified 1366
187 Ga0501072_0356100 3300049588 Bacteria 1162
188 Ga0501075_0002186 3300049591 Bacteria 12936
189 Ga0501075_0044264 3300049591 Bacteria 3340
190 Ga0501076_0006363 3300049592 Bacteria 8562
191 Ga0501079_0096055 3300049741 Unclassified 2297
192 Ga0501080_0018316 3300049742 Bacteria 6481
193 Ga0501080_0318799 3300049742 Unclassified 1408
194 Ga0501081_0036348 3300049743 Bacteria 3359
195 nmdc:mga05p37_107522_c1 3300050507 Bacteria 3432
196 nmdc:mga05p37_11211_c1 3300050507 Bacteria 10656
197 nmdc:mga05p37_27604_c1 3300050507 Bacteria 6913
198 nmdc:mga05p37_307724_c1 3300050507 Bacteria 1879
199 nmdc:mga05p37_67788_c1 3300050507 Unclassified 4390
200 nmdc:mga09592_148507_c1 3300050508 Bacteria 2022
201 nmdc:mga09592_2553_c1 3300050508 Bacteria 14736
202 nmdc:mga09592_28071_c1 3300050508 Bacteria 4673
203 nmdc:mga09592_40698_c1 3300050508 Unclassified 3905
204 nmdc:mga09592_65606_c1 3300050508 Bacteria 3076
205 nmdc:mga09592_97051_c1 3300050508 Bacteria 2522
206 nmdc:mga0qj67_151696_c1 3300050509 Unclassified 1880
207 nmdc:mga06r32_138819_c1 3300050510 Bacteria 2406
208 nmdc:mga06r32_176810_c1 3300050510 Bacteria 2119
209 nmdc:mga06r32_300769_c1 3300050510 Bacteria 1590
210 nmdc:mga06r32_596046_c1 3300050510 Unclassified 1076
211 nmdc:mga0n895_100667_c1 3300050512 Bacteria 2899
212 nmdc:mga0a205_25716_c1 3300050515 Bacteria 5610
213 Ga0501084_0025687 3300054114 Bacteria 4912
214 Ga0501082_0231758 3300060353 Bacteria 1607
215 nmdc:mga0qj67_246750_c1
216 SwRhRL3b_contig_4546601
217 SwRhRL2b_contig_1662820
218 Ga0065704_10070436
219 Ga0065712_10130871
220 Ga0065715_10102629
221 Ga0065707_10081813
222 Ga0065707_10083172
223 Ga0065707_10083192
224 Ga0065707_10088499
225 Ga0065707_10105968
226 Ga0065707_10161827
227 Ga0065707_10231235
228 Ga0070680_100114091
229 Ga0070705_100083610
230 Ga0070694_100031614
231 Ga0070694_100065978
232 Ga0070694_100116655
233 Ga0070706_100060960
234 Ga0070706_100149533
235 Ga0070706_100343713
236 Ga0070707_100006505
237 Ga0070707_100046307
238 Ga0070707_100185910
239 Ga0070698_100002370
240 Ga0070698_100615838
241 Ga0070699_100006613
242 Ga0070699_100010343
243 Ga0070699_100147625
244 Ga0070697_100126490
245 Ga0070686_100027420
246 Ga0070695_100106196
247 Ga0070696_100325501
248 Ga0070704_100061130
249 Ga0068857_100464343
250 Ga0068859_100017279
251 Ga0068859_100024664
252 Ga0068859_100230244
253 Ga0068861_100109680
254 Ga0068861_100325273
255 Ga0068862_100116587
256 Ga0068862_100206064
257 Ga0081539_10001161
258 Ga0081539_10006506
259 Ga0075428_100131496
260 Ga0075428_100134818
261 Ga0075428_100150310
262 Ga0075430_100100037
263 Ga0075431_100030104
264 Ga0075431_100052475
265 Ga0075431_100618121
266 Ga0075429_100043974
267 Ga0075429_100046201
268 Ga0075429_100171525
269 Ga0097620_100017279
270 Ga0097620_100024663
271 Ga0097620_100230247
272 Ga0111539_10028519
273 Ga0114129_10001409
274 Ga0114129_10003228
275 Ga0114129_10006964
276 Ga0114129_10014119
277 Ga0114129_10055637
278 Ga0114129_10240372
279 Ga0105243_10004321
280 Ga0105243_10170615
281 Ga0105242_10360692
282 Ga0105249_10051139
283 Ga0105246_10011261
284 Ga0207646_10515163
285 Ga0207709_10035208
286 Ga0207674_10383407
287 Ga0207675_100046165
288 Ga0207675_100512961
