F325247

General Info

Members Datasets Scaffolds Average Seq Length
214 168 200 282

Family's Representative Sequence

Representative Sequence 3300025298|Ga0209050_1001310|Ga0209050_100131011
Length 266
Sequence MPRTIHLLIVDPQNDFCDLPESYRPLDPLTGLAVAPALPIAGAHADMQRLARFIDATAPVLSSITVTLDSHHRLDIAHPTFWRAGNGDPVAPFTPITAAQLRAGEFVPRHDDDLPRTLNYLDELEARGRYTLMAWPVHCEIGTWGHNVHPDVRAAYGRWEEERQFIVRKVPKGANPRSQLNRGLLDSLDRADLILIAGEAGSHCVKATVEHLAEHLPGGNLSRIVLLTDCMSPVAGFANAQSSFLQRMRDLGVQERTSTDMARALA

Samples

Sample ID Description Type Environment
1 2599185292 Achromobacter sp. NFACC18-2 Isolate Rhizoplane
2 2643221569 Achromobacter sp. Root565 Isolate Unclassified
3 2643221594 Achromobacter sp. Root170 Isolate Unclassified
4 2643221621 Achromobacter sp. Root83 Isolate Unclassified
5 2808606395 Achromobacter sp. SLBN-14 Isolate Unclassified
6 2818991436 Collimonas arenae 515 Isolate Unclassified
7 2842677519 Variovorax sp. R-72495 Isolate Unclassified
8 2857537821 Achromobacter sp. R-71975 Isolate Unclassified
9 2858950400 Achromobacter sp. K91 Isolate Unclassified
10 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
11 2904456579 Variovorax sp. 2002 Isolate Unclassified
12 2929520902 Variovorax beijingensis 502 Isolate Unclassified
13 2941479691
14 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
15 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
16 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
17 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
18 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
19 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
20 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
21 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
22 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
23 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
24 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
25 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
26 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
27 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
28 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
29 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
42 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
43 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
44 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
45 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
46 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
47 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
48 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
49 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
50 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
51 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
52 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
53 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
54 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
55 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
56 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
57 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
58 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
59 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
60 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
61 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
62 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
67 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
68 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
69 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
71 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
72 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
73 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
74 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
75 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
77 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
97 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
98 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
99 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
