F325247
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 214 | 168 | 200 | 282 |
Family's Representative Sequence
| Representative Sequence | 3300025298|Ga0209050_1001310|Ga0209050_100131011 |
| Length | 266 |
| Sequence | MPRTIHLLIVDPQNDFCDLPESYRPLDPLTGLAVAPALPIAGAHADMQRLARFIDATAPVLSSITVTLDSHHRLDIAHPTFWRAGNGDPVAPFTPITAAQLRAGEFVPRHDDDLPRTLNYLDELEARGRYTLMAWPVHCEIGTWGHNVHPDVRAAYGRWEEERQFIVRKVPKGANPRSQLNRGLLDSLDRADLILIAGEAGSHCVKATVEHLAEHLPGGNLSRIVLLTDCMSPVAGFANAQSSFLQRMRDLGVQERTSTDMARALA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2599185292 | Achromobacter sp. NFACC18-2 | Isolate | Rhizoplane |
| 2 | 2643221569 | Achromobacter sp. Root565 | Isolate | Unclassified |
| 3 | 2643221594 | Achromobacter sp. Root170 | Isolate | Unclassified |
| 4 | 2643221621 | Achromobacter sp. Root83 | Isolate | Unclassified |
| 5 | 2808606395 | Achromobacter sp. SLBN-14 | Isolate | Unclassified |
| 6 | 2818991436 | Collimonas arenae 515 | Isolate | Unclassified |
| 7 | 2842677519 | Variovorax sp. R-72495 | Isolate | Unclassified |
| 8 | 2857537821 | Achromobacter sp. R-71975 | Isolate | Unclassified |
| 9 | 2858950400 | Achromobacter sp. K91 | Isolate | Unclassified |
| 10 | 2904449895 | Variovorax sp. 1763 | Isolate | Rhizosphere |
| 11 | 2904456579 | Variovorax sp. 2002 | Isolate | Unclassified |
| 12 | 2929520902 | Variovorax beijingensis 502 | Isolate | Unclassified |
| 13 | 2941479691 | |||
| 14 | 2945945610 | Variovorax paradoxus W1I18 | Isolate | Rhizosphere |
| 15 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 16 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 17 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 18 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 19 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 20 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 21 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 22 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 23 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 24 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 25 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 26 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 27 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 28 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 34 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 35 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 37 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 39 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 40 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 41 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 42 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 43 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 44 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 45 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 46 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 47 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 48 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 49 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 59 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 61 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 62 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 63 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 64 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 65 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 66 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 67 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 68 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 69 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 70 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 71 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 72 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 73 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 74 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 75 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 76 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 77 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 78 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 79 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 98 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 99 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 100 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 101 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 102 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 103 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 104 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 105 