289 Ga0268265_10010061
290 Ga0265334_10018671
291 Ga0265318_10005800
292 Ga0265323_10050139
293 Ga0265338_10026048
294 Ga0265330_10052971
295 Ga0265340_10000742
296 Ga0265331_10010734
297 Ga0265327_10043907
298 Ga0307408_100213537
299 Ga0316575_10001905
300 Ga0316575_10002710
301 Ga0316579_10012635
302 Ga0316579_10073705
303 Ga0316579_10085121
304 Ga0316579_10111354
305 Ga0316576_10052440
306 Ga0316576_10141466
307 Ga0316576_10172805
308 Ga0316578_10051804
309 Ga0316577_10006932
310 Ga0316577_10028343
311 Ga0316577_10079385
312 Ga0316577_10104715
313 Ga0316577_10137202
314 Ga0307407_10149058
315 Ga0307412_10136068
316 Ga0307409_100238491
317 Ga0316585_10007218
318 Ga0316593_10007995
319 Ga0373949_0034731
320 Ga0316574_0020095
321 Ga0316574_0039628
322 Ga0316574_0041922
323 Ga0316582_0000238
324 Ga0316582_0048253
325 Ga0316584_0001300
326 Ga0316584_0013693
327 Ga0316584_0027796
328 Ga0316584_0060611
329 Ga0316584_0095089
330 Ga0316581_0002784
331 Ga0316581_0006034
332 Ga0400490_27060
333 Ga0400489_77470
334 Ga0400487_32151
335 Ga0451577_0003866
336 Ga0451577_0014533
337 Ga0451577_0052278
338 Ga0451577_0097419
339 Ga0451577_0118254
340 Ga0451577_0178259
341 Ga0451577_0194541
342 Ga0451577_0233884
343 Ga0451577_0382313
344 Ga0451577_0502788
345 Ga0451577_0586358
346 Ga0453683_0006309
347 Ga0453683_0047452
348 Ga0453683_0086643
349 Ga0453683_0088769
350 Ga0453683_0113002
351 Ga0453683_0147091
352 Ga0453683_0181684
353 Ga0453683_0223518
354 Ga0453684_0000012
355 Ga0453684_0000023
356 Ga0453684_0000162
357 Ga0453684_0000541
358 Ga0453684_0000627
359 Ga0453684_0001029
360 Ga0453684_0001517
361 Ga0453684_0005654
362 Ga0453684_0012754
363 Ga0453684_0013135
364 Ga0453684_0014283
365 Ga0453684_0035034
366 Ga0453684_0048669
367 Ga0453684_0058666
368 Ga0453684_0063933
369 Ga0453684_0066863
370 Ga0453684_0117760
371 Ga0453684_0133020
372 Ga0453684_0201776
373 Ga0453684_0205347
374 Ga0453684_0248889
375 Ga0453684_0260764
376 Ga0453684_0267246
377 Ga0453684_0284619
378 Ga0453684_0404047
379 Ga0453684_0437680
380 Ga0453684_0448642
381 Ga0453684_0472599
382 Ga0453684_0487413
383 Ga0453684_0674005
384 Ga0453684_0792029
385 Ga0453684_0972172
386 Ga0451576_0011005
387 Ga0451576_0025800
388 Ga0451576_0053407
389 Ga0451576_0053915
390 Ga0451576_0061026
391 Ga0451576_0077289
392 Ga0451576_0107458
393 Ga0451576_0159895
394 Ga0451576_0325354
395 Ga0451576_0401087
396 Ga0451576_0526783
397 Ga0451576_0681345
398 Ga0451576_1153447
399 Ga0495585_0251966
400 Ga0501072_0265309
401 Ga0501072_0356100
402 Ga0501075_0002186
403 Ga0501075_0044264
404 Ga0501076_0006363
405 Ga0501079_0096055
406 Ga0501080_0018316
407 Ga0501080_0318799
408 Ga0501081_0036348
409 nmdc:mga05p37_107522_c1
410 nmdc:mga05p37_11211_c1
411 nmdc:mga05p37_27604_c1
412 nmdc:mga05p37_307724_c1
413 nmdc:mga05p37_67788_c1
414 nmdc:mga09592_148507_c1
415 nmdc:mga09592_2553_c1
416 nmdc:mga09592_28071_c1
417 nmdc:mga09592_40698_c1
418 nmdc:mga09592_65606_c1
419 nmdc:mga09592_97051_c1
420 nmdc:mga0qj67_151696_c1
421 nmdc:mga06r32_138819_c1
422 nmdc:mga06r32_176810_c1
423 nmdc:mga06r32_300769_c1
424 nmdc:mga06r32_596046_c1
425 nmdc:mga0n895_100667_c1
426 nmdc:mga0a205_25716_c1
427 Ga0501084_0025687
428 Ga0501082_0231758

