F325067

General Info

Members Datasets Scaffolds Average Seq Length
214 176 428 275

Family's Representative Sequence

Representative Sequence 3300006177|Ga0075362_10135065|Ga0075362_101350652
Length 323
Sequence MKTRPTRQLFLQNHLNNRGPYYRLILCQVYDADKSSRYPTLQDKTPTTPPKPALTGDGITTNEDGKRFQFWDGIPDLFRSGNKSLPQPWQDIFGPLQRPGKGGMTVIGQIGQSLDGRIATPAGHSHYVNGDDGLAHLHRLRALVDAVVVGIGTVLADDPQLTVRRVNGPQPARVVIDPNRKLPHHARMLADDGVRRIIITDDATRPDLPQGLEMVPIRRVDGSIPPQAILDALSGLGFRRVLIEGGANTVSRFLSAGCLDRLHVVVAPIVIGSGPAGFSLAPIETMDQALRFPVRTHSLGPEVLFDCDLSAQRASGGSAKKST

Samples

Sample ID Description Type Environment
1 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
4 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
5 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
21 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
22 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
25 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
26 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
27 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
28 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
29 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
30 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
31 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
32 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
33 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
34 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
35 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
36 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
37 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
38 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
39 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
40 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
41 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
42 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
43 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
44 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
46 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
47 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
48 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
49 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
50 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
51 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
52 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
75 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
76 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
77 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
78 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
79 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
80 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
81 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
82 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
83 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
84 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
85 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
86 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
87 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
88 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
89 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
90 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
91 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
92 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
93 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
94 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
95 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
96 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
97 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
98 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
99 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
100 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
101 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
102 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
103 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
104 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
105 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
106 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
107 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
108 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
109 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
110 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
111 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
112 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
113 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
114 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
115 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
116 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
117 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
118 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
119 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
120 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
121 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
122 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
123 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
124 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
125 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
126 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
127 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
128 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
129 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
130 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
131 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
132 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
133 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
134 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
135 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
136 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
137 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
138 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
139 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
140 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
141 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
142 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
143 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
144 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
145 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
146 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
147 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
148 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
149 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
150 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
151 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
152 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
153 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
154 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
155 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
156 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
157 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
158 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
159 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
160 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
161 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
162 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
163 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
164 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
165 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
166 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
167 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
168 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
169 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
170 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
171 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
172 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
173 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
174 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
175 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
176 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.42
Nodule 0
Rhizoplane 7.48
Rhizosphere 76.17
Stem 0
Stem Tuber 0
Unclassified 7.01