100 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
101 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
102 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
103 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
104 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
105 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
106 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
107 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
108 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
109 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
110 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
111 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
112 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
113 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
114 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
115 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
116 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
117 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
118 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
119 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
120 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
121 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
122 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
123 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
124 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
125 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
126 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
127 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
128 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
129 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
130 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
131 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
132 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
133 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
134 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
135 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
136 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
137 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
138 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
139 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
140 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
141 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
142 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
143 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
144 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
145 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
146 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
147 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
148 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
149 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
150 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
151 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
152 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
153 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
154 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
155 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
156 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
157 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
158 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
159 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
160 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
161 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
162 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
163 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
164 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
165 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
166 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
167 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
168 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.99
Metatranscriptomes 0.47
Isolates 6.54

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 19.63
Nodule 1.4
Rhizoplane 0.93
Rhizosphere 57.01
Stem 0
Stem Tuber 0
Unclassified 21.03

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25156J39149_1000042 3300002705 Bacteria 105742
2 JGI25156J39149_1017013 3300002705 Bacteria 1392
3 JGI25154J39366_1000978 3300002738 Bacteria 11670
4 JGI25157J39369_1000033 3300002741 Bacteria 139508
5 JGI25165J46597_1000373 3300003214 Bacteria 49990
6 Ga0006562J51391_1136768 3300003578 Bacteria 3330
7 Ga0055538_1000144 3300003751 Bacteria 49990
8 Ga0055539_1000195 3300003752 Bacteria 49990
9 Ga0055539_1000413 3300003752 Bacteria 16128
10 Ga0055533_1000196 3300003756 Bacteria 49990
11 Ga0055525_1000263 3300003759 Bacteria 49990
12 Ga0055534_1000210 3300003784 Bacteria 43102
13 Ga0055528_1001684 3300003790 Bacteria 12921
14 Ga0055540_1000375 3300003792 Bacteria 37385
15 Ga0055541_1000128 3300003841 Bacteria 49990
16 Ga0070660_100020490 3300005339 Bacteria 4860
17 Ga0070660_100169688 3300005339 Bacteria 1762
18 Ga0070661_100001113 3300005344 Bacteria 18879
19 Ga0070661_100024903 3300005344 Bacteria 4296
20 Ga0070659_100000400 3300005366 Bacteria 32855
21 Ga0070659_100008741 3300005366 Bacteria 7412
22 Ga0070667_100001997 3300005367 Bacteria 18078
23 Ga0070662_100008054 3300005457 Bacteria 6859
24 Ga0068867_100000097 3300005459 Bacteria 55623
25 Ga0068853_100049887 3300005539 Bacteria 3598
26 Ga0068853_100179104 3300005539 Bacteria 1922
27 Ga0070665_100663748 3300005548 Bacteria 1056
28 Ga0068855_100216715 3300005563 Bacteria 2148
29 Ga0070664_100016748 3300005564 Bacteria 6014
30 Ga0070664_100071759 3300005564 Bacteria 2968
31 Ga0068857_100000169 3300005577 Bacteria 41061
32 Ga0068854_100086721 3300005578 Bacteria 2321
33 Ga0068852_100112495 3300005616 Bacteria 2478
34 Ga0068852_100201896 3300005616 Bacteria 1882
35 Ga0075363_100106981 3300006048 Bacteria 1552
36 Ga0075364_10072067 3300006051 Bacteria 2276
37 Ga0075432_10036179 3300006058 Bacteria 1716
38 Ga0075362_10000918 3300006177 Bacteria 8945
39 Ga0075362_10057723 3300006177 Bacteria 1750
40 Ga0075369_10096274 3300006186 Bacteria 1325
41 Ga0075366_10027302 3300006195 Bacteria 3348
42 Ga0075366_10086448 3300006195 Bacteria 1876
43 Ga0075370_10018441 3300006353 Bacteria 3788
44 Ga0099826_10018019 3300006948 Bacteria 5333
45 Ga0099826_10096839 3300006948 Bacteria 1790
46 Ga0105244_10045084 3300009036 Bacteria 2269
47 Ga0105240_10021880 3300009093 Bacteria 8495
48 Ga0105240_10095807 3300009093 Bacteria 3618
49 Ga0105243_10000316 3300009148 Bacteria 53266
50 Ga0105241_10304472 3300009174 Bacteria 1369
51 Ga0105237_10003554 3300009545 Bacteria 18477
52 Ga0105238_10080001 3300009551 Bacteria 3258
53 Ga0105238_10090977 3300009551 Bacteria 3039
54 Ga0105239_10002924 3300010375 Bacteria 21326
55 Ga0105239_10072676 3300010375 Bacteria 3781
56 Ga0157369_10087540 3300013105 Bacteria 3325
57 Ga0157378_10475671 3300013297 Bacteria 1244
58 Ga0182008_10006523 3300014497 Bacteria 6513
59 Ga0157377_10000006 3300014745 Bacteria 419853
60 Ga0182007_10023867 3300015262 Bacteria 2146
61 Ga0213872_10000077 3300021361 Bacteria 90250
62 Ga0213872_10000113 3300021361 Bacteria 74827
63 Ga0209784_100010 3300025224 Bacteria 683664
64 Ga0209566_100008 3300025225 Bacteria 683664
65 Ga0209674_100019 3300025226 Bacteria 683664
66 Ga0209563_100021 3300025230 Bacteria 683764
67 Ga0209437_100019 3300025233 Bacteria 683764
68 Ga0209646_1000089 3300025246 Bacteria 189974
69 Ga0209026_1000028 3300025250 Bacteria 341399
70 Ga0209677_100011 3300025253 Bacteria 683664
71 Ga0209677_100066 3300025253 Bacteria 149370
72 Ga0209759_1000021 3300025256 Bacteria 341399
73 Ga0209759_1000458 3300025256 Bacteria 46338
74 Ga0209233_1000025 3300025261 Bacteria 683764
75 Ga0209565_1000039 3300025263 Bacteria 278026
76 Ga0209673_1000146 3300025273 Bacteria 150871
77 Ga0209673_1002180 3300025273 Bacteria 14435
78 Ga0209675_1000030 3300025291 Bacteria 278026
79 Ga0209676_1005652 3300025292 Bacteria 6443
80 Ga0209758_1000177 3300025297 Bacteria 142824
81 Ga0209050_1001310 3300025298 Bacteria 27931