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 106 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 107 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 108 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 109 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 110 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 111 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 112 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 113 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 114 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 115 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 116 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 117 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 118 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 119 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 120 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 121 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 122 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 123 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 124 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 125 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 126 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 127 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 128 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 129 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 130 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 131 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 132 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 133 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 134 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 135 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 148 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 149 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 150 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 151 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 152 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 153 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 154 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 155 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 156 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 157 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 158 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 159 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 160 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 161 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 162 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 163 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 164 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 165 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 166 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 167 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 168 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 92.99 |
| Metatranscriptomes | 0.47 |
| Isolates | 6.54 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 19.63 |
| Nodule | 1.4 |
| Rhizoplane | 0.93 |
| Rhizosphere | 57.01 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 21.03 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25156J39149_1000042 | 3300002705 | Bacteria | 105742 |
| 2 | JGI25156J39149_1017013 | 3300002705 | Bacteria | 1392 |
| 3 | JGI25154J39366_1000978 | 3300002738 | Bacteria | 11670 |
| 4 | JGI25157J39369_1000033 | 3300002741 | Bacteria | 139508 |
| 5 | JGI25165J46597_1000373 | 3300003214 | Bacteria | 49990 |
| 6 | Ga0006562J51391_1136768 | 3300003578 | Bacteria | 3330 |
| 7 | Ga0055538_1000144 | 3300003751 | Bacteria | 49990 |
| 8 | Ga0055539_1000195 | 3300003752 | Bacteria | 49990 |
| 9 | Ga0055539_1000413 | 3300003752 | Bacteria | 16128 |
| 10 | Ga0055533_1000196 | 3300003756 | Bacteria | 49990 |
| 11 | Ga0055525_1000263 | 3300003759 | Bacteria | 49990 |
| 12 | Ga0055534_1000210 | 3300003784 | Bacteria | 43102 |
| 13 | Ga0055528_1001684 | 3300003790 | Bacteria | 12921 |
| 14 | Ga0055540_1000375 | 3300003792 | Bacteria | 37385 |
| 15 | Ga0055541_1000128 | 3300003841 | Bacteria | 49990 |
| 16 | Ga0070660_100020490 | 3300005339 | Bacteria | 4860 |
| 17 | Ga0070660_100169688 | 3300005339 | Bacteria | 1762 |
| 18 | Ga0070661_100001113 | 3300005344 | Bacteria | 18879 |
| 19 | Ga0070661_100024903 | 3300005344 | Bacteria | 4296 |
| 20 | Ga0070659_100000400 | 3300005366 | Bacteria | 32855 |
| 21 | Ga0070659_100008741 | 3300005366 | Bacteria | 7412 |
| 22 | Ga0070667_100001997 | 3300005367 | Bacteria | 18078 |