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075362_10135065 3300006177 Bacteria 1176
2 JGI24746J21847_1000855 3300001977 Bacteria 4724
3 JGI24750J21931_1000308 3300002070 Bacteria 8403
4 JGI24750J21931_1004134 3300002070 Bacteria 1750
5 JGI24744J21845_10000303 3300002077 Bacteria 8270
6 JGI24742J22300_10000317 3300002244 Bacteria 7200
7 Ga0070670_100003906 3300005331 Bacteria 12433
8 Ga0070666_10004550 3300005335 Bacteria 8453
9 Ga0070682_100291961 3300005337 Bacteria 1193
10 Ga0070660_100184023 3300005339 Bacteria 1691
11 Ga0070689_100000563 3300005340 Bacteria 22227
12 Ga0070687_100084476 3300005343 Bacteria 1740
13 Ga0070692_10002752 3300005345 Bacteria 6918
14 Ga0070668_100009086 3300005347 Bacteria 7380
15 Ga0070713_100035709 3300005436 Bacteria 4004
16 Ga0070708_100004960 3300005445 Bacteria 10518
17 Ga0070662_100011560 3300005457 Bacteria 5825
18 Ga0070681_10153741 3300005458 Bacteria 2226
19 Ga0068867_100010873 3300005459 Bacteria 6419
20 Ga0070679_100172963 3300005530 Bacteria 2132
21 Ga0070697_100057257 3300005536 Bacteria 3172
22 Ga0070672_100605266 3300005543 Bacteria 955
23 Ga0070696_100003543 3300005546 Bacteria 10392
24 Ga0068855_100008997 3300005563 Bacteria 12064
25 Ga0070664_100011229 3300005564 Bacteria 7266
26 Ga0068864_100114845 3300005618 Bacteria 2401
27 Ga0068862_100440907 3300005844 Bacteria 1226
28 Ga0075368_10004516 3300006042 Bacteria 4727
29 Ga0075363_100100839 3300006048 Unclassified 1598
30 Ga0075364_10037602 3300006051 Bacteria 3135
31 Ga0075364_10052862 3300006051 Unclassified 2655
32 Ga0070712_100086006 3300006175 Bacteria 2290
33 Ga0075362_10226836 3300006177 Bacteria 914
34 Ga0075367_10007056 3300006178 Bacteria 5725
35 Ga0075367_10046719 3300006178 Bacteria 2545
36 Ga0075367_10077072 3300006178 Bacteria 2012
37 Ga0075367_10215416 3300006178 Bacteria 1201
38 Ga0075369_10075860 3300006186 Bacteria 1485
39 Ga0075366_10001051 3300006195 Bacteria 13531
40 Ga0075366_10001684 3300006195 Bacteria 11097
41 Ga0075370_10028682 3300006353 Bacteria 3095
42 Ga0075430_100034632 3300006846 Bacteria 4286
43 Ga0075431_100043911 3300006847 Bacteria 4610
44 Ga0075431_100078514 3300006847 Unclassified 3407
45 Ga0075431_100642385 3300006847 Bacteria 1042
46 Ga0075433_10014534 3300006852 Bacteria 6436
47 Ga0075434_100003752 3300006871 Bacteria 13572
48 Ga0075434_100023456 3300006871 Bacteria 6014
49 Ga0075429_100011760 3300006880 Bacteria 7592
50 Ga0075436_100001787 3300006914 Bacteria 14739
51 Ga0075435_100007792 3300007076 Bacteria 7658
52 Ga0099794_10047390 3300007265 Bacteria 2061
53 Ga0099795_10012916 3300007788 Bacteria 2547
54 Ga0114129_10007782 3300009147 Bacteria 15247
55 Ga0114129_10030916 3300009147 Bacteria 7573
56 Ga0114129_10063520 3300009147 Bacteria 5155
57 Ga0114129_10861253 3300009147 Unclassified 1151
58 Ga0105248_10013011 3300009177 Bacteria 9171
59 Ga0099796_10000799 3300010159 Bacteria 5699
60 Ga0157373_10108705 3300013100 Bacteria 1950
61 Ga0163163_10009124 3300014325 Bacteria 8839
62 Ga0157380_10284829 3300014326 Bacteria 1514
63 Ga0157376_10215280 3300014969 Bacteria 1776
64 Ga0163161_10013038 3300017792 Bacteria 5776
65 Ga0207680_10119530 3300025903 Bacteria 1721
66 Ga0207645_10091618 3300025907 Bacteria 1955
67 Ga0207707_10064650 3300025912 Bacteria 3185
68 Ga0207695_10271549 3300025913 Unclassified 1591
69 Ga0207693_10108725 3300025915 Bacteria 2175
70 Ga0207660_10076295 3300025917 Bacteria 2451
71 Ga0207660_10169211 3300025917 Bacteria 1690
72 Ga0207662_10022194 3300025918 Bacteria 3636
73 Ga0207657_10123343 3300025919 Bacteria 2130
74 Ga0207652_10176051 3300025921 Bacteria 1921
75 Ga0207659_10132332 3300025926 Bacteria 1927
76 Ga0207690_10172461 3300025932 Bacteria 1622
77 Ga0207706_10072385 3300025933 Bacteria 3032
78 Ga0207704_10013386 3300025938 Bacteria 4102
79 Ga0207665_10077247 3300025939 Bacteria 2285