82 Ga0209051_1000271 3300025303 Bacteria 86541
83 Ga0207654_10110360 3300025911 Bacteria 1710
84 Ga0207695_10002511 3300025913 Bacteria 26961
85 Ga0207695_10069020 3300025913 Bacteria 3619
86 Ga0207671_10012924 3300025914 Bacteria 6683
87 Ga0207657_10011517 3300025919 Bacteria 8780
88 Ga0207657_10128574 3300025919 Bacteria 2078
89 Ga0207649_10000950 3300025920 Bacteria 18074
90 Ga0207694_10038248 3300025924 Bacteria 3689
91 Ga0207690_10017352 3300025932 Bacteria 4392
92 Ga0207690_10082191 3300025932 Bacteria 2253
93 Ga0207709_10002544 3300025935 Bacteria 11355
94 Ga0207679_10000088 3300025945 Bacteria 79836
95 Ga0207679_10000265 3300025945 Bacteria 39990
96 Ga0207667_10379418 3300025949 Bacteria 1440
97 Ga0207640_10076076 3300025981 Bacteria 2277
98 Ga0207658_10011938 3300025986 Bacteria 5921
99 Ga0207702_10000200 3300026078 Bacteria 70607
100 Ga0207648_10000779 3300026089 Bacteria 35914
101 Ga0207674_10001816 3300026116 Bacteria 27235
102 Ga0207683_10030460 3300026121 Bacteria 4675
103 Ga0207698_10034174 3300026142 Bacteria 3703
104 Ga0207698_10489748 3300026142 Bacteria 1194
105 Ga0209371_1008954 3300027312 Bacteria 3245
106 Ga0209282_1062584 3300027666 Bacteria 2066
107 Ga0307515_10000150 3300028794 Bacteria 169644
108 Ga0307515_10002776 3300028794 Bacteria 37347
109 Ga0307515_10018786 3300028794 Bacteria 12481
110 Ga0268256_1014687 3300030500 Bacteria 2312
111 Ga0316177_1004516 3300030731 Bacteria 4396
112 Ga0316183_1170720 3300030742 Bacteria 3297
113 Ga0265316_10147839 3300031344 Bacteria 1761
114 Ga0307513_10077425 3300031456 Bacteria 3444
115 Ga0307509_10001002 3300031507 Bacteria 48561
116 Ga0307408_100036735 3300031548 Bacteria 3445
117 Ga0307514_10131356 3300031649 Bacteria 1723
118 Ga0307516_10032019 3300031730 Bacteria 5298
119 Ga0307405_10015624 3300031731 Bacteria 4117
120 Ga0307405_10066778 3300031731 Bacteria 2294
121 Ga0307406_10300642 3300031901 Bacteria 1233
122 Ga0307407_10181378 3300031903 Bacteria 1396
123 Ga0307412_10000087 3300031911 Bacteria 84138
124 Ga0307412_10005923 3300031911 Bacteria 6890
125 Ga0307510_10004362 3300033180 Bacteria 16655
126 Ga0373931_0001086 3300035691 Bacteria 11518
127 Ga0373931_0047533 3300035691 Bacteria 2272
128 Ga0395905_0272210 3300037471 Bacteria 1579
129 Ga0436361_0382853 3300039447 Bacteria 24786
130 Ga0436361_0912981 3300039447 Bacteria 3743
131 Ga0436361_1007413 3300039447 Bacteria 98457
132 Ga0450923_009291 3300042125 Bacteria 1716
133 Ga0450898_003446 3300042134 Bacteria 2274
134 Ga0450907_003213 3300042146 Bacteria 2947
135 Ga0439434_0007077 3300042435 Bacteria 3279
136 Ga0450918_002379 3300042531 Bacteria 3557
137 Ga0450893_0040254 3300042532 Bacteria 855
138 Ga0466969_0030878 3300044656 Bacteria 2728
139 Ga0466972_0001086 3300044658 Bacteria 13045
140 Ga0466965_0007123 3300044683 Bacteria 5120
141 Ga0466965_0099072 3300044683 Bacteria 1489
142 Ga0466966_0135749 3300044684 Bacteria 1504
143 Ga0466961_0121417 3300044693 Bacteria 1640
144 Ga0466963_0123729 3300044694 Bacteria 1782
145 Ga0453684_0041082 3300044712 Bacteria 6263
146 Ga0466971_0017000 3300044719 Bacteria 3216
147 Ga0466971_0035318 3300044719 Bacteria 2241
148 Ga0466968_0083197 3300044735 Bacteria 1409
149 Ga0466968_0112477 3300044735 Bacteria 1225
150 Ga0466970_0006916 3300044765 Bacteria 5680
151 Ga0466957_0000486 3300044842 Bacteria 19778
152 Ga0466957_0020418 3300044842 Bacteria 3898
153 Ga0466957_0035211 3300044842 Bacteria 3004
154 Ga0466959_0002166 3300045049 Bacteria 12477
155 Ga0466959_0009584 3300045049 Bacteria 6889
156 Ga0466958_0000031 3300045836 Bacteria 40155
157 Ga0466958_0006720 3300045836 Bacteria 6278
158 Ga0495592_0000441 3300046454 Bacteria 31137
159 Ga0495653_0251641 3300046463 Bacteria 1172
160 Ga0495585_0032351 3300046492 Bacteria 2963
161 Ga0495607_0000021 3300046501 Bacteria 164571
162 Ga0495608_0043299 3300046511 Bacteria 3008
163 Ga0495628_0000580 3300046516 Bacteria 33596
164 Ga0495652_0006053 3300046529 Bacteria 11315
165 Ga0495652_0009031 3300046529 Bacteria 9069
166 Ga0495657_0097668 3300046675 Bacteria 1875