| 23 | Ga0070662_100008054 | 3300005457 | Bacteria | 6859 |
| 24 | Ga0068867_100000097 | 3300005459 | Bacteria | 55623 |
| 25 | Ga0068853_100049887 | 3300005539 | Bacteria | 3598 |
| 26 | Ga0068853_100179104 | 3300005539 | Bacteria | 1922 |
| 27 | Ga0070665_100663748 | 3300005548 | Bacteria | 1056 |
| 28 | Ga0068855_100216715 | 3300005563 | Bacteria | 2148 |
| 29 | Ga0070664_100016748 | 3300005564 | Bacteria | 6014 |
| 30 | Ga0070664_100071759 | 3300005564 | Bacteria | 2968 |
| 31 | Ga0068857_100000169 | 3300005577 | Bacteria | 41061 |
| 32 | Ga0068854_100086721 | 3300005578 | Bacteria | 2321 |
| 33 | Ga0068852_100112495 | 3300005616 | Bacteria | 2478 |
| 34 | Ga0068852_100201896 | 3300005616 | Bacteria | 1882 |
| 35 | Ga0075363_100106981 | 3300006048 | Bacteria | 1552 |
| 36 | Ga0075364_10072067 | 3300006051 | Bacteria | 2276 |
| 37 | Ga0075432_10036179 | 3300006058 | Bacteria | 1716 |
| 38 | Ga0075362_10000918 | 3300006177 | Bacteria | 8945 |
| 39 | Ga0075362_10057723 | 3300006177 | Bacteria | 1750 |
| 40 | Ga0075369_10096274 | 3300006186 | Bacteria | 1325 |
| 41 | Ga0075366_10027302 | 3300006195 | Bacteria | 3348 |
| 42 | Ga0075366_10086448 | 3300006195 | Bacteria | 1876 |
| 43 | Ga0075370_10018441 | 3300006353 | Bacteria | 3788 |
| 44 | Ga0099826_10018019 | 3300006948 | Bacteria | 5333 |
| 45 | Ga0099826_10096839 | 3300006948 | Bacteria | 1790 |
| 46 | Ga0105244_10045084 | 3300009036 | Bacteria | 2269 |
| 47 | Ga0105240_10021880 | 3300009093 | Bacteria | 8495 |
| 48 | Ga0105240_10095807 | 3300009093 | Bacteria | 3618 |
| 49 | Ga0105243_10000316 | 3300009148 | Bacteria | 53266 |
| 50 | Ga0105241_10304472 | 3300009174 | Bacteria | 1369 |
| 51 | Ga0105237_10003554 | 3300009545 | Bacteria | 18477 |
| 52 | Ga0105238_10080001 | 3300009551 | Bacteria | 3258 |
| 53 | Ga0105238_10090977 | 3300009551 | Bacteria | 3039 |
| 54 | Ga0105239_10002924 | 3300010375 | Bacteria | 21326 |
| 55 | Ga0105239_10072676 | 3300010375 | Bacteria | 3781 |
| 56 | Ga0157369_10087540 | 3300013105 | Bacteria | 3325 |
| 57 | Ga0157378_10475671 | 3300013297 | Bacteria | 1244 |
| 58 | Ga0182008_10006523 | 3300014497 | Bacteria | 6513 |
| 59 | Ga0157377_10000006 | 3300014745 | Bacteria | 419853 |
| 60 | Ga0182007_10023867 | 3300015262 | Bacteria | 2146 |
| 61 | Ga0213872_10000077 | 3300021361 | Bacteria | 90250 |
| 62 | Ga0213872_10000113 | 3300021361 | Bacteria | 74827 |
| 63 | Ga0209784_100010 | 3300025224 | Bacteria | 683664 |
| 64 | Ga0209566_100008 | 3300025225 | Bacteria | 683664 |
| 65 | Ga0209674_100019 | 3300025226 | Bacteria | 683664 |
| 66 | Ga0209563_100021 | 3300025230 | Bacteria | 683764 |
| 67 | Ga0209437_100019 | 3300025233 | Bacteria | 683764 |
| 68 | Ga0209646_1000089 | 3300025246 | Bacteria | 189974 |
| 69 | Ga0209026_1000028 | 3300025250 | Bacteria | 341399 |
| 70 | Ga0209677_100011 | 3300025253 | Bacteria | 683664 |
| 71 | Ga0209677_100066 | 3300025253 | Bacteria | 149370 |
| 72 | Ga0209759_1000021 | 3300025256 | Bacteria | 341399 |
| 73 | Ga0209759_1000458 | 3300025256 | Bacteria | 46338 |
| 74 | Ga0209233_1000025 | 3300025261 | Bacteria | 683764 |
| 75 | Ga0209565_1000039 | 3300025263 | Bacteria | 278026 |
| 76 | Ga0209673_1000146 | 3300025273 | Bacteria | 150871 |
| 77 | Ga0209673_1002180 | 3300025273 | Bacteria | 14435 |
| 78 | Ga0209675_1000030 | 3300025291 | Bacteria | 278026 |
| 79 | Ga0209676_1005652 | 3300025292 | Bacteria | 6443 |
| 80 | Ga0209758_1000177 | 3300025297 | Bacteria | 142824 |
| 81 | Ga0209050_1001310 | 3300025298 | Bacteria | 27931 |
| 82 | Ga0209051_1000271 | 3300025303 | Bacteria | 86541 |
| 83 | Ga0207654_10110360 | 3300025911 | Bacteria | 1710 |
| 84 | Ga0207695_10002511 | 3300025913 | Bacteria | 26961 |
| 85 | Ga0207695_10069020 | 3300025913 | Bacteria | 3619 |
| 86 | Ga0207671_10012924 | 3300025914 | Bacteria | 6683 |
| 87 | Ga0207657_10011517 | 3300025919 | Bacteria | 8780 |
| 88 | Ga0207657_10128574 | 3300025919 | Bacteria | 2078 |
| 89 | Ga0207649_10000950 | 3300025920 | Bacteria | 18074 |
| 90 | Ga0207694_10038248 | 3300025924 | Bacteria | 3689 |
| 91 | Ga0207690_10017352 | 3300025932 | Bacteria | 4392 |
| 92 | Ga0207690_10082191 | 3300025932 | Bacteria | 2253 |
| 93 | Ga0207709_10002544 | 3300025935 | Bacteria | 11355 |
| 94 | Ga0207679_10000088 | 3300025945 | Bacteria | 79836 |
| 95 | Ga0207679_10000265 | 3300025945 | Bacteria | 39990 |
| 96 | Ga0207667_10379418 | 3300025949 | Bacteria | 1440 |
| 97 | Ga0207640_10076076 | 3300025981 | Bacteria | 2277 |
| 98 | Ga0207658_10011938 | 3300025986 | Bacteria | 5921 |
| 99 | Ga0207702_10000200 | 3300026078 | Bacteria | 70607 |
| 100 | Ga0207648_10000779 | 3300026089 | Bacteria | 35914 |
