F325475

General Info

Members Datasets Scaffolds Average Seq Length
214 168 203 123

Family's Representative Sequence

Representative Sequence 3300039447|Ga0436361_0187216|Ga0436361_0187216_2804_3175
Length 123
Sequence MKPINFRDKLSLIPDFWQPRVVAEMNDYQFKLVRIEGDFIWHDHADTDETFIVLEGVLRLDFRDGPKHSHVLVGPGEMYVVPKGVEHKPYAEKEVRMMLIEPRGTLNTGDEGGERTAVNDLWI

Samples

Sample ID Description Type Environment
1 2599185292 Achromobacter sp. NFACC18-2 Isolate Rhizoplane
2 2811994881 Pseudomonas sp. SLBN-26 Isolate Unclassified
3 2818991445 Herbaspirillum hiltneri 3195 Isolate Unclassified
4 2858950400 Achromobacter sp. K91 Isolate Unclassified
5 2884811622 Herbaspirillum sp. 3C11 Isolate Unclassified
6 2884836552 Herbaspirillum sp. 3R-11 Isolate Unclassified
7 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
8 2885270888 Paraburkholderia sp. UYCPa14C Isolate Unclassified
9 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
10 2923519811 Pseudomonas otitidis SLBN-103 Isolate Rhizosphere
11 2941479691
12 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
13 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
14 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
15 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
16 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
17 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
18 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
19 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
20 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
21 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
22 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
53 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
54 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
55 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
56 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
57 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
58 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
59 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
60 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
61 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
62 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
63 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
65 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
67 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
70 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
71 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
72 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
73 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
74 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
75 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
76 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
77 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
78 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
79 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
80 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
82 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
84 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
85 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
86 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
87 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
119 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
120 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
121 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
122 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
123 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
124 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
125 3300033544 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 Metagenome Unclassified
126 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
127 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
128 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
129 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
130 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
131 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
132 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
133 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
134 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
135 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
136 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
137 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
138 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
139 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
140 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
141 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
142 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
143 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
144 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
145 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
146 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
147 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
148 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
149 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
150 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
151 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
152 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
153 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
154 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
155 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
156 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
157 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
158 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
159 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
160 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
161 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
162 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
163 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
164 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
165 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
166 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
167 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
168 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.39
Metatranscriptomes 0.47
Isolates 5.14

