F325745

General Info

Members Datasets Scaffolds Average Seq Length
214 150 205 114

Family's Representative Sequence

Representative Sequence 3300049758|Ga0501241_001295|Ga0501241_001295_2818_3216
Length 132
Sequence MDSTIPADSAIRKESKANNMLSKGGCPKTMLSIRDALEALEGKWKLLILFSLSEGAPKRFKEIGRAVNGITDKTLSKELKSLEANKLIKREVYDTFPPAVEYTITPHGLSLEKVLDELHFWGLSHRKKVIGK

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 2588254257 Chryseobacterium sp. YR203 Isolate Rhizosphere
3 2738541278 Niastella sp. CF465 Isolate Unclassified
4 2739367874 Chryseobacterium sp. T16E-39 Isolate Unclassified
5 2818991444 Filimonas endophytica 3197 Isolate Unclassified
6 2904419702 Flavobacterium sp. 1355 Isolate Rhizosphere
7 2904555929 Flavobacterium sp. 1750 Isolate Rhizosphere
8 2919191525 Flavobacterium sp. 2755 Isolate Rhizosphere
9 2919692658 Algoriphagus sp. 4150 Isolate Rhizosphere
10 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
11 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
12 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
13 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
14 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
15 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
16 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
17 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
18 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
19 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
20 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
21 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
22 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
23 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
24 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
44 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
45 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
47 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
49 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
50 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
51 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
52 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
53 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
54 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
55 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
56 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
57 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
58 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
59 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
60 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
61 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
62 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
63 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
66 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
80 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
83 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
84 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
85 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
86 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
87 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
88 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
89 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
90 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
91 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
92 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
93 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
94 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
95 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
96 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
97 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
98 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
99 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
100 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
101 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
102 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
103 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
104 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
105 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
106 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
107 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
108 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
109 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
110 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
111 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
112 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
113 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
114 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
115 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
116 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
117 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
118 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
119 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
120 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
121 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
122 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
123 3300049676 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control Metagenome Rhizosphere
124 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
125 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
126 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
127 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
128 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
129 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
130 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
131 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
132 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
133 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
134 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
135 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
136 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
137 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
138 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
139 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
140 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
141 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
142 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
143 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
144 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
145 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
146 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
147 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
148 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
149 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
150 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.79
Metatranscriptomes 0
Isolates 4.21

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 20.56
Nodule 0
Rhizoplane 1.87
Rhizosphere 55.14
Stem 0
Stem Tuber 0
Unclassified 22.43