| 101 | Ga0207674_10001816 | 3300026116 | Bacteria | 27235 |
| 102 | Ga0207683_10030460 | 3300026121 | Bacteria | 4675 |
| 103 | Ga0207698_10034174 | 3300026142 | Bacteria | 3703 |
| 104 | Ga0207698_10489748 | 3300026142 | Bacteria | 1194 |
| 105 | Ga0209371_1008954 | 3300027312 | Bacteria | 3245 |
| 106 | Ga0209282_1062584 | 3300027666 | Bacteria | 2066 |
| 107 | Ga0307515_10000150 | 3300028794 | Bacteria | 169644 |
| 108 | Ga0307515_10002776 | 3300028794 | Bacteria | 37347 |
| 109 | Ga0307515_10018786 | 3300028794 | Bacteria | 12481 |
| 110 | Ga0268256_1014687 | 3300030500 | Bacteria | 2312 |
| 111 | Ga0316177_1004516 | 3300030731 | Bacteria | 4396 |
| 112 | Ga0316183_1170720 | 3300030742 | Bacteria | 3297 |
| 113 | Ga0265316_10147839 | 3300031344 | Bacteria | 1761 |
| 114 | Ga0307513_10077425 | 3300031456 | Bacteria | 3444 |
| 115 | Ga0307509_10001002 | 3300031507 | Bacteria | 48561 |
| 116 | Ga0307408_100036735 | 3300031548 | Bacteria | 3445 |
| 117 | Ga0307514_10131356 | 3300031649 | Bacteria | 1723 |
| 118 | Ga0307516_10032019 | 3300031730 | Bacteria | 5298 |
| 119 | Ga0307405_10015624 | 3300031731 | Bacteria | 4117 |
| 120 | Ga0307405_10066778 | 3300031731 | Bacteria | 2294 |
| 121 | Ga0307406_10300642 | 3300031901 | Bacteria | 1233 |
| 122 | Ga0307407_10181378 | 3300031903 | Bacteria | 1396 |
| 123 | Ga0307412_10000087 | 3300031911 | Bacteria | 84138 |
| 124 | Ga0307412_10005923 | 3300031911 | Bacteria | 6890 |
| 125 | Ga0307510_10004362 | 3300033180 | Bacteria | 16655 |
| 126 | Ga0373931_0001086 | 3300035691 | Bacteria | 11518 |
| 127 | Ga0373931_0047533 | 3300035691 | Bacteria | 2272 |
| 128 | Ga0395905_0272210 | 3300037471 | Bacteria | 1579 |
| 129 | Ga0436361_0382853 | 3300039447 | Bacteria | 24786 |
| 130 | Ga0436361_0912981 | 3300039447 | Bacteria | 3743 |
| 131 | Ga0436361_1007413 | 3300039447 | Bacteria | 98457 |
| 132 | Ga0450923_009291 | 3300042125 | Bacteria | 1716 |
| 133 | Ga0450898_003446 | 3300042134 | Bacteria | 2274 |
| 134 | Ga0450907_003213 | 3300042146 | Bacteria | 2947 |
| 135 | Ga0439434_0007077 | 3300042435 | Bacteria | 3279 |
| 136 | Ga0450918_002379 | 3300042531 | Bacteria | 3557 |
| 137 | Ga0450893_0040254 | 3300042532 | Bacteria | 855 |
| 138 | Ga0466969_0030878 | 3300044656 | Bacteria | 2728 |
| 139 | Ga0466972_0001086 | 3300044658 | Bacteria | 13045 |
| 140 | Ga0466965_0007123 | 3300044683 | Bacteria | 5120 |
| 141 | Ga0466965_0099072 | 3300044683 | Bacteria | 1489 |
| 142 | Ga0466966_0135749 | 3300044684 | Bacteria | 1504 |
| 143 | Ga0466961_0121417 | 3300044693 | Bacteria | 1640 |
| 144 | Ga0466963_0123729 | 3300044694 | Bacteria | 1782 |
| 145 | Ga0453684_0041082 | 3300044712 | Bacteria | 6263 |
| 146 | Ga0466971_0017000 | 3300044719 | Bacteria | 3216 |
| 147 | Ga0466971_0035318 | 3300044719 | Bacteria | 2241 |
| 148 | Ga0466968_0083197 | 3300044735 | Bacteria | 1409 |
| 149 | Ga0466968_0112477 | 3300044735 | Bacteria | 1225 |
| 150 | Ga0466970_0006916 | 3300044765 | Bacteria | 5680 |
| 151 | Ga0466957_0000486 | 3300044842 | Bacteria | 19778 |
| 152 | Ga0466957_0020418 | 3300044842 | Bacteria | 3898 |
| 153 | Ga0466957_0035211 | 3300044842 | Bacteria | 3004 |
| 154 | Ga0466959_0002166 | 3300045049 | Bacteria | 12477 |
| 155 | Ga0466959_0009584 | 3300045049 | Bacteria | 6889 |
| 156 | Ga0466958_0000031 | 3300045836 | Bacteria | 40155 |
| 157 | Ga0466958_0006720 | 3300045836 | Bacteria | 6278 |
| 158 | Ga0495592_0000441 | 3300046454 | Bacteria | 31137 |
| 159 | Ga0495653_0251641 | 3300046463 | Bacteria | 1172 |
| 160 | Ga0495585_0032351 | 3300046492 | Bacteria | 2963 |
| 161 | Ga0495607_0000021 | 3300046501 | Bacteria | 164571 |
| 162 | Ga0495608_0043299 | 3300046511 | Bacteria | 3008 |
| 163 | Ga0495628_0000580 | 3300046516 | Bacteria | 33596 |
| 164 | Ga0495652_0006053 | 3300046529 | Bacteria | 11315 |
| 165 | Ga0495652_0009031 | 3300046529 | Bacteria | 9069 |
| 166 | Ga0495657_0097668 | 3300046675 | Bacteria | 1875 |
| 167 | Ga0495623_0141350 | 3300046679 | Bacteria | 1431 |
| 168 | Ga0495646_0004339 | 3300046680 | Bacteria | 8933 |
| 169 | Ga0495646_0075869 | 3300046680 | Bacteria | 1970 |
| 170 | Ga0495624_0030968 | 3300046690 | Bacteria | 3482 |
| 171 | Ga0495602_0017309 | 3300048088 | Bacteria | 7227 |
| 172 | Ga0496109_0077371 | 3300048912 | Bacteria | 3062 |
| 173 | Ga0496116_0005934 | 3300048919 | Bacteria | 11200 |
| 174 | Ga0496117_0025816 | 3300048920 | Bacteria | 4608 |
| 175 | Ga0496118_0006774 | 3300048921 | Bacteria | 12458 |
| 176 | Ga0496118_0011539 | 3300048921 | Bacteria | 8611 |
| 177 | Ga0496119_0016130 | 3300048922 | Bacteria | 5705 |
| 178 | Ga0496119_0036682 | 3300048922 | Bacteria | 3197 |