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00561

Abhydrolase_1

alpha/beta hydrolase fold

24

252

0.9

PF00756

Esterase

Putative esterase

49

223

0.77

PF12146

Hydrolase_4

Serine aminopeptidase, S33

23

252

0.77

PF12697

Abhydrolase_6

Alpha/beta hydrolase family

26

258

0.57

Structural Annotation

Top 5 Hits

ID Description Score Start End
8pi1-assembly1.cif.gz_B bicyclic incypro pseudomonas fluorescens esterase 0.8855 2 261
3ia2-assembly2.cif.gz_D pseudomonas fluorescens esterase complexed to the r-enantiomer of a sulfonate transition state analog 0.8841 2 260
3t4u-assembly1.cif.gz_A l29i mutation in an aryl esterase from pseudomonas fluorescens leads to unique peptide flip and increased activity 0.8835 2 260
3fob-assembly1.cif.gz_B crystal structure of bromoperoxidase from bacillus anthracis 0.882 2 260
4dgq-assembly1.cif.gz_C crystal structure of non-heme chloroperoxidase from burkholderia cenocepacia 0.8797 3 260
ID Description Score Start End Superfamily
af_Q9NQF3_11_190_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9094 2 119 3.40.50.1820
af_I1KMX1_1_216_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8845 2 116 3.40.50.1820
af_P9WNH3_12_303_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8839 2 268 3.40.50.1820
2xuaH00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8788 2 260 3.40.50.1820
4dgqB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8771 3 260 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A2W6AZZ2-F1-model_v4 Alpha/beta hydrolase 0.9419 1 260 GO:0016020
GO:0016787
AF-A0A2W6AZZ2-F1-model_v4 Alpha/beta hydrolase 0.928 1 260 GO:0016020
GO:0016787
AF-A0A7W1LDM9-F1-model_v4 Alpha/beta fold hydrolase 0.9278 2 110 GO:0016787
AF-A0A2N2YBN3-F1-model_v4 Alpha/beta hydrolase 0.9231 2 115 GO:0016020
GO:0016787
AF-A0A381UGQ8-F1-model_v4 AB hydrolase-1 domain-containing protein 0.922 2 115 GO:0006508
GO:0008233
GO:0016020

Map