80 Ga0207679_10026204 3300025945 Bacteria 4019
81 Ga0207667_10158320 3300025949 Unclassified 2330
82 Ga0207668_10029159 3300025972 Bacteria 3614
83 Ga0207676_10134365 3300026095 Bacteria 2108
84 Ga0207675_100010562 3300026118 Bacteria 8650
85 Ga0209179_1001590 3300027512 Bacteria 2836
86 Ga0268266_10153500 3300028379 Bacteria 2078
87 Ga0268265_10450794 3300028380 Bacteria 1202
88 Ga0265330_10164198 3300031235 Bacteria 942
89 Ga0265339_10050256 3300031249 Bacteria 2280
90 Ga0265331_10036762 3300031250 Bacteria 2402
91 Ga0307408_100214486 3300031548 Bacteria 1567
92 Ga0265314_10005765 3300031711 Bacteria 11114
93 Ga0265314_10021163 3300031711 Bacteria 5008
94 Ga0373938_0010914 3300034957 Bacteria 1680
95 Ga0373923_0009157 3300035111 Bacteria 3561
96 Ga0373936_0097455 3300035113 Unclassified 1238
97 Ga0373953_0000578 3300035117 Bacteria 10189
98 Ga0373954_0001627 3300035118 Bacteria 9195
99 Ga0373956_0001905 3300035119 Bacteria 8610
100 Ga0373955_0000175 3300035172 Bacteria 26347
101 Ga0373924_0000864 3300035410 Bacteria 9547
102 Ga0373927_0115622 3300035695 Bacteria 1749
103 Ga0373933_0016633 3300035724 Bacteria 4116
104 Ga0373937_0028847 3300036401 Bacteria 5024
105 Ga0373937_0068064 3300036401 Bacteria 3282
106 Ga0373925_0076731 3300037068 Bacteria 2535
107 Ga0395899_0004257 3300037312 Bacteria 11198
108 Ga0395900_0005595 3300037418 Bacteria 13146
109 Ga0395900_0095093 3300037418 Bacteria 3061
110 Ga0395900_0552829 3300037418 Unclassified 1095
111 Ga0395898_0009703 3300037466 Bacteria 10094
112 Ga0395898_0012794 3300037466 Bacteria 8663
113 Ga0395898_0036068 3300037466 Bacteria 4913
114 Ga0395905_0338724 3300037471 Unclassified 1395
115 Ga0395901_0017918 3300038443 Bacteria 7228
116 Ga0395901_0048083 3300038443 Bacteria 4430
117 Ga0395901_0057470 3300038443 Bacteria 4046
118 Ga0395901_0100244 3300038443 Bacteria 3038
119 Ga0395901_0332201 3300038443 Unclassified 1571
120 Ga0436361_1138266 3300039447 Bacteria 3619
121 Ga0451853_3324519 3300041512 Bacteria 1504
122 Ga0466958_0180756 3300045836 Bacteria 1338
123 Ga0495592_0001017 3300046454 Bacteria 19452
124 Ga0495629_0001205 3300046459 Bacteria 20378
125 Ga0495638_0071610 3300046460 Bacteria 2121
126 Ga0495651_0061892 3300046462 Bacteria 2864
127 Ga0495653_0008098 3300046463 Bacteria 8610
128 Ga0495608_0029551 3300046511 Bacteria 3716
129 Ga0495618_0116448 3300046514 Bacteria 1711
130 Ga0495628_0122438 3300046516 Bacteria 1994
131 Ga0495648_0189337 3300046524 Bacteria 1039
132 Ga0495652_0069220 3300046529 Bacteria 2954
133 Ga0495640_0014178 3300046533 Bacteria 6042
134 Ga0495587_0040850 3300046536 Bacteria 2769
135 Ga0495645_0060945 3300046543 Bacteria 2734
136 Ga0495667_0008233 3300046559 Bacteria 7073
137 Ga0495634_0006941 3300046642 Bacteria 8552
138 Ga0495635_0010668 3300046663 Bacteria 6431
139 Ga0495657_0010478 3300046675 Bacteria 6974
140 Ga0495599_0004983 3300046678 Bacteria 7898
141 Ga0495623_0022892 3300046679 Bacteria 4034
142 Ga0495646_0016189 3300046680 Bacteria 4733
143 Ga0495613_0002804 3300046689 Bacteria 13079
144 Ga0495600_0001368 3300046809 Bacteria 13443
145 Ga0495604_0017879 3300047317 Bacteria 5672
146 Ga0495674_0037184 3300047319 Bacteria 4375
147 Ga0495672_0116219 3300047320 Unclassified 1429
148 Ga0495676_0265679 3300047321 Bacteria 1166
149 Ga0495680_0022292 3300047322 Bacteria 5281
150 Ga0495675_0018960 3300047444 Bacteria 4369
151 Ga0495684_0000820 3300047471 Bacteria 25141
152 Ga0495593_0014421 3300047673 Bacteria 4493
153 Ga0495602_0090097 3300048088 Bacteria 2548
154 Ga0496100_0035775 3300048903 Bacteria 3126
155 Ga0496100_0106209 3300048903 Bacteria 1943
156 Ga0496100_0285152 3300048903 Bacteria 1232
157 Ga0496104_0012024 3300048907 Bacteria 7768
158 Ga0496105_0005829 3300048908 Bacteria 9395
159 Ga0496107_0027222 3300048910 Bacteria 4059