167 Ga0495623_0141350 3300046679 Bacteria 1431
168 Ga0495646_0004339 3300046680 Bacteria 8933
169 Ga0495646_0075869 3300046680 Bacteria 1970
170 Ga0495624_0030968 3300046690 Bacteria 3482
171 Ga0495602_0017309 3300048088 Bacteria 7227
172 Ga0496109_0077371 3300048912 Bacteria 3062
173 Ga0496116_0005934 3300048919 Bacteria 11200
174 Ga0496117_0025816 3300048920 Bacteria 4608
175 Ga0496118_0006774 3300048921 Bacteria 12458
176 Ga0496118_0011539 3300048921 Bacteria 8611
177 Ga0496119_0016130 3300048922 Bacteria 5705
178 Ga0496119_0036682 3300048922 Bacteria 3197
179 Ga0496120_0006491 3300048923 Bacteria 8965
180 Ga0496121_0000165 3300048924 Bacteria 145052
181 Ga0496121_0139575 3300048924 Bacteria 1800
182 Ga0496122_0001028 3300048925 Bacteria 49218
183 Ga0496122_0116780 3300048925 Bacteria 1734
184 Ga0496123_0000763 3300048926 Bacteria 52065
185 Ga0496123_0139648 3300048926 Bacteria 1327
186 Ga0496124_0130769 3300048927 Bacteria 1994
187 Ga0496125_0000121 3300048928 Bacteria 174971
188 Ga0496125_0271693 3300048928 Bacteria 1056
189 Ga0496126_0072461 3300048929 Bacteria 3064
190 Ga0501225_0012306 3300049705 Bacteria 2403
191 nmdc:mga03683_3400_c1 3300050489 Bacteria 5128
192 nmdc:mga03n38_136735_c1 3300050490 Bacteria 1220
193 nmdc:mga00v17_27131_c1 3300050491 Bacteria 3341
194 nmdc:mga0k408_27299_c1 3300050493 Bacteria 1982
195 Ga0500635_0000076 3300053080 Bacteria 63630
196 Ga0500651_0027311 3300053093 Bacteria 3589
197 Ga0500559_0000027 3300053136 Bacteria 118758
198 Ga0500604_0014398 3300053151 Bacteria 2154
199 Ga0466962_0014575 3300061719 Bacteria 3788
200 Ga0466962_0061185 3300061719 Bacteria 1797

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037471 Ga0395905_0272210 Ga0395905_0272210_336_1205 245
2 3300005539 Ga0068853_100179104 Ga0068853_1001791042 246
3 3300005548 Ga0070665_100663748 Ga0070665_1006637482 246
4 3300005616 Ga0068852_100201896 Ga0068852_1002018962 246
5 3300009093 Ga0105240_10095807 Ga0105240_100958074 246
6 3300009174 Ga0105241_10304472 Ga0105241_103044721 246
7 3300009545 Ga0105237_10003554 Ga0105237_1000355411 246
8 3300009551 Ga0105238_10090977 Ga0105238_100909772 246
9 3300010375 Ga0105239_10002924 Ga0105239_1000292414 246
10 3300025911 Ga0207654_10110360 Ga0207654_101103601 246
11 3300025913 Ga0207695_10069020 Ga0207695_100690201 246
12 3300025914 Ga0207671_10012924 Ga0207671_100129244 246
13 3300025924 Ga0207694_10038248 Ga0207694_100382483 246
14 3300026121 Ga0207683_10030460 Ga0207683_100304603 247
15 3300031730 Ga0307516_10032019 Ga0307516_100320193 249
16 3300005459 Ga0068867_100000097 Ga0068867_1000000977 253
17 3300009148 Ga0105243_10000316 Ga0105243_100003163 253
18 3300014745 Ga0157377_10000006 Ga0157377_10000006282 253
19 3300025935 Ga0207709_10002544 Ga0207709_100025443 253
20 3300026089 Ga0207648_10000779 Ga0207648_100007799 253
21 3300042532 Ga0450893_0040254 Ga0450893_0040254_44_808 253
22 3300013297 Ga0157378_10475671 Ga0157378_104756712 258
23 3300026142 Ga0207698_10034174 Ga0207698_100341741 262
24 3300005457 Ga0070662_100008054 Ga0070662_1000080544 263
25 3300005339 Ga0070660_100020490 Ga0070660_1000204905 266
26 3300005344 Ga0070661_100024903 Ga0070661_1000249033 266
27 3300005366 Ga0070659_100008741 Ga0070659_1000087413 266
28 3300005564 Ga0070664_100071759 Ga0070664_1000717592 266
29 3300025292 Ga0209676_1005652 Ga0209676_10056524 266
30 3300025298 Ga0209050_1001310 Ga0209050_100131011 266
31 3300025919 Ga0207657_10011517 Ga0207657_100115175 266
32 3300025932 Ga0207690_10017352 Ga0207690_100173524 266
33 3300044658 Ga0466972_0001086 Ga0466972_0001086_2353_3219 266
34 3300044683 Ga0466965_0099072 Ga0466965_0099072_343_1209 266
35 3300006195 Ga0075366_10027302 Ga0075366_100273021 272
36 3300035691 Ga0373931_0047533 Ga0373931_0047533_1040_1858 272
37 3300042134 Ga0450898_003446 Ga0450898_003446_252_1082 275
38 3300021361 Ga0213872_10000077 Ga0213872_1000007750 277
39 3300039447 Ga0436361_1007413 Ga0436361_1007413_63000_63833 277
40 3300028794 Ga0307515_10018786 Ga0307515_1001878612 278