| 179 | Ga0496120_0006491 | 3300048923 | Bacteria | 8965 |
| 180 | Ga0496121_0000165 | 3300048924 | Bacteria | 145052 |
| 181 | Ga0496121_0139575 | 3300048924 | Bacteria | 1800 |
| 182 | Ga0496122_0001028 | 3300048925 | Bacteria | 49218 |
| 183 | Ga0496122_0116780 | 3300048925 | Bacteria | 1734 |
| 184 | Ga0496123_0000763 | 3300048926 | Bacteria | 52065 |
| 185 | Ga0496123_0139648 | 3300048926 | Bacteria | 1327 |
| 186 | Ga0496124_0130769 | 3300048927 | Bacteria | 1994 |
| 187 | Ga0496125_0000121 | 3300048928 | Bacteria | 174971 |
| 188 | Ga0496125_0271693 | 3300048928 | Bacteria | 1056 |
| 189 | Ga0496126_0072461 | 3300048929 | Bacteria | 3064 |
| 190 | Ga0501225_0012306 | 3300049705 | Bacteria | 2403 |
| 191 | nmdc:mga03683_3400_c1 | 3300050489 | Bacteria | 5128 |
| 192 | nmdc:mga03n38_136735_c1 | 3300050490 | Bacteria | 1220 |
| 193 | nmdc:mga00v17_27131_c1 | 3300050491 | Bacteria | 3341 |
| 194 | nmdc:mga0k408_27299_c1 | 3300050493 | Bacteria | 1982 |
| 195 | Ga0500635_0000076 | 3300053080 | Bacteria | 63630 |
| 196 | Ga0500651_0027311 | 3300053093 | Bacteria | 3589 |
| 197 | Ga0500559_0000027 | 3300053136 | Bacteria | 118758 |
| 198 | Ga0500604_0014398 | 3300053151 | Bacteria | 2154 |
| 199 | Ga0466962_0014575 | 3300061719 | Bacteria | 3788 |
| 200 | Ga0466962_0061185 | 3300061719 | Bacteria | 1797 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300037471 | Ga0395905_0272210 | Ga0395905_0272210_336_1205 | 245 |
| 2 | 3300005539 | Ga0068853_100179104 | Ga0068853_1001791042 | 246 |
| 3 | 3300005548 | Ga0070665_100663748 | Ga0070665_1006637482 | 246 |
| 4 | 3300005616 | Ga0068852_100201896 | Ga0068852_1002018962 | 246 |
| 5 | 3300009093 | Ga0105240_10095807 | Ga0105240_100958074 | 246 |
| 6 | 3300009174 | Ga0105241_10304472 | Ga0105241_103044721 | 246 |
| 7 | 3300009545 | Ga0105237_10003554 | Ga0105237_1000355411 | 246 |
| 8 | 3300009551 | Ga0105238_10090977 | Ga0105238_100909772 | 246 |
| 9 | 3300010375 | Ga0105239_10002924 | Ga0105239_1000292414 | 246 |
| 10 | 3300025911 | Ga0207654_10110360 | Ga0207654_101103601 | 246 |
| 11 | 3300025913 | Ga0207695_10069020 | Ga0207695_100690201 | 246 |
| 12 | 3300025914 | Ga0207671_10012924 | Ga0207671_100129244 | 246 |
| 13 | 3300025924 | Ga0207694_10038248 | Ga0207694_100382483 | 246 |
| 14 | 3300026121 | Ga0207683_10030460 | Ga0207683_100304603 | 247 |
| 15 | 3300031730 | Ga0307516_10032019 | Ga0307516_100320193 | 249 |
| 16 | 3300005459 | Ga0068867_100000097 | Ga0068867_1000000977 | 253 |
| 17 | 3300009148 | Ga0105243_10000316 | Ga0105243_100003163 | 253 |
| 18 | 3300014745 | Ga0157377_10000006 | Ga0157377_10000006282 | 253 |
| 19 | 3300025935 | Ga0207709_10002544 | Ga0207709_100025443 | 253 |
| 20 | 3300026089 | Ga0207648_10000779 | Ga0207648_100007799 | 253 |
| 21 | 3300042532 | Ga0450893_0040254 | Ga0450893_0040254_44_808 | 253 |
| 22 | 3300013297 | Ga0157378_10475671 | Ga0157378_104756712 | 258 |
| 23 | 3300026142 | Ga0207698_10034174 | Ga0207698_100341741 | 262 |
| 24 | 3300005457 | Ga0070662_100008054 | Ga0070662_1000080544 | 263 |
| 25 | 3300005339 | Ga0070660_100020490 | Ga0070660_1000204905 | 266 |
| 26 | 3300005344 | Ga0070661_100024903 | Ga0070661_1000249033 | 266 |
| 27 | 3300005366 | Ga0070659_100008741 | Ga0070659_1000087413 | 266 |
| 28 | 3300005564 | Ga0070664_100071759 | Ga0070664_1000717592 | 266 |
| 29 | 3300025292 | Ga0209676_1005652 | Ga0209676_10056524 | 266 |
| 30 | 3300025298 | Ga0209050_1001310 | Ga0209050_100131011 | 266 |
| 31 | 3300025919 | Ga0207657_10011517 | Ga0207657_100115175 | 266 |
| 32 | 3300025932 | Ga0207690_10017352 | Ga0207690_100173524 | 266 |
| 33 | 3300044658 | Ga0466972_0001086 | Ga0466972_0001086_2353_3219 | 266 |
| 34 | 3300044683 | Ga0466965_0099072 | Ga0466965_0099072_343_1209 | 266 |
| 35 | 3300006195 | Ga0075366_10027302 | Ga0075366_100273021 | 272 |
| 36 | 3300035691 | Ga0373931_0047533 | Ga0373931_0047533_1040_1858 | 272 |
| 37 | 3300042134 | Ga0450898_003446 | Ga0450898_003446_252_1082 | 275 |
| 38 | 3300021361 | Ga0213872_10000077 | Ga0213872_1000007750 | 277 |
| 39 | 3300039447 | Ga0436361_1007413 | Ga0436361_1007413_63000_63833 | 277 |
| 40 | 3300028794 | Ga0307515_10018786 | Ga0307515_1001878612 | 278 |
| 41 | 3300005367 | Ga0070667_100001997 | Ga0070667_1000019977 | 280 |
| 42 | 3300025986 | Ga0207658_10011938 | Ga0207658_100119387 | 280 |
| 43 | 3300031456 | Ga0307513_10077425 | Ga0307513_100774254 | 280 |
| 44 | iso_pu_bacteria | 2599185292 | 2599904407 | 280 |
| 45 | iso_pu_bacteria | 2643221569 | 2643863646 | 280 |
| 46 | iso_pu_bacteria | 2643221594 | 2643982848 | 280 |
| 47 | iso_pu_bacteria | 2643221621 | 2644123325 | 280 |
| 48 | iso_pu_bacteria | 2808606395 | 2809033438 | 280 |