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_2385529 2162886012 Bacteria 1173
2 JGI25159J45721_1016899 3300002987 Unclassified 1534
3 rootH1_10000954 3300003316 Bacteria 2719
4 rootH1_10116811 3300003316 Bacteria 1637
5 rootH2_10035575 3300003320 Bacteria 8979
6 rootH2_10037604 3300003320 Bacteria 17285
7 rootH2_10052059 3300003320 Bacteria 1895
8 rootH2_10052060 3300003320 Bacteria 1546
9 rootH2_10107411 3300003320 Bacteria 1157
10 rootH2_10162807 3300003320 Unclassified 1509
11 rootH2_10311399 3300003320 Unclassified 1444
12 rootL2_10011536 3300003322 Bacteria 7296
13 rootL2_10040595 3300003322 Bacteria 6527
14 rootL2_10042318 3300003322 Bacteria 10855
15 rootL2_10077340 3300003322 Bacteria 4202
16 rootL2_10106168 3300003322 Bacteria 10378
17 rootL2_10285143 3300003322 Bacteria 1122
18 rootL2_10299585 3300003322 Unclassified 1319
19 rootL2_10376475 3300003322 Unclassified 1529
20 rootH1_10017228 3300003323 Bacteria 19763
21 rootH1_10028833 3300003323 Bacteria 3575
22 rootH1_10058094 3300003323 Bacteria 20461
23 rootH1_10097218 3300003323 Bacteria 3918
24 rootH1_10144806 3300003323 Bacteria 1671
25 rootH1_10148381 3300003323 Bacteria 4590
26 rootH1_10227413 3300003323 Unclassified 1466
27 rootH1_10331693 3300003323 Bacteria 1610
28 rootH1_10370721 3300003323 Bacteria 1339
29 rootH1_10394744 3300003323 Bacteria 2058
30 JGI25160J50197_1002403 3300003354 Bacteria 8727
31 Ga0055536_1005099 3300003781 Bacteria 6513
32 Ga0055531_10000128 3300003794 Bacteria 85521
33 Ga0055531_10000198 3300003794 Bacteria 66737
34 Ga0055543_1017804 3300004625 Bacteria 1331
35 Ga0065165_1000259 3300005262 Bacteria 91800
36 Ga0065165_1001904 3300005262 Bacteria 20002
37 Ga0065704_10074739 3300005289 Bacteria 6030
38 Ga0065704_10279481 3300005289 Bacteria 925
39 Ga0065704_10689539 3300005289 Unclassified 566
40 Ga0065707_10110041 3300005295 Bacteria 2446
41 Ga0070658_10123366 3300005327 Bacteria 2154
42 Ga0070670_100040363 3300005331 Bacteria 4013
43 Ga0068869_100110139 3300005334 Bacteria 2094
44 Ga0070668_100068792 3300005347 Bacteria 2753
45 Ga0070669_100001368 3300005353 Bacteria 17581
46 Ga0070669_100075866 3300005353 Unclassified 2494
47 Ga0070669_100380280 3300005353 Bacteria 1151
48 Ga0070675_100009028 3300005354 Bacteria 7743
49 Ga0070673_100010757 3300005364 Bacteria 6209
50 Ga0070688_100056291 3300005365 Bacteria 2469
51 Ga0070659_100985759 3300005366 Bacteria 739
52 Ga0070701_10355377 3300005438 Bacteria 916
53 Ga0070700_100674623 3300005441 Bacteria 819
54 Ga0070694_100346140 3300005444 Bacteria 1150
55 Ga0070662_100014273 3300005457 Bacteria 5304
56 Ga0070685_10578001 3300005466 Bacteria 806
57 Ga0068857_100125189 3300005577 Bacteria 2315
58 Ga0068857_100220030 3300005577 Unclassified 1734
59 Ga0068854_100019281 3300005578 Bacteria 4594
60 Ga0068859_100008110 3300005617 Bacteria 10652
61 Ga0068861_100011136 3300005719 Bacteria 6244
62 Ga0068870_10011165 3300005840 Bacteria 4155
63 Ga0068860_101246062 3300005843 Bacteria 764
64 Ga0068862_100001122 3300005844 Bacteria 25408
65 Ga0075366_10324002 3300006195 Bacteria 944
66 Ga0068865_100901355 3300006881 Bacteria 769
67 Ga0097620_100008110 3300006931 Bacteria 10652
68 Ga0105240_10000117 3300009093 Bacteria 165286
69 Ga0111539_10005337 3300009094 Bacteria 16625