160 Ga0496108_0002007 3300048911 Bacteria 16311
161 Ga0496108_0065772 3300048911 Bacteria 3056
162 Ga0496108_0138353 3300048911 Bacteria 2097
163 Ga0496109_0010439 3300048912 Bacteria 7934
164 Ga0496109_0028801 3300048912 Bacteria 4971
165 Ga0496110_0012691 3300048913 Bacteria 6934
166 Ga0496110_0139377 3300048913 Bacteria 2192
167 Ga0496111_0000757 3300048914 Bacteria 17245
168 Ga0496114_0005590 3300048917 Bacteria 9855
169 Ga0496115_0009105 3300048918 Bacteria 7368
170 Ga0496126_0188905 3300048929 Bacteria 1746
171 Ga0501048_0137450 3300049582 Bacteria 1727
172 Ga0501072_0321933 3300049588 Unclassified 1229
173 Ga0501073_0067292 3300049589 Bacteria 2497
174 Ga0501076_0142906 3300049592 Bacteria 1945
175 Ga0501081_0074468 3300049743 Bacteria 2369
176 Ga0501083_0078771 3300049744 Bacteria 2185
177 Ga0501083_0094897 3300049744 Bacteria 1969
178 nmdc:mga03n38_84322_c1 3300050490 Bacteria 1500
179 nmdc:mga03n38_8477_c1 3300050490 Bacteria 3691
180 nmdc:mga0k408_24125_c1 3300050493 Bacteria 3436
181 nmdc:mga06z11_145005_c1 3300050494 Bacteria 1345
182 nmdc:mga04h51_67668_c1 3300050495 Bacteria 1239
183 nmdc:mga05p37_174473_c1 3300050507 Bacteria 2620
184 nmdc:mga05p37_308320_c1 3300050507 Bacteria 1877
185 nmdc:mga05p37_4064_c1 3300050507 Bacteria 17101
186 nmdc:mga05p37_49215_c1 3300050507 Bacteria 5184
187 nmdc:mga09592_37669_c1 3300050508 Bacteria 4057
188 nmdc:mga06r32_498886_c1 3300050510 Bacteria 1194
189 nmdc:mga06r32_616169_c1 3300050510 Bacteria 1055
190 nmdc:mga0n895_1026_c1 3300050512 Bacteria 20312
191 nmdc:mga0n895_47559_c1 3300050512 Bacteria 4195
192 nmdc:mga0rr50_9955_c1 3300050513 Bacteria 6010
193 nmdc:mga08x19_3242_c1 3300050514 Bacteria 9746
194 nmdc:mga0a205_17636_c1 3300050515 Bacteria 6700
195 Ga0495601_0079273 3300053077 Bacteria 2105
196 Ga0495595_0001498 3300053084 Bacteria 9126
197 Ga0495619_0039377 3300053085 Bacteria 3085
198 Ga0500566_0000003 3300053094 Bacteria 166820
199 Ga0500640_000016 3300053095 Bacteria 24966
200 Ga0500562_004600 3300053108 Bacteria 3485
201 Ga0500572_000125 3300053111 Bacteria 25716
202 Ga0500595_005762 3300053119 Bacteria 5359
203 Ga0500614_009087 3300053123 Bacteria 2116
204 Ga0500559_0001819 3300053136 Bacteria 11657
205 Ga0500568_0019489 3300053139 Bacteria 2947
206 Ga0500603_000029 3300053150 Bacteria 36423
207 Ga0500630_000051 3300053159 Bacteria 34539
208 Ga0500639_000042 3300053163 Bacteria 61423
209 Ga0500576_069301 3300053725 Unclassified 1520
210 Ga0500596_004562 3300053735 Bacteria 2527
211 Ga0500601_011525 3300053737 Unclassified 994
212 Ga0501084_0096575 3300054114 Bacteria 2481
213 Ga0501084_0271261 3300054114 Unclassified 1432
214 Ga0501082_0178637 3300060353 Bacteria 1846
215 Ga0075362_10135065
216 JGI24746J21847_1000855
217 JGI24750J21931_1000308
218 JGI24750J21931_1004134
219 JGI24744J21845_10000303
220 JGI24742J22300_10000317
221 Ga0070670_100003906
222 Ga0070666_10004550
223 Ga0070682_100291961
224 Ga0070660_100184023
225 Ga0070689_100000563
226 Ga0070687_100084476
227 Ga0070692_10002752
228 Ga0070668_100009086
229 Ga0070713_100035709
230 Ga0070708_100004960
231 Ga0070662_100011560
232 Ga0070681_10153741
233 Ga0068867_100010873
234 Ga0070679_100172963
235 Ga0070697_100057257
236 Ga0070672_100605266
237 Ga0070696_100003543
238 Ga0068855_100008997
239 Ga0070664_100011229
240 Ga0068864_100114845
241 Ga0068862_100440907
242 Ga0075368_10004516
243 Ga0075363_100100839
244 Ga0075364_10037602
245 Ga0075364_10052862
246 Ga0070712_100086006
247 Ga0075362_10226836
248 Ga0075367_10007056
249 Ga0075367_10046719
250 Ga0075367_10077072
251 Ga0075367_10215416
252 Ga0075369_10075860
253 Ga0075366_10001051
254 Ga0075366_10001684
255 Ga0075370_10028682
256 Ga0075430_100034632
257 Ga0075431_100043911
258 Ga0075431_100078514
259 Ga0075431_100642385
260 Ga0075433_10014534
261 Ga0075434_100003752
262 Ga0075434_100023456
263 Ga0075429_100011760
264 Ga0075436_100001787
265 Ga0075435_100007792
266 Ga0099794_10047390
267 Ga0099795_10012916
268 Ga0114129_10007782
269 Ga0114129_10030916
270 Ga0114129_10063520
271 Ga0114129_10861253
272 Ga0105248_10013011
273 Ga0099796_10000799
274 Ga0157373_10108705
275 Ga0163163_10009124
276 Ga0157380_10284829
277 Ga0157376_10215280
278 Ga0163161_10013038
279 Ga0207680_10119530
280 Ga0207645_10091618
281 Ga0207707_10064650
282 Ga0207695_10271549
283 Ga0207693_10108725
284 Ga0207660_10076295
285 Ga0207660_10169211
286 Ga0207662_10022194
287 Ga0207657_10123343
288 Ga0207652_10176051
289 Ga0207659_10132332
290 Ga0207690_10172461
291 Ga0207706_10072385
292 Ga0207704_10013386
293 Ga0207665_10077247
294 Ga0207679_10026204
295 Ga0207667_10158320
296 Ga0207668_10029159
297 Ga0207676_10134365
298 Ga0207675_100010562
299 Ga0209179_1001590
300 Ga0268266_10153500
301 Ga0268265_10450794
302 Ga0265330_10164198
303 Ga0265339_10050256
304 Ga0265331_10036762
305 Ga0307408_100214486
306 Ga0265314_10005765
307 Ga0265314_10021163
308 Ga0373938_0010914
309 Ga0373923_0009157
310 Ga0373936_0097455
311 Ga0373953_0000578
312 Ga0373954_0001627
313 Ga0373956_0001905
314 Ga0373955_0000175
315 Ga0373924_0000864
316 Ga0373927_0115622
317 Ga0373933_0016633
318 Ga0373937_0028847
319 Ga0373937_0068064
320 Ga0373925_0076731
321 Ga0395899_0004257
322 Ga0395900_0005595
323 Ga0395900_0095093
324 Ga0395900_0552829
325 Ga0395898_0009703
326 Ga0395898_0012794
327 Ga0395898_0036068
328 Ga0395905_0338724
329 Ga0395901_0017918
330 Ga0395901_0048083
331 Ga0395901_0057470
332 Ga0395901_0100244
333 Ga0395901_0332201
334 Ga0436361_1138266
335 Ga0451853_3324519
336 Ga0466958_0180756
337 Ga0495592_0001017
338 Ga0495629_0001205
339 Ga0495638_0071610
340 Ga0495651_0061892
341 Ga0495653_0008098
342 Ga0495608_0029551
343 Ga0495618_0116448
344 Ga0495628_0122438
345 Ga0495648_0189337
346 Ga0495652_0069220
347 Ga0495640_0014178
348 Ga0495587_0040850
349 Ga0495645_0060945
350 Ga0495667_0008233
351 Ga0495634_0006941
352 Ga0495635_0010668
353 Ga0495657_0010478
354 Ga0495599_0004983
355 Ga0495623_0022892
356 Ga0495646_0016189
357 Ga0495613_0002804
358 Ga0495600_0001368
359 Ga0495604_0017879
360 Ga0495674_0037184
361 Ga0495672_0116219
362 Ga0495676_0265679
363 Ga0495680_0022292
364 Ga0495675_0018960
365 Ga0495684_0000820
366 Ga0495593_0014421
367 Ga0495602_0090097
368 Ga0496100_0035775
369 Ga0496100_0106209
370 Ga0496100_0285152
371 Ga0496104_0012024
372 Ga0496105_0005829
373 Ga0496107_0027222
374 Ga0496108_0002007
375 Ga0496108_0065772
376 Ga0496108_0138353
377 Ga0496109_0010439
378 Ga0496109_0028801
379 Ga0496110_0012691
380 Ga0496110_0139377
381 Ga0496111_0000757
382 Ga0496114_0005590
383 Ga0496115_0009105
384 Ga0496126_0188905
385 Ga0501048_0137450
386 Ga0501072_0321933
387 Ga0501073_0067292
388 Ga0501076_0142906
389 Ga0501081_0074468
390 Ga0501083_0078771
391 Ga0501083_0094897
392 nmdc:mga03n38_84322_c1
393 nmdc:mga03n38_8477_c1
394 nmdc:mga0k408_24125_c1
395 nmdc:mga06z11_145005_c1
396 nmdc:mga04h51_67668_c1
397 nmdc:mga05p37_174473_c1
398 nmdc:mga05p37_308320_c1
399 nmdc:mga05p37_4064_c1
400 nmdc:mga05p37_49215_c1
401 nmdc:mga09592_37669_c1
402 nmdc:mga06r32_498886_c1
403 nmdc:mga06r32_616169_c1
404 nmdc:mga0n895_1026_c1
405 nmdc:mga0n895_47559_c1
406 nmdc:mga0rr50_9955_c1
407 nmdc:mga08x19_3242_c1
408 nmdc:mga0a205_17636_c1
409 Ga0495601_0079273
410 Ga0495595_0001498
411 Ga0495619_0039377
412 Ga0500566_0000003
413 Ga0500640_000016
414 Ga0500562_004600
415 Ga0500572_000125
416 Ga0500595_005762
417 Ga0500614_009087
418 Ga0500559_0001819
419 Ga0500568_0019489
420 Ga0500603_000029
421 Ga0500630_000051
422 Ga0500639_000042
423 Ga0500576_069301
424 Ga0500596_004562
425 Ga0500601_011525
426 Ga0501084_0096575
427 Ga0501084_0271261
428 Ga0501082_0178637

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01872

RibD_C

RibD C-terminal domain

104

305

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
8dqb-assembly1.cif.gz_A crystal structure of 3-dehydroquinate dehydratase i from klebsiella oxytoca (i23 form) 0.9033 87 291
8dq9-assembly1.cif.gz_B crystal structure of gdp bound 3-dehydroquinate dehydratase i from klebsiella oxytoca 0.9026 86 291
8dqc-assembly1.cif.gz_A crystal structure of 3-dehydroquinate dehydratase i from klebsiella oxytoca (i222 form) 0.8999 86 291
8dq9-assembly1.cif.gz_A crystal structure of gdp bound 3-dehydroquinate dehydratase i from klebsiella oxytoca 0.8804 86 290
6p8c-assembly1.cif.gz_B 2,5-diamino-6-(ribosylamino)-4(3h)-pyrimidinone 5'-phosphate reductase (mthred) from methanothermobacter thermautotrophicus 0.8741 86 290
ID Description Score Start End Superfamily
af_Q2FXF9_123_334_3.40.430.10 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.8985 86 290 3.40.430.10
af_P9WPH1_148_338_3.40.430.10 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.8825 86 290 3.40.430.10
af_Q9STY4_178_394_3.40.430.10 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.8659 86 289 3.40.430.10
2hxvA02 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.8629 87 290 3.40.430.10
af_Q2FXF9_123_334_3.40.430.10 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.8625 86 290 3.40.430.10
ID Description Score Start End GO Terms
AF-A0A6M9PU83-F1-model_v4 Riboflavin deaminase 0.961 86 299 GO:0008703
GO:0009231
AF-A0A6M9PU83-F1-model_v4 Riboflavin deaminase 0.9566 86 299 GO:0008703
GO:0009231
AF-A0A6N7GPT5-F1-model_v4 Riboflavin deaminase 0.9529 61 305 GO:0008703
GO:0009231
AF-A0A127EW13-F1-model_v4 Bifunctional deaminase-reductase domain-containing protein 0.9432 51 305 GO:0008703
GO:0009231
AF-A0A6N7GPT5-F1-model_v4 Riboflavin deaminase 0.9416 61 305 GO:0008703
GO:0009231

Map