| 49 | iso_pu_bacteria | 2857537821 | 2857538058 | 280 |
| 50 | iso_pu_bacteria | 2818991436 | 2819542036 | 281 |
| 51 | iso_pu_bacteria | 2842677519 | 2842682887 | 281 |
| 52 | iso_pu_bacteria | 2941479691 | 2941484306 | 281 |
| 53 | iso_pu_bacteria | 2858950400 | 2858951856 | 282 |
| 54 | iso_pu_bacteria | 2904449895 | 2904453464 | 282 |
| 55 | iso_pu_bacteria | 2904456579 | 2904459422 | 282 |
| 56 | iso_pu_bacteria | 2929520902 | 2929523107 | 282 |
| 57 | iso_pu_bacteria | 2945945610 | 2945948489 | 282 |
| 58 | 3300025297 | Ga0209758_1000177 | Ga0209758_100017792 | 284 |
| 59 | 3300027312 | Ga0209371_1008954 | Ga0209371_10089544 | 284 |
| 60 | 3300044712 | Ga0453684_0041082 | Ga0453684_0041082_1987_2847 | 284 |
| 61 | 3300044735 | Ga0466968_0083197 | Ga0466968_0083197_14_868 | 284 |
| 62 | 3300048920 | Ga0496117_0025816 | Ga0496117_0025816_2062_2916 | 284 |
| 63 | 3300048921 | Ga0496118_0006774 | Ga0496118_0006774_3581_4435 | 284 |
| 64 | 3300048922 | Ga0496119_0036682 | Ga0496119_0036682_1186_2040 | 284 |
| 65 | 3300003214 | JGI25165J46597_1000373 | JGI25165J46597_100037343 | 285 |
| 66 | 3300003751 | Ga0055538_1000144 | Ga0055538_100014443 | 285 |
| 67 | 3300003752 | Ga0055539_1000195 | Ga0055539_100019515 | 285 |
| 68 | 3300003756 | Ga0055533_1000196 | Ga0055533_100019643 | 285 |
| 69 | 3300003759 | Ga0055525_1000263 | Ga0055525_100026343 | 285 |
| 70 | 3300003841 | Ga0055541_1000128 | Ga0055541_100012815 | 285 |
| 71 | 3300005344 | Ga0070661_100001113 | Ga0070661_10000111315 | 285 |
| 72 | 3300005366 | Ga0070659_100000400 | Ga0070659_10000040011 | 285 |
| 73 | 3300005564 | Ga0070664_100016748 | Ga0070664_1000167485 | 285 |
| 74 | 3300006353 | Ga0075370_10018441 | Ga0075370_100184412 | 285 |
| 75 | 3300009036 | Ga0105244_10045084 | Ga0105244_100450842 | 285 |
| 76 | 3300015262 | Ga0182007_10023867 | Ga0182007_100238672 | 285 |
| 77 | 3300021361 | Ga0213872_10000113 | Ga0213872_1000011343 | 285 |
| 78 | 3300025224 | Ga0209784_100010 | Ga0209784_10001043 | 285 |
| 79 | 3300025225 | Ga0209566_100008 | Ga0209566_10000843 | 285 |
| 80 | 3300025226 | Ga0209674_100019 | Ga0209674_10001943 | 285 |
| 81 | 3300025230 | Ga0209563_100021 | Ga0209563_10002143 | 285 |
| 82 | 3300025233 | Ga0209437_100019 | Ga0209437_10001943 | 285 |
| 83 | 3300025253 | Ga0209677_100011 | Ga0209677_10001143 | 285 |
| 84 | 3300025261 | Ga0209233_1000025 | Ga0209233_100002543 | 285 |
| 85 | 3300025919 | Ga0207657_10128574 | Ga0207657_101285742 | 285 |
| 86 | 3300025920 | Ga0207649_10000950 | Ga0207649_1000095014 | 285 |
| 87 | 3300025932 | Ga0207690_10082191 | Ga0207690_100821912 | 285 |
| 88 | 3300025945 | Ga0207679_10000088 | Ga0207679_1000008868 | 285 |
| 89 | 3300025945 | Ga0207679_10000265 | Ga0207679_1000026532 | 285 |
| 90 | 3300030500 | Ga0268256_1014687 | Ga0268256_10146871 | 285 |
| 91 | 3300031344 | Ga0265316_10147839 | Ga0265316_101478392 | 285 |
| 92 | 3300031507 | Ga0307509_10001002 | Ga0307509_1000100238 | 285 |
| 93 | 3300031649 | Ga0307514_10131356 | Ga0307514_101313561 | 285 |
| 94 | 3300031911 | Ga0307412_10000087 | Ga0307412_1000008730 | 285 |
| 95 | 3300033180 | Ga0307510_10004362 | Ga0307510_100043628 | 285 |
| 96 | 3300039447 | Ga0436361_0382853 | Ga0436361_0382853_20351_21211 | 285 |
| 97 | 3300039447 | Ga0436361_0912981 | Ga0436361_0912981_332_1210 | 285 |
| 98 | 3300044693 | Ga0466961_0121417 | Ga0466961_0121417_518_1375 | 285 |
| 99 | 3300044719 | Ga0466971_0035318 | Ga0466971_0035318_866_1723 | 285 |
| 100 | 3300044842 | Ga0466957_0035211 | Ga0466957_0035211_956_1813 | 285 |
| 101 | 3300045049 | Ga0466959_0002166 | Ga0466959_0002166_10908_11765 | 285 |
| 102 | 3300046454 | Ga0495592_0000441 | Ga0495592_0000441_20043_20912 | 285 |
| 103 | 3300046675 | Ga0495657_0097668 | Ga0495657_0097668_932_1789 | 285 |
| 104 | 3300046680 | Ga0495646_0075869 | Ga0495646_0075869_708_1577 | 285 |
| 105 | 3300048919 | Ga0496116_0005934 | Ga0496116_0005934_4968_5825 | 285 |
| 106 | 3300048921 | Ga0496118_0011539 | Ga0496118_0011539_6489_7346 | 285 |
| 107 | 3300048922 | Ga0496119_0016130 | Ga0496119_0016130_4822_5679 | 285 |
| 108 | 3300048923 | Ga0496120_0006491 | Ga0496120_0006491_3415_4272 | 285 |
| 109 | 3300048924 | Ga0496121_0000165 | Ga0496121_0000165_22718_23575 | 285 |
| 110 | 3300048924 | Ga0496121_0139575 | Ga0496121_0139575_424_1281 | 285 |
| 111 | 3300048925 | Ga0496122_0001028 | Ga0496122_0001028_9090_9947 | 285 |
| 112 | 3300048925 | Ga0496122_0116780 | Ga0496122_0116780_252_1109 | 285 |
| 113 | 3300048926 | Ga0496123_0000763 | Ga0496123_0000763_32251_33108 | 285 |
| 114 | 3300048926 | Ga0496123_0139648 | Ga0496123_0139648_367_1224 | 285 |