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.01
Nodule 0.47
Rhizoplane 3.74
Rhizosphere 71.5
Stem 0
Stem Tuber 0
Unclassified 17.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25156J39149_1000848 3300002705 Bacteria 15364
2 JGI25156J39149_1002710 3300002705 Bacteria 6191
3 JGI25154J39366_1000290 3300002738 Bacteria 30181
4 JGI25157J39369_1001917 3300002741 Bacteria 6288
5 rootH1_10388399 3300003323 Bacteria 1554
6 Ga0055532_1000016 3300003758 Bacteria 327509
7 Ga0055535_1006588 3300003761 Bacteria 2327
8 Ga0055529_1000683 3300003763 Bacteria 23311
9 Ga0070670_100043509 3300005331 Bacteria 3860
10 Ga0070670_100069089 3300005331 Bacteria 3032
11 Ga0070680_100110643 3300005336 Bacteria 2287
12 Ga0068868_100035988 3300005338 Bacteria 3829
13 Ga0070687_100004225 3300005343 Bacteria 5701
14 Ga0070668_100045375 3300005347 Bacteria 3372
15 Ga0070668_100779483 3300005347 Bacteria 848
16 Ga0070669_100044654 3300005353 Bacteria 3228
17 Ga0070675_100341191 3300005354 Bacteria 1327
18 Ga0070671_100021105 3300005355 Bacteria 5318
19 Ga0070674_100702455 3300005356 Bacteria 865
20 Ga0070673_101082882 3300005364 Bacteria 748
21 Ga0070713_101645691 3300005436 Bacteria 623
22 Ga0070711_100032318 3300005439 Bacteria 3479
23 Ga0070700_100352066 3300005441 Bacteria 1092
24 Ga0070700_100376645 3300005441 Bacteria 1060
25 Ga0070708_100077411 3300005445 Bacteria 3006
26 Ga0070708_100081864 3300005445 Bacteria 2923
27 Ga0070708_100147068 3300005445 Bacteria 2189
28 Ga0070681_10044797 3300005458 Bacteria 4429
29 Ga0070706_100024510 3300005467 Bacteria 5554
30 Ga0070706_101531013 3300005467 Bacteria 609
31 Ga0070707_100085412 3300005468 Bacteria 3050
32 Ga0070707_100156986 3300005468 Bacteria 2216
33 Ga0070707_100736658 3300005468 Bacteria 949
34 Ga0070698_100082742 3300005471 Bacteria 3201
35 Ga0070698_100637693 3300005471 Bacteria 1006
36 Ga0070699_100214464 3300005518 Bacteria 1714
37 Ga0070699_100223391 3300005518 Bacteria 1679
38 Ga0070699_100252322 3300005518 Bacteria 1576
39 Ga0070679_100721596 3300005530 Bacteria 939
40 Ga0070697_100096039 3300005536 Bacteria 2459
41 Ga0070697_100581877 3300005536 Bacteria 983
42 Ga0068853_100532730 3300005539 Bacteria 1111
43 Ga0070672_100213468 3300005543 Bacteria 1617
44 Ga0070696_100877549 3300005546 Bacteria 743
45 Ga0070704_100591967 3300005549 Bacteria 974
46 Ga0068855_100400309 3300005563 Bacteria 1504
47 Ga0068864_101114795 3300005618 Bacteria 786
48 Ga0068861_100273241 3300005719 Bacteria 1452
49 Ga0068851_10096814 3300005834 Bacteria 1561
50 Ga0068863_100270683 3300005841 Bacteria 1644
51 Ga0068858_100543836 3300005842 Bacteria 1124
52 Ga0068860_100308825 3300005843 Bacteria 1550
53 Ga0068862_101061448 3300005844 Bacteria 804
54 Ga0081455_10320660 3300005937 Bacteria 1104
55 Ga0081538_10015777 3300005981 Bacteria 5829
56 Ga0070716_100172727 3300006173 Bacteria 1412
57 Ga0075367_10432758 3300006178 Unclassified 833
58 Ga0075434_100190751 3300006871 Bacteria 2070
59 Ga0075434_100901526 3300006871 Bacteria 899
60 Ga0068865_101628199 3300006881 Bacteria 581
61 Ga0075436_100223230 3300006914 Bacteria 1337
62 Ga0075435_100135618 3300007076 Bacteria 2062
63 Ga0099794_10226215 3300007265 Bacteria 962
64 Ga0099795_10231106 3300007788 Bacteria 791
65 Ga0105240_10004718 3300009093 Bacteria 20573