70 Ga0105242_10782012 3300009176 Bacteria 943
71 Ga0105248_12394783 3300009177 Bacteria 601
72 Ga0105249_10019587 3300009553 Bacteria 6038
73 Ga0105239_10200297 3300010375 Bacteria 2237
74 Ga0157373_10329828 3300013100 Bacteria 1086
75 Ga0157371_10125619 3300013102 Bacteria 1824
76 Ga0157371_10714048 3300013102 Bacteria 751
77 Ga0157370_10000043 3300013104 Bacteria 132770
78 Ga0157370_10311165 3300013104 Bacteria 1453
79 Ga0157370_10678189 3300013104 Bacteria 941
80 Ga0157370_11340342 3300013104 Bacteria 644
81 Ga0157372_12908309 3300013307 Unclassified 548
82 Ga0157375_10029807 3300013308 Bacteria 5136
83 Ga0157375_10046228 3300013308 Bacteria 4242
84 Ga0157380_10003234 3300014326 Bacteria 11140
85 Ga0157380_10417957 3300014326 Unclassified 1278
86 Ga0163161_10062268 3300017792 Bacteria 2717
87 Ga0163161_10224009 3300017792 Bacteria 1457
88 Ga0163161_10548511 3300017792 Bacteria 947
89 Ga0209436_102937 3300025208 Unclassified 4769
90 Ga0209258_106948 3300025242 Unclassified 1719
91 Ga0209646_1002460 3300025246 Bacteria 4086
92 Ga0209130_1003183 3300025284 Bacteria 7250
93 Ga0209676_1000686 3300025292 Bacteria 47720
94 Ga0209050_1000892 3300025298 Bacteria 39709
95 Ga0209050_1029130 3300025298 Bacteria 1774
96 Ga0209050_1035069 3300025298 Bacteria 1489
97 Ga0207426_1000148 3300025302 Bacteria 190030
98 Ga0209257_1000005 3300025304 Bacteria 1592528
99 Ga0209257_1000008 3300025304 Bacteria 1294570
100 Ga0207645_10348673 3300025907 Bacteria 990
101 Ga0207695_10000077 3300025913 Bacteria 307107
102 Ga0207681_10008358 3300025923 Bacteria 6329
103 Ga0207681_10134236 3300025923 Bacteria 1834
104 Ga0207681_10362179 3300025923 Bacteria 1163
105 Ga0207650_10773517 3300025925 Bacteria 813
106 Ga0207690_10616727 3300025932 Bacteria 887
107 Ga0207706_10038618 3300025933 Bacteria 4235
108 Ga0207691_10087593 3300025940 Unclassified 2793
109 Ga0207712_10247508 3300025961 Unclassified 1439
110 Ga0207668_11286532 3300025972 Bacteria 658
111 Ga0207708_10257565 3300026075 Bacteria 1407
112 Ga0207674_10103255 3300026116 Unclassified 2830
113 Ga0207675_100002999 3300026118 Bacteria 16577
114 Ga0207428_10195722 3300027907 Bacteria 1522
115 Ga0268265_10005209 3300028380 Bacteria 8905
116 Ga0268264_10893112 3300028381 Bacteria 892
117 Ga0307515_10000135 3300028794 Bacteria 175323
118 Ga0316181_1015635 3300030744 Bacteria 11896
119 Ga0316182_1020434 3300030745 Bacteria 981
120 Ga0307513_10717488 3300031456 Bacteria 705
121 Ga0307408_100023422 3300031548 Bacteria 4206
122 Ga0307514_10171330 3300031649 Bacteria 1417
123 Ga0307407_10025108 3300031903 Bacteria 3136
124 Ga0307414_10000307 3300032004 Bacteria 28368
125 Ga0451807_0565424 3300041486 Bacteria 933
126 Ga0451807_2473942 3300041486 Unclassified 824
127 Ga0451837_0470659 3300041494 Unclassified 734
128 Ga0451853_0664484 3300041512 Unclassified 844
129 Ga0451853_3876430 3300041512 Bacteria 512
130 Ga0439431_0006477 3300041997 Bacteria 2591
131 Ga0466972_0022137 3300044658 Unclassified 3165
132 Ga0466982_0067612 3300044672 Bacteria 2204
133 Ga0466965_0581131 3300044683 Viruses 635
134 Ga0466961_0485751 3300044693 Bacteria 746
135 Ga0466964_0070299 3300044706 Bacteria 1479
136 Ga0466970_0090333 3300044765 Unclassified 1662
137 Ga0466957_0009714 3300044842 Bacteria 5495