41 3300005367 Ga0070667_100001997 Ga0070667_1000019977 280
42 3300025986 Ga0207658_10011938 Ga0207658_100119387 280
43 3300031456 Ga0307513_10077425 Ga0307513_100774254 280
44 iso_pu_bacteria 2599185292 2599904407 280
45 iso_pu_bacteria 2643221569 2643863646 280
46 iso_pu_bacteria 2643221594 2643982848 280
47 iso_pu_bacteria 2643221621 2644123325 280
48 iso_pu_bacteria 2808606395 2809033438 280
49 iso_pu_bacteria 2857537821 2857538058 280
50 iso_pu_bacteria 2818991436 2819542036 281
51 iso_pu_bacteria 2842677519 2842682887 281
52 iso_pu_bacteria 2941479691 2941484306 281
53 iso_pu_bacteria 2858950400 2858951856 282
54 iso_pu_bacteria 2904449895 2904453464 282
55 iso_pu_bacteria 2904456579 2904459422 282
56 iso_pu_bacteria 2929520902 2929523107 282
57 iso_pu_bacteria 2945945610 2945948489 282
58 3300025297 Ga0209758_1000177 Ga0209758_100017792 284
59 3300027312 Ga0209371_1008954 Ga0209371_10089544 284
60 3300044712 Ga0453684_0041082 Ga0453684_0041082_1987_2847 284
61 3300044735 Ga0466968_0083197 Ga0466968_0083197_14_868 284
62 3300048920 Ga0496117_0025816 Ga0496117_0025816_2062_2916 284
63 3300048921 Ga0496118_0006774 Ga0496118_0006774_3581_4435 284
64 3300048922 Ga0496119_0036682 Ga0496119_0036682_1186_2040 284
65 3300003214 JGI25165J46597_1000373 JGI25165J46597_100037343 285
66 3300003751 Ga0055538_1000144 Ga0055538_100014443 285
67 3300003752 Ga0055539_1000195 Ga0055539_100019515 285
68 3300003756 Ga0055533_1000196 Ga0055533_100019643 285
69 3300003759 Ga0055525_1000263 Ga0055525_100026343 285
70 3300003841 Ga0055541_1000128 Ga0055541_100012815 285
71 3300005344 Ga0070661_100001113 Ga0070661_10000111315 285
72 3300005366 Ga0070659_100000400 Ga0070659_10000040011 285
73 3300005564 Ga0070664_100016748 Ga0070664_1000167485 285
74 3300006353 Ga0075370_10018441 Ga0075370_100184412 285
75 3300009036 Ga0105244_10045084 Ga0105244_100450842 285
76 3300015262 Ga0182007_10023867 Ga0182007_100238672 285
77 3300021361 Ga0213872_10000113 Ga0213872_1000011343 285
78 3300025224 Ga0209784_100010 Ga0209784_10001043 285
79 3300025225 Ga0209566_100008 Ga0209566_10000843 285
80 3300025226 Ga0209674_100019 Ga0209674_10001943 285
81 3300025230 Ga0209563_100021 Ga0209563_10002143 285
82 3300025233 Ga0209437_100019 Ga0209437_10001943 285
83 3300025253 Ga0209677_100011 Ga0209677_10001143 285
84 3300025261 Ga0209233_1000025 Ga0209233_100002543 285
85 3300025919 Ga0207657_10128574 Ga0207657_101285742 285
86 3300025920 Ga0207649_10000950 Ga0207649_1000095014 285
87 3300025932 Ga0207690_10082191 Ga0207690_100821912 285
88 3300025945 Ga0207679_10000088 Ga0207679_1000008868 285
89 3300025945 Ga0207679_10000265 Ga0207679_1000026532 285
90 3300030500 Ga0268256_1014687 Ga0268256_10146871 285
91 3300031344 Ga0265316_10147839 Ga0265316_101478392 285
92 3300031507 Ga0307509_10001002 Ga0307509_1000100238 285
93 3300031649 Ga0307514_10131356 Ga0307514_101313561 285
94 3300031911 Ga0307412_10000087 Ga0307412_1000008730 285
95 3300033180 Ga0307510_10004362 Ga0307510_100043628 285
96 3300039447 Ga0436361_0382853 Ga0436361_0382853_20351_21211 285
97 3300039447 Ga0436361_0912981 Ga0436361_0912981_332_1210 285
98 3300044693 Ga0466961_0121417 Ga0466961_0121417_518_1375 285
99 3300044719 Ga0466971_0035318 Ga0466971_0035318_866_1723 285
100 3300044842 Ga0466957_0035211 Ga0466957_0035211_956_1813 285
101 3300045049 Ga0466959_0002166 Ga0466959_0002166_10908_11765 285
102 3300046454 Ga0495592_0000441 Ga0495592_0000441_20043_20912 285
103 3300046675 Ga0495657_0097668 Ga0495657_0097668_932_1789 285
104 3300046680 Ga0495646_0075869 Ga0495646_0075869_708_1577 285
105 3300048919 Ga0496116_0005934 Ga0496116_0005934_4968_5825 285
106 3300048921 Ga0496118_0011539 Ga0496118_0011539_6489_7346 285
107 3300048922 Ga0496119_0016130 Ga0496119_0016130_4822_5679 285
108 3300048923 Ga0496120_0006491 Ga0496120_0006491_3415_4272 285
109 3300048924 Ga0496121_0000165 Ga0496121_0000165_22718_23575 285
110 3300048924 Ga0496121_0139575 Ga0496121_0139575_424_1281 285
111 3300048925 Ga0496122_0001028 Ga0496122_0001028_9090_9947 285
112 3300048925 Ga0496122_0116780 Ga0496122_0116780_252_1109 285