66 Ga0111539_10524240 3300009094 Bacteria 1380
67 Ga0111539_12183807 3300009094 Bacteria 642
68 Ga0105245_10185486 3300009098 Bacteria 1990
69 Ga0114129_11357022 3300009147 Bacteria 879
70 Ga0105243_11169756 3300009148 Bacteria 781
71 Ga0105241_10528444 3300009174 Bacteria 1056
72 Ga0105248_10245818 3300009177 Bacteria 2014
73 Ga0105248_11467213 3300009177 Bacteria 772
74 Ga0105238_10038772 3300009551 Bacteria 4837
75 Ga0105238_10173247 3300009551 Bacteria 2134
76 Ga0105239_10250567 3300010375 Bacteria 1989
77 Ga0157369_10347115 3300013105 Bacteria 1542
78 Ga0157374_10314164 3300013296 Bacteria 1552
79 Ga0157375_10131939 3300013308 Bacteria 2618
80 Ga0157380_10611377 3300014326 Bacteria 1080
81 Ga0182008_10018914 3300014497 Bacteria 3562
82 Ga0182006_1118202 3300015261 Bacteria 924
83 Ga0213872_10018576 3300021361 Bacteria 3206
84 Ga0213872_10047665 3300021361 Bacteria 1948
85 Ga0213872_10208376 3300021361 Bacteria 835
86 Ga0213871_10176032 3300021441 Unclassified 660
87 Ga0209435_100016 3300025206 Bacteria 305566
88 Ga0209147_100023 3300025229 Bacteria 437803
89 Ga0209437_100080 3300025233 Bacteria 275402
90 Ga0209258_100210 3300025242 Bacteria 117131
91 Ga0209258_126231 3300025242 Bacteria 568
92 Ga0209646_1000033 3300025246 Bacteria 369507
93 Ga0209026_1000031 3300025250 Bacteria 325747
94 Ga0209759_1000045 3300025256 Bacteria 235654
95 Ga0209759_1002937 3300025256 Bacteria 7118
96 Ga0209233_1040236 3300025261 Bacteria 1018
97 Ga0209455_1000325 3300025272 Bacteria 46601
98 Ga0209455_1005495 3300025272 Bacteria 3904
99 Ga0207656_10092200 3300025321 Bacteria 1377
100 Ga0207656_10330178 3300025321 Bacteria 759
101 Ga0207684_10061347 3300025910 Bacteria 3193
102 Ga0207684_10902886 3300025910 Bacteria 743
103 Ga0207684_10912340 3300025910 Bacteria 738
104 Ga0207707_10739689 3300025912 Bacteria 823
105 Ga0207695_10011378 3300025913 Bacteria 10784
106 Ga0207695_10616070 3300025913 Bacteria 967
107 Ga0207671_10147456 3300025914 Bacteria 1816
108 Ga0207663_10016600 3300025916 Bacteria 4087
109 Ga0207660_10354147 3300025917 Bacteria 1177
110 Ga0207662_10010136 3300025918 Bacteria 5195
111 Ga0207652_11150105 3300025921 Bacteria 677
112 Ga0207646_10216095 3300025922 Bacteria 1732
113 Ga0207646_10226315 3300025922 Bacteria 1689
114 Ga0207646_10310541 3300025922 Bacteria 1425
115 Ga0207694_10006974 3300025924 Bacteria 8577
116 Ga0207650_10058967 3300025925 Bacteria 2859
117 Ga0207650_10113440 3300025925 Bacteria 2101
118 Ga0207659_10404485 3300025926 Bacteria 1142
119 Ga0207700_10927869 3300025928 Bacteria 779
120 Ga0207644_10028365 3300025931 Bacteria 3874
121 Ga0207669_11964521 3300025937 Bacteria 500
122 Ga0207665_10581710 3300025939 Bacteria 873
123 Ga0207691_10179700 3300025940 Bacteria 1849
124 Ga0207689_11675795 3300025942 Bacteria 527
125 Ga0207667_10403153 3300025949 Bacteria 1392
126 Ga0207668_10048464 3300025972 Bacteria 2916
127 Ga0207677_12133583 3300026023 Bacteria 521
128 Ga0207703_10622325 3300026035 Bacteria 1022
129 Ga0207639_10499259 3300026041 Bacteria 1111
130 Ga0207708_10456128 3300026075 Bacteria 1065
131 Ga0207708_10728786 3300026075 Bacteria 849
132 Ga0207641_10306999 3300026088 Bacteria 1500
133 Ga0207641_10448639 3300026088 Bacteria 1246
134 Ga0207676_10077009 3300026095 Bacteria 2697