| 115 | 3300048927 | Ga0496124_0130769 | Ga0496124_0130769_403_1260 | 285 |
| 116 | 3300048928 | Ga0496125_0000121 | Ga0496125_0000121_33172_34029 | 285 |
| 117 | 3300048929 | Ga0496126_0072461 | Ga0496126_0072461_414_1271 | 285 |
| 118 | 3300053080 | Ga0500635_0000076 | Ga0500635_0000076_14857_15714 | 285 |
| 119 | 3300053093 | Ga0500651_0027311 | Ga0500651_0027311_1289_2158 | 285 |
| 120 | 3300053136 | Ga0500559_0000027 | Ga0500559_0000027_41641_42510 | 285 |
| 121 | 3300053151 | Ga0500604_0014398 | Ga0500604_0014398_764_1633 | 285 |
| 122 | 3300061719 | Ga0466962_0061185 | Ga0466962_0061185_497_1354 | 285 |
| 123 | 3300002705 | JGI25156J39149_1000042 | JGI25156J39149_100004240 | 286 |
| 124 | 3300002705 | JGI25156J39149_1017013 | JGI25156J39149_10170132 | 286 |
| 125 | 3300002738 | JGI25154J39366_1000978 | JGI25154J39366_10009785 | 286 |
| 126 | 3300002741 | JGI25157J39369_1000033 | JGI25157J39369_100003335 | 286 |
| 127 | 3300003578 | Ga0006562J51391_1136768 | Ga0006562J51391_11367683 | 286 |
| 128 | 3300003752 | Ga0055539_1000413 | Ga0055539_10004139 | 286 |
| 129 | 3300003784 | Ga0055534_1000210 | Ga0055534_100021026 | 286 |
| 130 | 3300003790 | Ga0055528_1001684 | Ga0055528_10016841 | 286 |
| 131 | 3300003792 | Ga0055540_1000375 | Ga0055540_10003755 | 286 |
| 132 | 3300005339 | Ga0070660_100169688 | Ga0070660_1001696883 | 286 |
| 133 | 3300005539 | Ga0068853_100049887 | Ga0068853_1000498873 | 286 |
| 134 | 3300005563 | Ga0068855_100216715 | Ga0068855_1002167152 | 286 |
| 135 | 3300005577 | Ga0068857_100000169 | Ga0068857_10000016915 | 286 |
| 136 | 3300005578 | Ga0068854_100086721 | Ga0068854_1000867213 | 286 |
| 137 | 3300005616 | Ga0068852_100112495 | Ga0068852_1001124952 | 286 |
| 138 | 3300006048 | Ga0075363_100106981 | Ga0075363_1001069812 | 286 |
| 139 | 3300006051 | Ga0075364_10072067 | Ga0075364_100720672 | 286 |
| 140 | 3300006058 | Ga0075432_10036179 | Ga0075432_100361793 | 286 |
| 141 | 3300006177 | Ga0075362_10000918 | Ga0075362_100009187 | 286 |
| 142 | 3300006177 | Ga0075362_10057723 | Ga0075362_100577232 | 286 |
| 143 | 3300006186 | Ga0075369_10096274 | Ga0075369_100962742 | 286 |
| 144 | 3300006195 | Ga0075366_10086448 | Ga0075366_100864482 | 286 |
| 145 | 3300006948 | Ga0099826_10018019 | Ga0099826_100180192 | 286 |
| 146 | 3300006948 | Ga0099826_10096839 | Ga0099826_100968392 | 286 |
| 147 | 3300009093 | Ga0105240_10021880 | Ga0105240_100218809 | 286 |
| 148 | 3300009551 | Ga0105238_10080001 | Ga0105238_100800012 | 286 |
| 149 | 3300010375 | Ga0105239_10072676 | Ga0105239_100726765 | 286 |
| 150 | 3300013105 | Ga0157369_10087540 | Ga0157369_100875404 | 286 |
| 151 | 3300014497 | Ga0182008_10006523 | Ga0182008_100065238 | 286 |
| 152 | 3300025246 | Ga0209646_1000089 | Ga0209646_100008981 | 286 |
| 153 | 3300025250 | Ga0209026_1000028 | Ga0209026_1000028204 | 286 |
| 154 | 3300025253 | Ga0209677_100066 | Ga0209677_10006677 | 286 |
| 155 | 3300025256 | Ga0209759_1000021 | Ga0209759_100002181 | 286 |
| 156 | 3300025256 | Ga0209759_1000458 | Ga0209759_100045814 | 286 |
| 157 | 3300025263 | Ga0209565_1000039 | Ga0209565_1000039148 | 286 |
| 158 | 3300025273 | Ga0209673_1000146 | Ga0209673_1000146116 | 286 |
| 159 | 3300025273 | Ga0209673_1002180 | Ga0209673_100218011 | 286 |
| 160 | 3300025291 | Ga0209675_1000030 | Ga0209675_1000030148 | 286 |
| 161 | 3300025303 | Ga0209051_1000271 | Ga0209051_100027187 | 286 |
| 162 | 3300025913 | Ga0207695_10002511 | Ga0207695_1000251124 | 286 |
| 163 | 3300025949 | Ga0207667_10379418 | Ga0207667_103794181 | 286 |
| 164 | 3300025981 | Ga0207640_10076076 | Ga0207640_100760763 | 286 |
| 165 | 3300026078 | Ga0207702_10000200 | Ga0207702_1000020014 | 286 |
| 166 | 3300026116 | Ga0207674_10001816 | Ga0207674_1000181611 | 286 |
| 167 | 3300026142 | Ga0207698_10489748 | Ga0207698_104897482 | 286 |
| 168 | 3300027666 | Ga0209282_1062584 | Ga0209282_10625842 | 286 |
| 169 | 3300028794 | Ga0307515_10000150 | Ga0307515_10000150135 | 286 |
| 170 | 3300028794 | Ga0307515_10002776 | Ga0307515_1000277625 | 286 |
| 171 | 3300030731 | Ga0316177_1004516 | Ga0316177_10045165 | 286 |
| 172 | 3300030742 | Ga0316183_1170720 | Ga0316183_11707202 | 286 |
| 173 | 3300031548 | Ga0307408_100036735 | Ga0307408_1000367354 | 286 |
| 174 | 3300031731 | Ga0307405_10015624 | Ga0307405_100156242 | 286 |
| 175 | 3300031731 | Ga0307405_10066778 | Ga0307405_100667782 | 286 |
| 176 | 3300031901 | Ga0307406_10300642 | Ga0307406_103006422 | 286 |
| 177 | 3300031903 | Ga0307407_10181378 | Ga0307407_101813782 | 286 |
| 178 | 3300031911 | Ga0307412_10005923 | Ga0307412_100059238 | 286 |
| 179 | 3300035691 | Ga0373931_0001086 | Ga0373931_0001086_5192_6058 | 286 |