113 3300048926 Ga0496123_0000763 Ga0496123_0000763_32251_33108 285
114 3300048926 Ga0496123_0139648 Ga0496123_0139648_367_1224 285
115 3300048927 Ga0496124_0130769 Ga0496124_0130769_403_1260 285
116 3300048928 Ga0496125_0000121 Ga0496125_0000121_33172_34029 285
117 3300048929 Ga0496126_0072461 Ga0496126_0072461_414_1271 285
118 3300053080 Ga0500635_0000076 Ga0500635_0000076_14857_15714 285
119 3300053093 Ga0500651_0027311 Ga0500651_0027311_1289_2158 285
120 3300053136 Ga0500559_0000027 Ga0500559_0000027_41641_42510 285
121 3300053151 Ga0500604_0014398 Ga0500604_0014398_764_1633 285
122 3300061719 Ga0466962_0061185 Ga0466962_0061185_497_1354 285
123 3300002705 JGI25156J39149_1000042 JGI25156J39149_100004240 286
124 3300002705 JGI25156J39149_1017013 JGI25156J39149_10170132 286
125 3300002738 JGI25154J39366_1000978 JGI25154J39366_10009785 286
126 3300002741 JGI25157J39369_1000033 JGI25157J39369_100003335 286
127 3300003578 Ga0006562J51391_1136768 Ga0006562J51391_11367683 286
128 3300003752 Ga0055539_1000413 Ga0055539_10004139 286
129 3300003784 Ga0055534_1000210 Ga0055534_100021026 286
130 3300003790 Ga0055528_1001684 Ga0055528_10016841 286
131 3300003792 Ga0055540_1000375 Ga0055540_10003755 286
132 3300005339 Ga0070660_100169688 Ga0070660_1001696883 286
133 3300005539 Ga0068853_100049887 Ga0068853_1000498873 286
134 3300005563 Ga0068855_100216715 Ga0068855_1002167152 286
135 3300005577 Ga0068857_100000169 Ga0068857_10000016915 286
136 3300005578 Ga0068854_100086721 Ga0068854_1000867213 286
137 3300005616 Ga0068852_100112495 Ga0068852_1001124952 286
138 3300006048 Ga0075363_100106981 Ga0075363_1001069812 286
139 3300006051 Ga0075364_10072067 Ga0075364_100720672 286
140 3300006058 Ga0075432_10036179 Ga0075432_100361793 286
141 3300006177 Ga0075362_10000918 Ga0075362_100009187 286
142 3300006177 Ga0075362_10057723 Ga0075362_100577232 286
143 3300006186 Ga0075369_10096274 Ga0075369_100962742 286
144 3300006195 Ga0075366_10086448 Ga0075366_100864482 286
145 3300006948 Ga0099826_10018019 Ga0099826_100180192 286
146 3300006948 Ga0099826_10096839 Ga0099826_100968392 286
147 3300009093 Ga0105240_10021880 Ga0105240_100218809 286
148 3300009551 Ga0105238_10080001 Ga0105238_100800012 286
149 3300010375 Ga0105239_10072676 Ga0105239_100726765 286
150 3300013105 Ga0157369_10087540 Ga0157369_100875404 286
151 3300014497 Ga0182008_10006523 Ga0182008_100065238 286
152 3300025246 Ga0209646_1000089 Ga0209646_100008981 286
153 3300025250 Ga0209026_1000028 Ga0209026_1000028204 286
154 3300025253 Ga0209677_100066 Ga0209677_10006677 286
155 3300025256 Ga0209759_1000021 Ga0209759_100002181 286
156 3300025256 Ga0209759_1000458 Ga0209759_100045814 286
157 3300025263 Ga0209565_1000039 Ga0209565_1000039148 286
158 3300025273 Ga0209673_1000146 Ga0209673_1000146116 286
159 3300025273 Ga0209673_1002180 Ga0209673_100218011 286
160 3300025291 Ga0209675_1000030 Ga0209675_1000030148 286
161 3300025303 Ga0209051_1000271 Ga0209051_100027187 286
162 3300025913 Ga0207695_10002511 Ga0207695_1000251124 286
163 3300025949 Ga0207667_10379418 Ga0207667_103794181 286
164 3300025981 Ga0207640_10076076 Ga0207640_100760763 286
165 3300026078 Ga0207702_10000200 Ga0207702_1000020014 286
166 3300026116 Ga0207674_10001816 Ga0207674_1000181611 286
167 3300026142 Ga0207698_10489748 Ga0207698_104897482 286
168 3300027666 Ga0209282_1062584 Ga0209282_10625842 286
169 3300028794 Ga0307515_10000150 Ga0307515_10000150135 286
170 3300028794 Ga0307515_10002776 Ga0307515_1000277625 286
171 3300030731 Ga0316177_1004516 Ga0316177_10045165 286
172 3300030742 Ga0316183_1170720 Ga0316183_11707202 286
173 3300031548 Ga0307408_100036735 Ga0307408_1000367354 286
174 3300031731 Ga0307405_10015624 Ga0307405_100156242 286
175 3300031731 Ga0307405_10066778 Ga0307405_100667782 286
176 3300031901 Ga0307406_10300642 Ga0307406_103006422 286
177 3300031903 Ga0307407_10181378 Ga0307407_101813782 286
178 3300031911 Ga0307412_10005923 Ga0307412_100059238 286
179 3300035691 Ga0373931_0001086 Ga0373931_0001086_5192_6058 286
180 3300042125 Ga0450923_009291 Ga0450923_009291_212_1114 286
181 3300042146 Ga0450907_003213 Ga0450907_003213_1991_2893 286
182 3300042435 Ga0439434_0007077 Ga0439434_0007077_2027_2929 286
183 3300042531 Ga0450918_002379 Ga0450918_002379_1252_2154 286
184 3300044656 Ga0466969_0030878 Ga0466969_0030878_99_971 286
185 3300044683 Ga0466965_0007123 Ga0466965_0007123_3359_4231 286
186 3300044684 Ga0466966_0135749 Ga0466966_0135749_293_1165 286
187 3300044694 Ga0466963_0123729 Ga0466963_0123729_215_1087 286
188 3300044719 Ga0466971_0017000 Ga0466971_0017000_2070_2942 286
189 3300044735 Ga0466968_0112477 Ga0466968_0112477_204_1076 286
190 3300044765 Ga0466970_0006916 Ga0466970_0006916_1433_2305 286
191 3300044842 Ga0466957_0000486 Ga0466957_0000486_2275_3147 286
192 3300044842 Ga0466957_0020418 Ga0466957_0020418_1336_2208 286
193 3300045049 Ga0466959_0009584 Ga0466959_0009584_1046_1918 286
194 3300045836 Ga0466958_0000031 Ga0466958_0000031_27348_28217 286
195 3300045836 Ga0466958_0006720 Ga0466958_0006720_4917_5789 286
196 3300046463 Ga0495653_0251641 Ga0495653_0251641_50_919 286
197 3300046492 Ga0495585_0032351 Ga0495585_0032351_807_1673 286
198 3300046501 Ga0495607_0000021 Ga0495607_0000021_58345_59205 286
199 3300046511 Ga0495608_0043299 Ga0495608_0043299_125_994 286
200 3300046516 Ga0495628_0000580 Ga0495628_0000580_23795_24664 286
201 3300046529 Ga0495652_0006053 Ga0495652_0006053_6422_7291 286
202 3300046529 Ga0495652_0009031 Ga0495652_0009031_563_1432 286
203 3300046679 Ga0495623_0141350 Ga0495623_0141350_347_1216 286
204 3300046680 Ga0495646_0004339 Ga0495646_0004339_3869_4738 286
205 3300046690 Ga0495624_0030968 Ga0495624_0030968_1151_2020 286
206 3300048088 Ga0495602_0017309 Ga0495602_0017309_1957_2826 286
207 3300048912 Ga0496109_0077371 Ga0496109_0077371_1679_2542 286
208 3300048928 Ga0496125_0271693 Ga0496125_0271693_104_967 286
209 3300049705 Ga0501225_0012306 Ga0501225_0012306_1344_2207 286
210 3300050489 nmdc:mga03683_3400_c1 nmdc:mga03683_3400_c1_3120_3983 286
211 3300050490 nmdc:mga03n38_136735_c1 nmdc:mga03n38_136735_c1_281_1144 286
212 3300050491 nmdc:mga00v17_27131_c1 nmdc:mga00v17_27131_c1_1782_2645 286
213 3300050493 nmdc:mga0k408_27299_c1 nmdc:mga0k408_27299_c1_540_1403 286
214 3300061719 Ga0466962_0014575 Ga0466962_0014575_2465_3337 286

Structural Annotation

Top 5 Hits

ID Description Score Start End
1im5-assembly1.cif.gz_A crystal structure of pyrazinamidase of pyrococcus horikoshii in complex with zinc 0.8321 4 275
2wt9-assembly1.cif.gz_A acinetobacter baumanii nicotinamidase pyrazinamidease 0.8305 3 279
3hb7-assembly4.cif.gz_H the crystal structure of an isochorismatase-like hydrolase from alkaliphilus metalliredigens to 2.3a 0.8259 4 282
6kua-assembly1.cif.gz_B crystal structure of the nicotinamidase sapnca from staphylococcus aureus 0.8214 3 273
1im5-assembly1.cif.gz_A crystal structure of pyrazinamidase of pyrococcus horikoshii in complex with zinc 0.8191 4 275
ID Description Score Start End Superfamily
1im5A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Isochorismatase-like 0.8322 4 275 3.40.50.850
2wt9A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Isochorismatase-like 0.8305 3 279 3.40.50.850
af_P21369_4_203_3.40.50.850 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Isochorismatase-like 0.8222 6 274 3.40.50.850
3hb7H00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Isochorismatase-like 0.8216 4 282 3.40.50.850
1im5A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Isochorismatase-like 0.8193 4 275 3.40.50.850
ID Description Score Start End GO Terms
AF-A0A257K5Z8-F1-model_v4 Isochorismatase-like domain-containing protein 0.9858 133 278 GO:0016787
AF-A0A5C0AXA5-F1-model_v4 Cysteine hydrolase 0.9837 4 285 GO:0016787
AF-A0A658A355-F1-model_v4 deleted 0.9831 88 286
AF-A9BXF8-F1-model_v4 Cysteine hydrolase 0.9803 1 278 GO:0016787
AF-A0A846T4B1-F1-model_v4 Isochorismatase-like domain-containing protein 0.9793 4 278 GO:0016787

Feature Viewer

pLDDT pTM Quality
90.61 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map