138 Ga0466957_0031200 3300044842 Bacteria 3183
139 Ga0466959_0019319 3300045049 Bacteria 5011
140 Ga0466967_0947951 3300045976 Bacteria 856
141 Ga0495638_0000026 3300046460 Bacteria 347061
142 Ga0495606_0007623 3300046507 Bacteria 9622
143 Ga0495606_0033385 3300046507 Bacteria 3550
144 Ga0495633_0267936 3300046558 Bacteria 778
145 Ga0496115_0048966 3300048918 Bacteria 3381
146 Ga0496115_0166397 3300048918 Bacteria 1823
147 Ga0496116_0000032 3300048919 Bacteria 419997
148 Ga0496118_0236892 3300048921 Bacteria 1048
149 Ga0496125_0000111 3300048928 Bacteria 191489
150 Ga0496125_0000378 3300048928 Bacteria 83455
151 Ga0496126_0000792 3300048929 Bacteria 56862
152 Ga0496126_0058521 3300048929 Unclassified 3474
153 Ga0496126_0209623 3300048929 Bacteria 1641
154 Ga0496126_0979010 3300048929 Unclassified 636
155 Ga0496126_1153044 3300048929 Bacteria 572
156 Ga0501294_053563 3300049517 Unclassified 521
157 Ga0501198_001528 3300049649 Bacteria 3046
158 Ga0501198_082178 3300049649 Unclassified 625
159 Ga0501199_005671 3300049650 Bacteria 1257
160 Ga0501199_045802 3300049650 Bacteria 579
161 Ga0501207_151138 3300049654 Bacteria 500
162 Ga0501217_067426 3300049661 Bacteria 967
163 Ga0501222_002769 3300049662 Bacteria 2428
164 Ga0501223_005206 3300049663 Bacteria 2743
165 Ga0501224_053797 3300049664 Unclassified 620
166 Ga0501235_088889 3300049669 Unclassified 744
167 Ga0501235_097803 3300049669 Bacteria 714
168 Ga0501236_000070 3300049670 Bacteria 9174
169 Ga0501238_004799 3300049671 Bacteria 1701
170 Ga0501242_001212 3300049674 Bacteria 2538
171 Ga0501246_008403 3300049676 Unclassified 914
172 Ga0501247_002224 3300049677 Bacteria 1997
173 Ga0501253_013516 3300049683 Unclassified 1303
174 Ga0501257_001310 3300049686 Bacteria 5127
175 Ga0501257_005851 3300049686 Bacteria 2719
176 Ga0501259_019586 3300049688 Unclassified 1192
177 Ga0501225_0004618 3300049705 Bacteria 4097
178 Ga0501241_001295 3300049758 Bacteria 5188
179 Ga0501204_012968 3300049850 Bacteria 1007
180 nmdc:mga0k408_284358_c1 3300050493 Bacteria 987
181 nmdc:mga0k408_531306_c1 3300050493 Bacteria 696
182 nmdc:mga08y16_6931_c1 3300050511 Bacteria 11879
183 Ga0500644_0000110 3300053088 Bacteria 52203
184 Ga0500646_0062222 3300053090 Bacteria 1101
185 Ga0500583_0079904 3300053092 Bacteria 1578
186 Ga0500650_0054476 3300053098 Bacteria 1862
187 Ga0500660_246961 3300053100 Bacteria 554
188 Ga0500555_036651 3300053103 Unclassified 1375
189 Ga0500569_002999 3300053109 Bacteria 3392
190 Ga0500652_193605 3300053131 Bacteria 828
191 Ga0500658_0000007 3300053134 Bacteria 284115
192 Ga0500658_0073770 3300053134 Bacteria 1445
193 Ga0500559_0020463 3300053136 Unclassified 2798
194 Ga0500573_0102621 3300053140 Bacteria 1608
195 Ga0500577_0051252 3300053142 Bacteria 1551
196 Ga0500589_166935 3300053147 Bacteria 879
197 Ga0500589_223613 3300053147 Bacteria 707
198 Ga0500616_0000004 3300053153 Bacteria 1002714
199 Ga0500616_0091100 3300053153 Bacteria 1510
200 Ga0500616_0207882 3300053153 Bacteria 862
201 Ga0500622_0000018 3300053156 Bacteria 307548
202 Ga0500622_0000021 3300053156 Bacteria 268013
203 Ga0500633_0041245 3300053160 Bacteria 1552
204 Ga0500636_0147409 3300053177 Unclassified 1296
205 Ga0500661_059193 3300055283 Bacteria 690

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041997 Ga0439431_0006477 Ga0439431_0006477_1914_2222 102
2 iso_pu_bacteria 2919191525 2919196303 107
3 iso_pu_bacteria 2738541278 2738728438 108
4 iso_pu_bacteria 2739367874 2740057749 108
5 iso_pu_bacteria 2739367874 2740058856 108
6 iso_pu_bacteria 2818991444 2819588543 108
7 iso_pu_bacteria 2904419702 2904421974 108
8 iso_pu_bacteria 2904555929 2904556890 108
9 iso_pu_bacteria 2919692658 2919693698 108
10 3300005353 Ga0070669_100075866 Ga0070669_1000758662 109
11 3300025923 Ga0207681_10134236 Ga0207681_101342362 109
12 3300055283 Ga0500661_059193 Ga0500661_059193_172_501 109
13 3300003320 rootH2_10311399 rootH2_103113991 111
14 3300003794 Ga0055531_10000128 Ga0055531_1000012816 111
15 3300013102 Ga0157371_10714048 Ga0157371_107140482 111
16 3300025304 Ga0209257_1000005 Ga0209257_1000005862 111
17 3300044658 Ga0466972_0022137 Ga0466972_0022137_1218_1553 111
18 3300044693 Ga0466961_0485751 Ga0466961_0485751_20_355 111
19 3300044765 Ga0466970_0090333 Ga0466970_0090333_901_1236 111
20 3300045049 Ga0466959_0019319 Ga0466959_0019319_2663_2998 111
21 3300049669 Ga0501235_088889 Ga0501235_088889_304_639 111
22 iso_pu_bacteria 2588254257 2590611780 111
23 3300002987 JGI25159J45721_1016899 JGI25159J45721_10168992 112
24 3300003316 rootH1_10000954 rootH1_100009542 112
25 3300003316 rootH1_10116811 rootH1_101168113 112
26 3300003320 rootH2_10035575 rootH2_100355756 112
27 3300003320 rootH2_10037604 rootH2_1003760414 112
28 3300003320 rootH2_10052059 rootH2_100520592 112
29 3300003320 rootH2_10052060 rootH2_100520602 112
30 3300003320 rootH2_10107411 rootH2_101074112 112
31 3300003320 rootH2_10162807 rootH2_101628072 112
32 3300003322 rootL2_10011536 rootL2_100115368 112
33 3300003322 rootL2_10040595 rootL2_100405954 112
34 3300003322 rootL2_10042318 rootL2_100423182 112
35 3300003322 rootL2_10077340 rootL2_100773404 112
36 3300003322 rootL2_10106168 rootL2_101061688 112
37 3300003322 rootL2_10285143 rootL2_102851432 112
38 3300003322 rootL2_10299585 rootL2_102995851 112
39 3300003322 rootL2_10376475 rootL2_103764752 112
40 3300003323 rootH1_10017228 rootH1_1001722817 112
41 3300003323 rootH1_10028833 rootH1_100288335 112
42 3300003323 rootH1_10144806 rootH1_101448063 112
43 3300003323 rootH1_10148381 rootH1_101483814 112
44 3300003323 rootH1_10227413 rootH1_102274132 112
45 3300003323 rootH1_10331693 rootH1_103316933 112
46 3300003323 rootH1_10370721 rootH1_103707211 112
47 3300003323 rootH1_10394744 rootH1_103947443 112
48 3300003354 JGI25160J50197_1002403 JGI25160J50197_10024037 112
49 3300003781 Ga0055536_1005099 Ga0055536_10050993 112
50 3300003794 Ga0055531_10000198 Ga0055531_1000019835 112
51 3300004625 Ga0055543_1017804 Ga0055543_10178042 112
52 3300005262 Ga0065165_1000259 Ga0065165_100025950 112
53 3300005262 Ga0065165_1001904 Ga0065165_100190413 112
54 3300005289 Ga0065704_10074739 Ga0065704_100747392 112
55 3300005289 Ga0065704_10279481 Ga0065704_102794811 112
56 3300005289 Ga0065704_10689539 Ga0065704_106895391 112
57 3300005327 Ga0070658_10123366 Ga0070658_101233664 112
58 3300005353 Ga0070669_100380280 Ga0070669_1003802802 112
59 3300005366 Ga0070659_100985759 Ga0070659_1009857591 112
60 3300005577 Ga0068857_100220030 Ga0068857_1002200303 112
61 3300006195 Ga0075366_10324002 Ga0075366_103240022 112
62 3300009093 Ga0105240_10000117 Ga0105240_100001179 112
63 3300010375 Ga0105239_10200297 Ga0105239_102002973 112
64 3300013100 Ga0157373_10329828 Ga0157373_103298281 112
65 3300013102 Ga0157371_10125619 Ga0157371_101256192 112
66 3300013104 Ga0157370_10000043 Ga0157370_1000004334 112
67 3300013104 Ga0157370_10311165 Ga0157370_103111652 112
68 3300013104 Ga0157370_10678189 Ga0157370_106781891 112
69 3300013104 Ga0157370_11340342 Ga0157370_113403422 112
70 3300013307 Ga0157372_12908309 Ga0157372_129083091 112
71 3300013308 Ga0157375_10046228 Ga0157375_100462284 112
72 3300017792 Ga0163161_10062268 Ga0163161_100622684 112
73 3300017792 Ga0163161_10224009 Ga0163161_102240092 112
74 3300025208 Ga0209436_102937 Ga0209436_1029374 112
75 3300025242 Ga0209258_106948 Ga0209258_1069483 112
76 3300025246 Ga0209646_1002460 Ga0209646_10024605 112
77 3300025284 Ga0209130_1003183 Ga0209130_10031835 112
78 3300025292 Ga0209676_1000686 Ga0209676_100068631 112
79 3300025298 Ga0209050_1000892 Ga0209050_100089219 112
80 3300025298 Ga0209050_1029130 Ga0209050_10291303 112
81 3300025298 Ga0209050_1035069 Ga0209050_10350692 112
82 3300025302 Ga0207426_1000148 Ga0207426_1000148128 112
83 3300025304 Ga0209257_1000008 Ga0209257_1000008529 112
84 3300025913 Ga0207695_10000077 Ga0207695_10000077268 112
85 3300025923 Ga0207681_10362179 Ga0207681_103621792 112
86 3300025932 Ga0207690_10616727 Ga0207690_106167272 112
87 3300028794 Ga0307515_10000135 Ga0307515_1000013556 112
88 3300030744 Ga0316181_1015635 Ga0316181_101563513 112
89 3300030745 Ga0316182_1020434 Ga0316182_10204342 112
90 3300031456 Ga0307513_10717488 Ga0307513_107174882 112
91 3300031548 Ga0307408_100023422 Ga0307408_1000234222 112
92 3300031649 Ga0307514_10171330 Ga0307514_101713302 112
93 3300031903 Ga0307407_10025108 Ga0307407_100251082 112
94 3300032004 Ga0307414_10000307 Ga0307414_100003072 112
95 3300041486 Ga0451807_0565424 Ga0451807_0565424_509_847 112
96 3300041486 Ga0451807_2473942 Ga0451807_2473942_235_573 112
97 3300041494 Ga0451837_0470659 Ga0451837_0470659_89_427 112
98 3300041512 Ga0451853_0664484 Ga0451853_0664484_279_617 112
99 3300041512 Ga0451853_3876430 Ga0451853_3876430_49_387 112
100 3300044672 Ga0466982_0067612 Ga0466982_0067612_358_696 112
101 3300044683 Ga0466965_0581131 Ga0466965_0581131_122_460 112
102 3300044706 Ga0466964_0070299 Ga0466964_0070299_238_576 112
103 3300044842 Ga0466957_0009714 Ga0466957_0009714_3951_4289 112
104 3300044842 Ga0466957_0031200 Ga0466957_0031200_2703_3041 112
105 3300045976 Ga0466967_0947951 Ga0466967_0947951_44_382 112
106 3300046460 Ga0495638_0000026 Ga0495638_0000026_94777_95115 112
107 3300046507 Ga0495606_0007623 Ga0495606_0007623_3285_3623 112
108 3300046507 Ga0495606_0033385 Ga0495606_0033385_664_1002 112
109 3300046558 Ga0495633_0267936 Ga0495633_0267936_283_621 112
110 3300048918 Ga0496115_0166397 Ga0496115_0166397_1154_1492 112
111 3300048919 Ga0496116_0000032 Ga0496116_0000032_256307_256645 112
112 3300048921 Ga0496118_0236892 Ga0496118_0236892_314_652 112
113 3300048928 Ga0496125_0000111 Ga0496125_0000111_189563_189901 112
114 3300048929 Ga0496126_0000792 Ga0496126_0000792_28085_28423 112
115 3300048929 Ga0496126_0209623 Ga0496126_0209623_343_705 112
116 3300048929 Ga0496126_0979010 Ga0496126_0979010_61_399 112
117 3300048929 Ga0496126_1153044 Ga0496126_1153044_69_407 112
118 3300049517 Ga0501294_053563 Ga0501294_053563_143_481 112
119 3300049649 Ga0501198_001528 Ga0501198_001528_1133_1471 112
120 3300049649 Ga0501198_082178 Ga0501198_082178_103_441 112
121 3300049650 Ga0501199_005671 Ga0501199_005671_255_593 112
122 3300049650 Ga0501199_045802 Ga0501199_045802_121_459 112
123 3300049654 Ga0501207_151138 Ga0501207_151138_114_452 112
124 3300049661 Ga0501217_067426 Ga0501217_067426_64_402 112
125 3300049662 Ga0501222_002769 Ga0501222_002769_767_1105 112
126 3300049663 Ga0501223_005206 Ga0501223_005206_1900_2238 112
127 3300049664 Ga0501224_053797 Ga0501224_053797_140_478 112
128 3300049669 Ga0501235_097803 Ga0501235_097803_179_517 112
129 3300049670 Ga0501236_000070 Ga0501236_000070_3439_3777 112
130 3300049671 Ga0501238_004799 Ga0501238_004799_40_378 112
131 3300049674 Ga0501242_001212 Ga0501242_001212_1807_2145 112
132 3300049676 Ga0501246_008403 Ga0501246_008403_25_363 112
133 3300049677 Ga0501247_002224 Ga0501247_002224_1256_1594 112
134 3300049683 Ga0501253_013516 Ga0501253_013516_432_770 112
135 3300049686 Ga0501257_001310 Ga0501257_001310_1182_1520 112
136 3300049686 Ga0501257_005851 Ga0501257_005851_1263_1601 112
137 3300049688 Ga0501259_019586 Ga0501259_019586_827_1165 112
138 3300049705 Ga0501225_0004618 Ga0501225_0004618_3334_3672 112
139 3300049758 Ga0501241_001295 Ga0501241_001295_2818_3216 112
140 3300049850 Ga0501204_012968 Ga0501204_012968_658_996 112
141 3300050493 nmdc:mga0k408_284358_c1 nmdc:mga0k408_284358_c1_275_613 112
142 3300050493 nmdc:mga0k408_531306_c1 nmdc:mga0k408_531306_c1_199_537 112
143 3300053088 Ga0500644_0000110 Ga0500644_0000110_239_604 112
144 3300053090 Ga0500646_0062222 Ga0500646_0062222_197_535 112
145 3300053092 Ga0500583_0079904 Ga0500583_0079904_924_1262 112
146 3300053098 Ga0500650_0054476 Ga0500650_0054476_1210_1548 112
147 3300053100 Ga0500660_246961 Ga0500660_246961_147_485 112
148 3300053103 Ga0500555_036651 Ga0500555_036651_721_1059 112
149 3300053109 Ga0500569_002999 Ga0500569_002999_479_817 112
150 3300053131 Ga0500652_193605 Ga0500652_193605_171_509 112
151 3300053134 Ga0500658_0000007 Ga0500658_0000007_278663_279004 112
152 3300053134 Ga0500658_0073770 Ga0500658_0073770_185_523 112
153 3300053136 Ga0500559_0020463 Ga0500559_0020463_2280_2618 112
154 3300053140 Ga0500573_0102621 Ga0500573_0102621_1188_1529 112
155 3300053142 Ga0500577_0051252 Ga0500577_0051252_190_528 112
156 3300053147 Ga0500589_166935 Ga0500589_166935_174_512 112
157 3300053147 Ga0500589_223613 Ga0500589_223613_323_661 112
158 3300053153 Ga0500616_0000004 Ga0500616_0000004_147643_147981 112
159 3300053153 Ga0500616_0091100 Ga0500616_0091100_890_1228 112
160 3300053153 Ga0500616_0207882 Ga0500616_0207882_145_483 112
161 3300053156 Ga0500622_0000018 Ga0500622_0000018_135949_136287 112
162 3300053156 Ga0500622_0000021 Ga0500622_0000021_190337_190675 112
163 3300053160 Ga0500633_0041245 Ga0500633_0041245_792_1157 112
164 3300053177 Ga0500636_0147409 Ga0500636_0147409_545_883 112
165 3300003323 rootH1_10058094 rootH1_100580942 113
166 3300048918 Ga0496115_0048966 Ga0496115_0048966_1266_1610 114
167 3300048928 Ga0496125_0000378 Ga0496125_0000378_43363_43707 114
168 3300048929 Ga0496126_0058521 Ga0496126_0058521_3072_3461 114
169 2162886012 MBSR1b_contig_2385529 MBSR1b_0348.00005190 120
170 3300003323 rootH1_10097218 rootH1_100972183 120
171 3300005295 Ga0065707_10110041 Ga0065707_101100412 120
172 3300005331 Ga0070670_100040363 Ga0070670_1000403633 120
173 3300005334 Ga0068869_100110139 Ga0068869_1001101392 120
174 3300005347 Ga0070668_100068792 Ga0070668_1000687925 120
175 3300005353 Ga0070669_100001368 Ga0070669_10000136813 120
176 3300005354 Ga0070675_100009028 Ga0070675_1000090285 120
177 3300005364 Ga0070673_100010757 Ga0070673_10001075710 120
178 3300005365 Ga0070688_100056291 Ga0070688_1000562912 120
179 3300005438 Ga0070701_10355377 Ga0070701_103553771 120
180 3300005441 Ga0070700_100674623 Ga0070700_1006746232 120
181 3300005444 Ga0070694_100346140 Ga0070694_1003461401 120
182 3300005457 Ga0070662_100014273 Ga0070662_1000142733 120
183 3300005466 Ga0070685_10578001 Ga0070685_105780012 120
184 3300005577 Ga0068857_100125189 Ga0068857_1001251893 120
185 3300005578 Ga0068854_100019281 Ga0068854_1000192815 120
186 3300005617 Ga0068859_100008110 Ga0068859_1000081106 120
187 3300005719 Ga0068861_100011136 Ga0068861_1000111362 120
188 3300005840 Ga0068870_10011165 Ga0068870_100111657 120
189 3300005843 Ga0068860_101246062 Ga0068860_1012460622 120
190 3300005844 Ga0068862_100001122 Ga0068862_10000112223 120
191 3300006881 Ga0068865_100901355 Ga0068865_1009013552 120
192 3300006931 Ga0097620_100008110 Ga0097620_1000081108 120
193 3300009094 Ga0111539_10005337 Ga0111539_1000533721 120
194 3300009176 Ga0105242_10782012 Ga0105242_107820121 120
195 3300009177 Ga0105248_12394783 Ga0105248_123947831 120
196 3300009553 Ga0105249_10019587 Ga0105249_100195873 120
197 3300013308 Ga0157375_10029807 Ga0157375_100298072 120
198 3300014326 Ga0157380_10003234 Ga0157380_100032343 120
199 3300014326 Ga0157380_10417957 Ga0157380_104179571 120
200 3300017792 Ga0163161_10548511 Ga0163161_105485111 120
201 3300025907 Ga0207645_10348673 Ga0207645_103486731 120
202 3300025923 Ga0207681_10008358 Ga0207681_100083585 120
203 3300025925 Ga0207650_10773517 Ga0207650_107735171 120
204 3300025933 Ga0207706_10038618 Ga0207706_100386186 120
205 3300025940 Ga0207691_10087593 Ga0207691_100875934 120
206 3300025961 Ga0207712_10247508 Ga0207712_102475083 120
207 3300025972 Ga0207668_11286532 Ga0207668_112865321 120
208 3300026075 Ga0207708_10257565 Ga0207708_102575652 120
209 3300026116 Ga0207674_10103255 Ga0207674_101032554 120
210 3300026118 Ga0207675_100002999 Ga0207675_10000299922 120
211 3300027907 Ga0207428_10195722 Ga0207428_101957221 120
212 3300028380 Ga0268265_10005209 Ga0268265_1000520912 120
213 3300028381 Ga0268264_10893112 Ga0268264_108931121 120
214 3300050511 nmdc:mga08y16_6931_c1 nmdc:mga08y16_6931_c1_1077_1439 120

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01638

HxlR

HxlR-like helix-turn-helix

39

129

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
4a5m-assembly1.cif.gz_B redox regulator hypr in its oxidized form 0.9409 21 112
2fsw-assembly1.cif.gz_A crystal structure of the putative transcriptional regualator, marr family from porphyromonas gingivalis w83 0.935 17 111
2hzt-assembly1.cif.gz_B crystal structure of a putative hth-type transcriptional regulator ytcd 0.9333 22 113
2hzt-assembly2.cif.gz_D crystal structure of a putative hth-type transcriptional regulator ytcd 0.9333 22 113
7bze-assembly1.cif.gz_A-2 structure of bacillus subtilis hxlr, k13a mutant 0.9332 21 120
ID Description Score Start End Superfamily
af_P9WMG3_11_158_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9397 22 113 1.10.10.10
2fswA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9351 17 110 1.10.10.10
5j6xB00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9317 34 92 1.10.10.10
4lb5A00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9134 32 93 1.10.10.10
5hs9A00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9068 21 112 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A4P5UVC8-F1-model_v4 Transcriptional regulator 0.9888 22 112 GO:0003677
AF-A0A3B7MPK0-F1-model_v4 Transcriptional regulator 0.985 15 118 GO:0003677
GO:0005737
AF-A0A1Q4V393-F1-model_v4 HxlR family transcriptional regulator 0.9843 22 117 GO:0003677
AF-D7C2P9-F1-model_v4 MarR family transcriptional regulator 0.9834 22 114 GO:0003677
GO:0003700
AF-A0A3M9MQJ0-F1-model_v4 Transcriptional regulator 0.983 15 118 GO:0003677
GO:0005737

Feature Viewer

pLDDT pTM Quality
87.04 0.75 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map