135 Ga0207676_11001601 3300026095 Bacteria 823
136 Ga0207675_100148666 3300026118 Bacteria 2228
137 Ga0268265_10106121 3300028380 Bacteria 2281
138 Ga0268264_10033521 3300028381 Bacteria 4220
139 Ga0265763_1052810 3300030763 Bacteria 516
140 Ga0307508_10307782 3300031616 Bacteria 1177
141 Ga0307407_10225062 3300031903 Bacteria 1271
142 Ga0307412_10000309 3300031911 Bacteria 30916
143 Ga0307412_11222940 3300031911 Bacteria 673
144 Ga0307416_100783803 3300032002 Bacteria 1048
145 Ga0307414_10942698 3300032004 Bacteria 793
146 Ga0307411_11317206 3300032005 Bacteria 658
147 Ga0316215_1022362 3300033544 Bacteria 646
148 Ga0373935_1423332 3300035692 Bacteria 518
149 Ga0373927_0646726 3300035695 Bacteria 699
150 Ga0373947_0298156 3300035725 Bacteria 1074
151 Ga0395899_0106480 3300037312 Bacteria 2019
152 Ga0395900_0168183 3300037418 Bacteria 2233
153 Ga0395905_0001042 3300037471 Bacteria 35110
154 Ga0395905_0402501 3300037471 Bacteria 1264
155 Ga0395901_0001771 3300038443 Bacteria 22274
156 Ga0436360_0456369 3300039438 Bacteria 504
157 Ga0436361_0055743 3300039447 Bacteria 1354
158 Ga0436361_0187216 3300039447 Bacteria 3820
159 Ga0436361_0796538 3300039447 Bacteria 980
160 Ga0436361_1103107 3300039447 Bacteria 700
161 Ga0436363_1116385 3300039450 Unclassified 2424
162 Ga0436363_1579110 3300039450 Bacteria 745
163 Ga0436362_0806046 3300039453 Bacteria 1084
164 Ga0451807_0323720 3300041486 Bacteria 581
165 Ga0451853_2525016 3300041512 Bacteria 2714
166 Ga0450897_008386 3300042128 Bacteria 961
167 Ga0450892_009399 3300042130 Bacteria 846
168 Ga0450893_0144152 3300042532 Bacteria 510
169 Ga0453683_0207388 3300044673 Bacteria 1245
170 Ga0495665_0310950 3300046531 Bacteria 806
171 Ga0495625_0006154 3300046660 Bacteria 10748
172 Ga0495624_0946475 3300046690 Bacteria 506
173 Ga0496101_1207724 3300048904 Bacteria 592
174 Ga0496108_1078558 3300048911 Bacteria 683
175 Ga0496109_0000118 3300048912 Bacteria 81929
176 Ga0496109_0028725 3300048912 Bacteria 4978
177 Ga0496112_0109078 3300048915 Bacteria 2738
178 Ga0496114_0821426 3300048917 Bacteria 809
179 Ga0496116_0011212 3300048919 Bacteria 7444
180 Ga0496116_0053734 3300048919 Bacteria 2658
181 Ga0496117_0201867 3300048920 Bacteria 1123
182 Ga0496118_0009882 3300048921 Bacteria 9541
183 Ga0496119_0099385 3300048922 Bacteria 1636
184 Ga0496120_0014661 3300048923 Bacteria 5212
185 Ga0496121_0000803 3300048924 Bacteria 57237
186 Ga0496121_0120513 3300048924 Bacteria 1982
187 Ga0496122_0001722 3300048925 Bacteria 33944
188 Ga0496122_0147631 3300048925 Bacteria 1458
189 Ga0496123_0000838 3300048926 Bacteria 49225
190 Ga0496123_0007713 3300048926 Bacteria 10047
191 Ga0496125_0000906 3300048928 Bacteria 46871
192 Ga0496125_0016615 3300048928 Bacteria 7058
193 nmdc:mga06z11_379604_c1 3300050494 Unclassified 849
194 nmdc:mga05p37_594221_c1 3300050507 Bacteria 1251
195 nmdc:mga08y16_1293376_c1 3300050511 Unclassified 696
196 nmdc:mga0n895_245675_c1 3300050512 Bacteria 1816
197 nmdc:mga0n895_712119_c1 3300050512 Bacteria 999
198 nmdc:mga0rr50_1452355_c1 3300050513 Bacteria 580
199 nmdc:mga0rr50_291277_c1 3300050513 Bacteria 1364
200 nmdc:mga0a205_1101695_c1 3300050515 Bacteria 641
201 Ga0500610_0410000 3300053079 Bacteria 547
202 Ga0500555_029904 3300053103 Bacteria 1547
203 Ga0500588_0011568 3300053146 Bacteria 2164

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300032004 Ga0307414_10942698 Ga0307414_109426982 114
2 3300009177 Ga0105248_10245818 Ga0105248_102458183 116
3 iso_pu_bacteria 2599185292 2599905267 118
4 iso_pu_bacteria 2858950400 2858954884 118
5 iso_pu_bacteria 2941479691 2941480271 118
6 3300021361 Ga0213872_10018576 Ga0213872_100185763 119
7 3300039447 Ga0436361_0187216 Ga0436361_0187216_2804_3175 119
8 3300039447 Ga0436361_0796538 Ga0436361_0796538_164_523 119
9 3300005331 Ga0070670_100069089 Ga0070670_1000690892 120
10 3300005347 Ga0070668_100045375 Ga0070668_1000453754 120
11 3300005353 Ga0070669_100044654 Ga0070669_1000446542 120
12 3300005354 Ga0070675_100341191 Ga0070675_1003411913 120
13 3300005364 Ga0070673_101082882 Ga0070673_1010828822 120
14 3300005441 Ga0070700_100376645 Ga0070700_1003766452 120
15 3300005543 Ga0070672_100213468 Ga0070672_1002134682 120
16 3300005618 Ga0068864_101114795 Ga0068864_1011147952 120
17 3300005719 Ga0068861_100273241 Ga0068861_1002732413 120
18 3300005841 Ga0068863_100270683 Ga0068863_1002706833 120
19 3300005842 Ga0068858_100543836 Ga0068858_1005438362 120
20 3300005843 Ga0068860_100308825 Ga0068860_1003088253 120
21 3300005844 Ga0068862_101061448 Ga0068862_1010614482 120
22 3300009094 Ga0111539_10524240 Ga0111539_105242402 120
23 3300009148 Ga0105243_11169756 Ga0105243_111697562 120
24 3300014326 Ga0157380_10611377 Ga0157380_106113772 120
25 3300025925 Ga0207650_10113440 Ga0207650_101134402 120
26 3300025926 Ga0207659_10404485 Ga0207659_104044853 120
27 3300025937 Ga0207669_11964521 Ga0207669_119645211 120
28 3300025940 Ga0207691_10179700 Ga0207691_101797003 120
29 3300025942 Ga0207689_11675795 Ga0207689_116757951 120
30 3300025972 Ga0207668_10048464 Ga0207668_100484644 120
31 3300026035 Ga0207703_10622325 Ga0207703_106223252 120
32 3300026075 Ga0207708_10456128 Ga0207708_104561282 120
33 3300026088 Ga0207641_10306999 Ga0207641_103069993 120
34 3300026088 Ga0207641_10448639 Ga0207641_104486393 120
35 3300026095 Ga0207676_11001601 Ga0207676_110016011 120
36 3300026118 Ga0207675_100148666 Ga0207675_1001486663 120
37 3300028380 Ga0268265_10106121 Ga0268265_101061214 120
38 3300028381 Ga0268264_10033521 Ga0268264_100335213 120
39 iso_pu_bacteria 2811994881 2812366188 120
40 iso_pu_bacteria 2885270888 2885279014 120
41 iso_pu_bacteria 2923519811 2923520211 120
42 3300003323 rootH1_10388399 rootH1_103883991 121
43 3300003763 Ga0055529_1000683 Ga0055529_100068313 121
44 3300005336 Ga0070680_100110643 Ga0070680_1001106432 121
45 3300005338 Ga0068868_100035988 Ga0068868_1000359883 121
46 3300005343 Ga0070687_100004225 Ga0070687_1000042255 121
47 3300005347 Ga0070668_100779483 Ga0070668_1007794832 121
48 3300005355 Ga0070671_100021105 Ga0070671_1000211056 121
49 3300005356 Ga0070674_100702455 Ga0070674_1007024551 121
50 3300005436 Ga0070713_101645691 Ga0070713_1016456912 121
51 3300005439 Ga0070711_100032318 Ga0070711_1000323184 121
52 3300005441 Ga0070700_100352066 Ga0070700_1003520662 121
53 3300005445 Ga0070708_100077411 Ga0070708_1000774112 121
54 3300005445 Ga0070708_100081864 Ga0070708_1000818643 121
55 3300005445 Ga0070708_100147068 Ga0070708_1001470682 121
56 3300005458 Ga0070681_10044797 Ga0070681_100447974 121
57 3300005467 Ga0070706_100024510 Ga0070706_1000245105 121
58 3300005467 Ga0070706_101531013 Ga0070706_1015310131 121
59 3300005468 Ga0070707_100085412 Ga0070707_1000854124 121
60 3300005468 Ga0070707_100156986 Ga0070707_1001569862 121
61 3300005468 Ga0070707_100736658 Ga0070707_1007366581 121
62 3300005471 Ga0070698_100082742 Ga0070698_1000827422 121
63 3300005471 Ga0070698_100637693 Ga0070698_1006376931 121
64 3300005518 Ga0070699_100223391 Ga0070699_1002233912 121
65 3300005518 Ga0070699_100252322 Ga0070699_1002523222 121
66 3300005530 Ga0070679_100721596 Ga0070679_1007215962 121
67 3300005536 Ga0070697_100096039 Ga0070697_1000960392 121
68 3300005536 Ga0070697_100581877 Ga0070697_1005818772 121
69 3300005546 Ga0070696_100877549 Ga0070696_1008775492 121
70 3300005549 Ga0070704_100591967 Ga0070704_1005919671 121
71 3300005937 Ga0081455_10320660 Ga0081455_103206602 121
72 3300005981 Ga0081538_10015777 Ga0081538_100157776 121
73 3300006173 Ga0070716_100172727 Ga0070716_1001727273 121
74 3300006178 Ga0075367_10432758 Ga0075367_104327582 121
75 3300006871 Ga0075434_100190751 Ga0075434_1001907513 121
76 3300006871 Ga0075434_100901526 Ga0075434_1009015261 121
77 3300006881 Ga0068865_101628199 Ga0068865_1016281992 121
78 3300006914 Ga0075436_100223230 Ga0075436_1002232302 121
79 3300007076 Ga0075435_100135618 Ga0075435_1001356182 121
80 3300007265 Ga0099794_10226215 Ga0099794_102262152 121
81 3300007788 Ga0099795_10231106 Ga0099795_102311061 121
82 3300009094 Ga0111539_12183807 Ga0111539_121838071 121
83 3300009098 Ga0105245_10185486 Ga0105245_101854862 121
84 3300009147 Ga0114129_11357022 Ga0114129_113570222 121
85 3300009174 Ga0105241_10528444 Ga0105241_105284441 121
86 3300009177 Ga0105248_11467213 Ga0105248_114672132 121
87 3300009551 Ga0105238_10173247 Ga0105238_101732471 121
88 3300010375 Ga0105239_10250567 Ga0105239_102505672 121
89 3300013105 Ga0157369_10347115 Ga0157369_103471152 121
90 3300013296 Ga0157374_10314164 Ga0157374_103141642 121
91 3300013308 Ga0157375_10131939 Ga0157375_101319392 121
92 3300021361 Ga0213872_10047665 Ga0213872_100476652 121
93 3300021441 Ga0213871_10176032 Ga0213871_101760321 121
94 3300025242 Ga0209258_126231 Ga0209258_1262311 121
95 3300025256 Ga0209759_1002937 Ga0209759_10029378 121
96 3300025272 Ga0209455_1000325 Ga0209455_10003252 121
97 3300025321 Ga0207656_10330178 Ga0207656_103301782 121
98 3300025910 Ga0207684_10061347 Ga0207684_100613472 121
99 3300025910 Ga0207684_10902886 Ga0207684_109028861 121
100 3300025910 Ga0207684_10912340 Ga0207684_109123402 121
101 3300025912 Ga0207707_10739689 Ga0207707_107396891 121
102 3300025913 Ga0207695_10616070 Ga0207695_106160702 121
103 3300025914 Ga0207671_10147456 Ga0207671_101474562 121
104 3300025916 Ga0207663_10016600 Ga0207663_100166003 121
105 3300025917 Ga0207660_10354147 Ga0207660_103541472 121
106 3300025918 Ga0207662_10010136 Ga0207662_100101363 121
107 3300025921 Ga0207652_11150105 Ga0207652_111501051 121
108 3300025922 Ga0207646_10216095 Ga0207646_102160953 121
109 3300025922 Ga0207646_10226315 Ga0207646_102263153 121
110 3300025922 Ga0207646_10310541 Ga0207646_103105412 121
111 3300025924 Ga0207694_10006974 Ga0207694_100069744 121
112 3300025928 Ga0207700_10927869 Ga0207700_109278692 121
113 3300025931 Ga0207644_10028365 Ga0207644_100283653 121
114 3300026023 Ga0207677_12133583 Ga0207677_121335831 121
115 3300026075 Ga0207708_10728786 Ga0207708_107287862 121
116 3300026095 Ga0207676_10077009 Ga0207676_100770094 121
117 3300030763 Ga0265763_1052810 Ga0265763_10528101 121
118 3300031616 Ga0307508_10307782 Ga0307508_103077821 121
119 3300031903 Ga0307407_10225062 Ga0307407_102250622 121
120 3300031911 Ga0307412_10000309 Ga0307412_1000030910 121
121 3300031911 Ga0307412_11222940 Ga0307412_112229402 121
122 3300032002 Ga0307416_100783803 Ga0307416_1007838032 121
123 3300032005 Ga0307411_11317206 Ga0307411_113172062 121
124 3300033544 Ga0316215_1022362 Ga0316215_10223621 121
125 3300035692 Ga0373935_1423332 Ga0373935_1423332_98_463 121
126 3300035695 Ga0373927_0646726 Ga0373927_0646726_50_415 121
127 3300035725 Ga0373947_0298156 Ga0373947_0298156_375_740 121
128 3300037312 Ga0395899_0106480 Ga0395899_0106480_406_771 121
129 3300037418 Ga0395900_0168183 Ga0395900_0168183_1847_2212 121
130 3300037471 Ga0395905_0001042 Ga0395905_0001042_9714_10079 121
131 3300038443 Ga0395901_0001771 Ga0395901_0001771_13969_14334 121
132 3300039438 Ga0436360_0456369 Ga0436360_0456369_85_450 121
133 3300039447 Ga0436361_0055743 Ga0436361_0055743_333_698 121
134 3300039450 Ga0436363_1116385 Ga0436363_1116385_1895_2260 121
135 3300039450 Ga0436363_1579110 Ga0436363_1579110_237_602 121
136 3300039453 Ga0436362_0806046 Ga0436362_0806046_191_556 121
137 3300041486 Ga0451807_0323720 Ga0451807_0323720_130_495 121
138 3300041512 Ga0451853_2525016 Ga0451853_2525016_54_419 121
139 3300042128 Ga0450897_008386 Ga0450897_008386_202_567 121
140 3300042130 Ga0450892_009399 Ga0450892_009399_366_731 121
141 3300042532 Ga0450893_0144152 Ga0450893_0144152_109_474 121
142 3300044673 Ga0453683_0207388 Ga0453683_0207388_729_1094 121
143 3300046531 Ga0495665_0310950 Ga0495665_0310950_423_788 121
144 3300046690 Ga0495624_0946475 Ga0495624_0946475_85_450 121
145 3300048904 Ga0496101_1207724 Ga0496101_1207724_58_423 121
146 3300048911 Ga0496108_1078558 Ga0496108_1078558_214_579 121
147 3300048912 Ga0496109_0000118 Ga0496109_0000118_22823_23188 121
148 3300048912 Ga0496109_0028725 Ga0496109_0028725_806_1171 121
149 3300048915 Ga0496112_0109078 Ga0496112_0109078_1715_2080 121
150 3300048917 Ga0496114_0821426 Ga0496114_0821426_371_736 121
151 3300048919 Ga0496116_0053734 Ga0496116_0053734_408_776 121
152 3300048922 Ga0496119_0099385 Ga0496119_0099385_882_1250 121
153 3300048923 Ga0496120_0014661 Ga0496120_0014661_1765_2133 121
154 3300048924 Ga0496121_0000803 Ga0496121_0000803_39882_40250 121
155 3300048924 Ga0496121_0120513 Ga0496121_0120513_848_1216 121
156 3300048925 Ga0496122_0147631 Ga0496122_0147631_764_1132 121
157 3300048926 Ga0496123_0007713 Ga0496123_0007713_7882_8250 121
158 3300048928 Ga0496125_0000906 Ga0496125_0000906_23376_23744 121
159 3300050494 nmdc:mga06z11_379604_c1 nmdc:mga06z11_379604_c1_98_463 121
160 3300050507 nmdc:mga05p37_594221_c1 nmdc:mga05p37_594221_c1_67_432 121
161 3300050511 nmdc:mga08y16_1293376_c1 nmdc:mga08y16_1293376_c1_56_421 121
162 3300050512 nmdc:mga0n895_245675_c1 nmdc:mga0n895_245675_c1_379_744 121
163 3300050512 nmdc:mga0n895_712119_c1 nmdc:mga0n895_712119_c1_60_425 121
164 3300050513 nmdc:mga0rr50_1452355_c1 nmdc:mga0rr50_1452355_c1_84_449 121
165 3300050513 nmdc:mga0rr50_291277_c1 nmdc:mga0rr50_291277_c1_852_1217 121
166 3300050515 nmdc:mga0a205_1101695_c1 nmdc:mga0a205_1101695_c1_203_568 121
167 3300053079 Ga0500610_0410000 Ga0500610_0410000_145_510 121
168 3300053103 Ga0500555_029904 Ga0500555_029904_1074_1439 121
169 3300053146 Ga0500588_0011568 Ga0500588_0011568_92_457 121
170 3300005518 Ga0070699_100214464 Ga0070699_1002144643 122
171 3300025939 Ga0207665_10581710 Ga0207665_105817101 122
172 3300021361 Ga0213872_10208376 Ga0213872_102083762 123
173 3300039447 Ga0436361_1103107 Ga0436361_1103107_212_583 123
174 iso_pu_bacteria 2818991445 2819591302 124
175 iso_pu_bacteria 2884811622 2884816072 124
176 iso_pu_bacteria 2884836552 2884837090 124
177 iso_pu_bacteria 2884852848 2884853382 124
178 iso_pu_bacteria 2896154374 2896155501 124
179 3300002705 JGI25156J39149_1000848 JGI25156J39149_100084816 128
180 3300002705 JGI25156J39149_1002710 JGI25156J39149_10027103 128
181 3300002738 JGI25154J39366_1000290 JGI25154J39366_100029013 128
182 3300002741 JGI25157J39369_1001917 JGI25157J39369_10019174 128
183 3300003758 Ga0055532_1000016 Ga0055532_1000016178 128
184 3300003761 Ga0055535_1006588 Ga0055535_10065882 128
185 3300005331 Ga0070670_100043509 Ga0070670_1000435095 128
186 3300005539 Ga0068853_100532730 Ga0068853_1005327302 128
187 3300005563 Ga0068855_100400309 Ga0068855_1004003091 128
188 3300005834 Ga0068851_10096814 Ga0068851_100968142 128
189 3300009093 Ga0105240_10004718 Ga0105240_100047188 128
190 3300009551 Ga0105238_10038772 Ga0105238_100387724 128
191 3300014497 Ga0182008_10018914 Ga0182008_100189142 128
192 3300015261 Ga0182006_1118202 Ga0182006_11182022 128
193 3300025206 Ga0209435_100016 Ga0209435_10001662 128
194 3300025229 Ga0209147_100023 Ga0209147_100023267 128
195 3300025233 Ga0209437_100080 Ga0209437_10008082 128
196 3300025242 Ga0209258_100210 Ga0209258_10021032 128
197 3300025246 Ga0209646_1000033 Ga0209646_1000033248 128
198 3300025250 Ga0209026_1000031 Ga0209026_1000031267 128
199 3300025256 Ga0209759_1000045 Ga0209759_1000045173 128
200 3300025261 Ga0209233_1040236 Ga0209233_10402362 128
201 3300025272 Ga0209455_1005495 Ga0209455_10054953 128
202 3300025321 Ga0207656_10092200 Ga0207656_100922002 128
203 3300025913 Ga0207695_10011378 Ga0207695_100113788 128
204 3300025925 Ga0207650_10058967 Ga0207650_100589675 128
205 3300025949 Ga0207667_10403153 Ga0207667_104031531 128
206 3300026041 Ga0207639_10499259 Ga0207639_104992592 128
207 3300037471 Ga0395905_0402501 Ga0395905_0402501_618_1055 128
208 3300046660 Ga0495625_0006154 Ga0495625_0006154_6761_7147 128
209 3300048919 Ga0496116_0011212 Ga0496116_0011212_6637_7023 128
210 3300048920 Ga0496117_0201867 Ga0496117_0201867_38_424 128
211 3300048921 Ga0496118_0009882 Ga0496118_0009882_932_1318 128
212 3300048925 Ga0496122_0001722 Ga0496122_0001722_15320_15706 128
213 3300048926 Ga0496123_0000838 Ga0496123_0000838_36651_37037 128
214 3300048928 Ga0496125_0016615 Ga0496125_0016615_5301_5687 128

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07883

Cupin_2

Cupin domain

31

101

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
3d82-assembly1.cif.gz_E crystal structure of a cupin-2 domain containing protein (sfri_3543) from shewanella frigidimarina ncimb 400 at 2.05 a resolution 0.9954 13 108
3d82-assembly1.cif.gz_E crystal structure of a cupin-2 domain containing protein (sfri_3543) from shewanella frigidimarina ncimb 400 at 2.05 a resolution 0.9279 13 108
2i45-assembly4.cif.gz_H crystal structure of protein nmb1881 from neisseria meningitidis 0.9245 11 107
2i45-assembly3.cif.gz_E crystal structure of protein nmb1881 from neisseria meningitidis 0.9223 11 107
2i45-assembly5.cif.gz_J crystal structure of protein nmb1881 from neisseria meningitidis 0.9152 11 107
ID Description Score Start End Superfamily
3d82C00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9659 9 108 2.60.120.10
3d82C00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.956 9 108 2.60.120.10
af_P76555_101_233_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9171 36 107 2.60.120.10
2i45I00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9107 12 105 2.60.120.10
af_P96245_1_96_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9014 41 104 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A537BVB2-F1-model_v4 Cupin domain-containing protein 0.9975 14 102
AF-A0A828ZF79-F1-model_v4 deleted 0.9921 11 109
AF-A0A1V3YYA2-F1-model_v4 deleted 0.9912 9 110
AF-A0A0M2VRC7-F1-model_v4 deleted 0.9905 9 110
AF-A0A7Z7CCP4-F1-model_v4 Cupin domain-containing protein 0.9903 34 109

Feature Viewer

pLDDT pTM Quality
84.75 0.77 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map