| 180 | 3300042125 | Ga0450923_009291 | Ga0450923_009291_212_1114 | 286 |
| 181 | 3300042146 | Ga0450907_003213 | Ga0450907_003213_1991_2893 | 286 |
| 182 | 3300042435 | Ga0439434_0007077 | Ga0439434_0007077_2027_2929 | 286 |
| 183 | 3300042531 | Ga0450918_002379 | Ga0450918_002379_1252_2154 | 286 |
| 184 | 3300044656 | Ga0466969_0030878 | Ga0466969_0030878_99_971 | 286 |
| 185 | 3300044683 | Ga0466965_0007123 | Ga0466965_0007123_3359_4231 | 286 |
| 186 | 3300044684 | Ga0466966_0135749 | Ga0466966_0135749_293_1165 | 286 |
| 187 | 3300044694 | Ga0466963_0123729 | Ga0466963_0123729_215_1087 | 286 |
| 188 | 3300044719 | Ga0466971_0017000 | Ga0466971_0017000_2070_2942 | 286 |
| 189 | 3300044735 | Ga0466968_0112477 | Ga0466968_0112477_204_1076 | 286 |
| 190 | 3300044765 | Ga0466970_0006916 | Ga0466970_0006916_1433_2305 | 286 |
| 191 | 3300044842 | Ga0466957_0000486 | Ga0466957_0000486_2275_3147 | 286 |
| 192 | 3300044842 | Ga0466957_0020418 | Ga0466957_0020418_1336_2208 | 286 |
| 193 | 3300045049 | Ga0466959_0009584 | Ga0466959_0009584_1046_1918 | 286 |
| 194 | 3300045836 | Ga0466958_0000031 | Ga0466958_0000031_27348_28217 | 286 |
| 195 | 3300045836 | Ga0466958_0006720 | Ga0466958_0006720_4917_5789 | 286 |
| 196 | 3300046463 | Ga0495653_0251641 | Ga0495653_0251641_50_919 | 286 |
| 197 | 3300046492 | Ga0495585_0032351 | Ga0495585_0032351_807_1673 | 286 |
| 198 | 3300046501 | Ga0495607_0000021 | Ga0495607_0000021_58345_59205 | 286 |
| 199 | 3300046511 | Ga0495608_0043299 | Ga0495608_0043299_125_994 | 286 |
| 200 | 3300046516 | Ga0495628_0000580 | Ga0495628_0000580_23795_24664 | 286 |
| 201 | 3300046529 | Ga0495652_0006053 | Ga0495652_0006053_6422_7291 | 286 |
| 202 | 3300046529 | Ga0495652_0009031 | Ga0495652_0009031_563_1432 | 286 |
| 203 | 3300046679 | Ga0495623_0141350 | Ga0495623_0141350_347_1216 | 286 |
| 204 | 3300046680 | Ga0495646_0004339 | Ga0495646_0004339_3869_4738 | 286 |
| 205 | 3300046690 | Ga0495624_0030968 | Ga0495624_0030968_1151_2020 | 286 |
| 206 | 3300048088 | Ga0495602_0017309 | Ga0495602_0017309_1957_2826 | 286 |
| 207 | 3300048912 | Ga0496109_0077371 | Ga0496109_0077371_1679_2542 | 286 |
| 208 | 3300048928 | Ga0496125_0271693 | Ga0496125_0271693_104_967 | 286 |
| 209 | 3300049705 | Ga0501225_0012306 | Ga0501225_0012306_1344_2207 | 286 |
| 210 | 3300050489 | nmdc:mga03683_3400_c1 | nmdc:mga03683_3400_c1_3120_3983 | 286 |
| 211 | 3300050490 | nmdc:mga03n38_136735_c1 | nmdc:mga03n38_136735_c1_281_1144 | 286 |
| 212 | 3300050491 | nmdc:mga00v17_27131_c1 | nmdc:mga00v17_27131_c1_1782_2645 | 286 |
| 213 | 3300050493 | nmdc:mga0k408_27299_c1 | nmdc:mga0k408_27299_c1_540_1403 | 286 |
| 214 | 3300061719 | Ga0466962_0014575 | Ga0466962_0014575_2465_3337 | 286 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1im5-assembly1.cif.gz_A | crystal structure of pyrazinamidase of pyrococcus horikoshii in complex with zinc | 0.8321 | 4 | 275 |
| 2wt9-assembly1.cif.gz_A | acinetobacter baumanii nicotinamidase pyrazinamidease | 0.8305 | 3 | 279 |
| 3hb7-assembly4.cif.gz_H | the crystal structure of an isochorismatase-like hydrolase from alkaliphilus metalliredigens to 2.3a | 0.8259 | 4 | 282 |
| 6kua-assembly1.cif.gz_B | crystal structure of the nicotinamidase sapnca from staphylococcus aureus | 0.8214 | 3 | 273 |
| 1im5-assembly1.cif.gz_A | crystal structure of pyrazinamidase of pyrococcus horikoshii in complex with zinc | 0.8191 | 4 | 275 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1im5A00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Isochorismatase-like | 0.8322 | 4 | 275 | 3.40.50.850 |
| 2wt9A00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Isochorismatase-like | 0.8305 | 3 | 279 | 3.40.50.850 |
| af_P21369_4_203_3.40.50.850 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Isochorismatase-like | 0.8222 | 6 | 274 | 3.40.50.850 |
| 3hb7H00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Isochorismatase-like | 0.8216 | 4 | 282 | 3.40.50.850 |
| 1im5A00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Isochorismatase-like | 0.8193 | 4 | 275 | 3.40.50.850 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A257K5Z8-F1-model_v4 | Isochorismatase-like domain-containing protein | 0.9858 | 133 | 278 |
GO:0016787
|
| AF-A0A5C0AXA5-F1-model_v4 | Cysteine hydrolase | 0.9837 | 4 | 285 |
GO:0016787
|
| AF-A0A658A355-F1-model_v4 | deleted | 0.9831 | 88 | 286 |
|
| AF-A9BXF8-F1-model_v4 | Cysteine hydrolase | 0.9803 | 1 | 278 |
GO:0016787
|
| AF-A0A846T4B1-F1-model_v4 | Isochorismatase-like domain-containing protein | 0.9793 | 4 | 278 |
GO:0016787
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar