F324997

General Info

Members Datasets Scaffolds Average Seq Length
214 152 428 139

Family's Representative Sequence

Representative Sequence 3300005563|Ga0068855_100577666|Ga0068855_1005776662
Length 144
Sequence MPDRRAQRLVVNAPCVIESIGQASMQLHPNLARVFRRVDADKSSVGTKFPAMIRDLSTNGAFVSGAPLPLLSRVAIKFELRGVGTVDAIGWVLWQRMDDCDVPGMSSHPSSLPKGFGVLFEAIPMETRAAIAALVSRSTPQGPA

Samples

Sample ID Description Type Environment
1 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
9 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
10 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
11 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
12 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
13 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
14 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
15 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
16 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
17 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
18 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
19 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
20 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
21 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
22 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
23 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
24 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
25 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
26 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
27 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
28 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
29 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
30 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
31 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
32 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
33 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
34 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
35 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
36 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
37 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
38 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
39 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
67 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
68 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
69 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
70 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
71 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
72 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
73 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
74 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
75 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
76 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
77 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
78 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
79 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
80 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
81 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
82 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
83 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
84 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
85 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
86 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
87 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
88 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
89 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
90 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
91 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
92 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
93 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
94 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
95 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
96 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
97 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
98 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
99 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
100 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
101 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
102 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
103 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
104 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
105 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
106 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
107 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
108 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
109 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
110 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
111 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
112 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
113 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
114 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
115 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
116 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
117 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
118 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
119 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
120 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
121 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
122 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
123 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
124 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
125 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
126 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
127 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
128 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
129 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
130 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
131 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
132 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
133 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
134 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
135 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
136 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
137 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
138 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
139 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
140 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
141 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
142 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
143 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
144 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
145 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
146 3300053144 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 endosphere Metagenome Endosphere
147 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
148 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
149 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
150 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
151 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
152 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.95
Nodule 0
Rhizoplane 1.4
Rhizosphere 75.7
Stem 0
Stem Tuber 0
Unclassified 17.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068855_100577666 3300005563 Bacteria 1214
2 Ga0070658_10064809 3300005327 Bacteria 2981
3 Ga0070658_10525392 3300005327 Bacteria 1023
4 Ga0070683_101087819 3300005329 Bacteria 768
5 Ga0070690_100009028 3300005330 Bacteria 5764
6 Ga0068869_100030316 3300005334 Bacteria 3796
7 Ga0068869_100144701 3300005334 Bacteria 1839
8 Ga0068868_100418540 3300005338 Unclassified 1160
9 Ga0070689_100020402 3300005340 Bacteria 4916
10 Ga0070688_100020894 3300005365 Bacteria 3815
11 Ga0070709_10736887 3300005434 Bacteria 769
12 Ga0070700_100690044 3300005441 Bacteria 811
13 Ga0070678_100054816 3300005456 Bacteria 2907
14 Ga0068867_101047549 3300005459 Bacteria 742
15 Ga0070685_10239331 3300005466 Bacteria 1197
16 Ga0070706_100034050 3300005467 Bacteria 4703
17 Ga0070707_101232522 3300005468 Bacteria 714
18 Ga0070679_100004999 3300005530 Bacteria 12233
19 Ga0070679_100366140 3300005530 Bacteria 1389
20 Ga0070679_101179834 3300005530 Unclassified 711
21 Ga0070684_100923260 3300005535 Unclassified 818
22 Ga0070684_100982575 3300005535 Bacteria 792
23 Ga0070665_100034073 3300005548 Bacteria 5121
24 Ga0070702_100761022 3300005615 Bacteria 745
25 Ga0068859_100554412 3300005617 Bacteria 1244
26 Ga0068864_101834150 3300005618 Unclassified 612
27 Ga0068861_100122805 3300005719 Bacteria 2097
28 Ga0068861_101721287 3300005719 Unclassified 620
29 Ga0068860_100023308 3300005843 Bacteria 5983
30 Ga0068860_100501373 3300005843 Bacteria 1212
31 Ga0081455_10184911 3300005937 Unclassified 1574
32 Ga0070717_10028398 3300006028 Bacteria 4478
33 Ga0070717_10588114 3300006028 Bacteria 1009
34 Ga0075362_10646134 3300006177 Unclassified 549
35 Ga0097621_101549529 3300006237 Bacteria 629
36 Ga0097621_102230043 3300006237 Bacteria 524
37 Ga0068871_100186519 3300006358 Bacteria 1785
38 Ga0068871_101009679 3300006358 Unclassified 775
39 Ga0068871_101079832 3300006358 Bacteria 750
40 Ga0068865_100998107 3300006881 Bacteria 733
41 Ga0097620_100554414 3300006931 Bacteria 1244
42 Ga0105245_10016845 3300009098 Bacteria 6381
43 Ga0105245_10215142 3300009098 Bacteria 1851
44 Ga0105242_10363663 3300009176 Bacteria 1340
45 Ga0105242_10407794 3300009176 Bacteria 1270
46 Ga0105242_12557954 3300009176 Bacteria 559
47 Ga0105249_10172804 3300009553 Bacteria 2097
48 Ga0105239_10602725 3300010375 Unclassified 1253
49 Ga0157374_10016147 3300013296 Bacteria 6562
50 Ga0157374_10463640 3300013296 Unclassified 1269
51 Ga0157378_10809778 3300013297 Unclassified 963
52 Ga0157378_12529356 3300013297 Unclassified 565
53 Ga0157378_12821445 3300013297 Unclassified 538
54 Ga0157379_11269960 3300014968 Bacteria 710
55 Ga0157376_10058277 3300014969 Bacteria 3234
56 Ga0157376_10621368 3300014969 Unclassified 1078
57 Ga0207692_10435327 3300025898 Bacteria 823
58 Ga0207643_10370395 3300025908 Bacteria 902
59 Ga0207684_10023826 3300025910 Bacteria 5224
60 Ga0207660_10337122 3300025917 Bacteria 1206
61 Ga0207662_10049367 3300025918 Bacteria 2496
62 Ga0207662_10072184 3300025918 Bacteria 2091
63 Ga0207652_10097587 3300025921 Bacteria 2590
64 Ga0207652_10422619 3300025921 Unclassified 1202
65 Ga0207652_10580162 3300025921 Bacteria 1006
66 Ga0207687_10027368 3300025927 Unclassified 3825
67 Ga0207687_10034866 3300025927 Bacteria 3420
68 Ga0207686_10598279 3300025934 Bacteria 868
69 Ga0207686_11484920 3300025934 Bacteria 559
70 Ga0207670_10010832 3300025936 Bacteria 5262
71 Ga0207670_10165936 3300025936 Bacteria 1652
72 Ga0207669_10102360 3300025937 Bacteria 1897
73 Ga0207704_10071093 3300025938 Unclassified 2207
74 Ga0207711_10885642 3300025941 Bacteria 830
75 Ga0207689_10008479 3300025942 Bacteria 8955
76 Ga0207689_10067167 3300025942 Bacteria 2947
77 Ga0207689_10075740 3300025942 Bacteria 2766
78 Ga0207661_10369467 3300025944 Bacteria 1297
79 Ga0207661_11082607 3300025944 Bacteria 738
80 Ga0207667_10310185 3300025949 Bacteria 1612
81 Ga0207668_11602165 3300025972 Bacteria 588
82 Ga0207677_10381492 3300026023 Bacteria 1190
83 Ga0207708_10084256 3300026075 Bacteria 2444
84 Ga0207702_11722517 3300026078 Bacteria 619
85 Ga0207641_10249548 3300026088 Unclassified 1657
86 Ga0207648_10953730 3300026089 Bacteria 802
87 Ga0207676_10250758 3300026095 Unclassified 1593
88 Ga0207675_100110800 3300026118 Bacteria 2590
89 Ga0207683_10095152 3300026121 Bacteria 2655
90 Ga0268266_10072343 3300028379 Bacteria 2989
91 Ga0268265_10172009 3300028380 Bacteria 1853
92 Ga0268264_10033754 3300028381 Bacteria 4207
93 Ga0268264_10623001 3300028381 Bacteria 1065
94 Ga0307517_10066479 3300028786 Bacteria 3316
95 Ga0307515_10072994 3300028794 Bacteria 4620
96 Ga0307515_10544957 3300028794 Bacteria 770
97 Ga0265332_10015118 3300031238 Bacteria 3410
98 Ga0307513_10036050 3300031456 Bacteria 5526
99 Ga0307513_10342341 3300031456 Bacteria 1245
100 Ga0307509_10000024 3300031507 Bacteria 237566
101 Ga0307509_10009331 3300031507 Bacteria 12300
102 Ga0307509_10078020 3300031507 Bacteria 3434
103 Ga0307509_10089185 3300031507 Bacteria 3163
104 Ga0307509_10320713 3300031507 Bacteria 1286
105 Ga0307508_10233300 3300031616 Bacteria 1438
106 Ga0307508_10563432 3300031616 Bacteria 738
107 Ga0307516_10026164 3300031730 Bacteria 5931
108 Ga0307516_10213640 3300031730 Bacteria 1641
109 Ga0307406_10031533 3300031901 Bacteria 3228
110 Ga0307406_10230298 3300031901 Bacteria 1383
111 Ga0307416_100356235 3300032002 Bacteria 1483
112 Ga0307415_100041338 3300032126 Bacteria 3061
113 Ga0307415_100284543 3300032126 Unclassified 1361
114 Ga0373949_0000430 3300035090 Bacteria 14542
115 Ga0373936_0000021 3300035113 Bacteria 142386
116 Ga0373941_0062432 3300035115 Unclassified 1216
117 Ga0373961_0000006 3300035241 Bacteria 146085
118 Ga0395899_0020488 3300037312 Bacteria 5012
119 Ga0395899_0040472 3300037312 Bacteria 3485
120 Ga0395900_0141888 3300037418 Bacteria 2459
121 Ga0395898_0108343 3300037466 Bacteria 2664
122 Ga0395905_0475818 3300037471 Bacteria 1148
123 Ga0395901_1928706 3300038443 Bacteria 538
124 Ga0436365_0861475 3300039437 Unclassified 788
125 Ga0436365_1396562 3300039437 Bacteria 2336
126 Ga0436363_1026119 3300039450 Bacteria 817
127 Ga0451787_029092 3300041441 Bacteria 806
128 Ga0451807_2481607 3300041486 Unclassified 967
129 Ga0466961_0802246 3300044693 Bacteria 562
130 Ga0466963_1011367 3300044694 Unclassified 585
131 Ga0495638_0130663 3300046460 Bacteria 1475
132 Ga0495650_0007496 3300046471 Bacteria 6544
133 Ga0495594_0561295 3300046499 Bacteria 648
134 Ga0495669_0632758 3300046684 Bacteria 520
135 Ga0495649_0094416 3300046694 Bacteria 1592
136 Ga0495686_0010843 3300047472 Bacteria 6457
137 Ga0495686_0031620 3300047472 Bacteria 3431
138 Ga0496110_1224123 3300048913 Bacteria 660
139 Ga0501291_092989 3300049514 Unclassified 618
140 Ga0501292_008811 3300049515 Unclassified 1484
141 Ga0501298_139588 3300049521 Unclassified 585
142 Ga0501032_0101466 3300049569 Bacteria 1907
143 Ga0501032_0292006 3300049569 Unclassified 1055
144 Ga0501034_0384627 3300049571 Bacteria 1328
145 Ga0501034_0477504 3300049571 Bacteria 1162
146 Ga0501034_0858111 3300049571 Bacteria 798
147 Ga0501038_1270081 3300049574 Bacteria 533
148 Ga0501043_0069813 3300049579 Bacteria 2760
149 Ga0501046_0114754 3300049580 Bacteria 2055
150 Ga0501047_0012172 3300049581 Bacteria 8143
151 Ga0501067_0162870 3300049583 Bacteria 1242
152 Ga0501068_0208559 3300049584 Bacteria 1240
153 Ga0501069_0058292 3300049585 Bacteria 2153
154 Ga0501070_0017572 3300049586 Bacteria 6003
155 Ga0501070_0142651 3300049586 Bacteria 1977
156 Ga0501070_0179927 3300049586 Bacteria 1740
157 Ga0501070_0229151 3300049586 Bacteria 1522
158 Ga0501070_0590376 3300049586 Bacteria 886
159 Ga0501071_0240781 3300049587 Bacteria 1364
160 Ga0501071_0481495 3300049587 Unclassified 951
161 Ga0501072_0144097 3300049588 Bacteria 1900
162 Ga0501072_1256128 3300049588 Bacteria 575
163 Ga0501073_0186675 3300049589 Bacteria 1435
164 Ga0501073_0397834 3300049589 Bacteria 952
165 Ga0501073_0614880 3300049589 Bacteria 750
166 Ga0501074_0701985 3300049590 Bacteria 714
167 Ga0501217_006247 3300049661 Bacteria 2523
168 Ga0501227_002481 3300049665 Bacteria 4069
169 Ga0501230_002817 3300049667 Bacteria 2244
170 Ga0501221_049176 3300049704 Bacteria 945
171 Ga0501229_002774 3300049706 Unclassified 2074
172 Ga0501079_0359356 3300049741 Bacteria 1141
173 Ga0501080_0349012 3300049742 Bacteria 1336
174 Ga0501080_0414471 3300049742 Bacteria 1211
175 Ga0501081_0407725 3300049743 Bacteria 1007
176 Ga0501083_0079994 3300049744 Bacteria 2167
177 Ga0501035_0179171 3300049822 Bacteria 1827
178 Ga0501035_0961631 3300049822 Bacteria 673
179 Ga0501044_0057387 3300049823 Bacteria 3995
180 nmdc:mga09592_990181_c1 3300050508 Bacteria 703
181 Ga0500635_0009859 3300053080 Bacteria 2664
182 Ga0495595_0226743 3300053084 Unclassified 933
183 Ga0495619_0581498 3300053085 Unclassified 767
184 Ga0500578_0613568 3300053086 Bacteria 596
185 Ga0500646_0039056 3300053090 Bacteria 1330
186 Ga0500647_0045643 3300053091 Bacteria 2105
187 Ga0500583_0138944 3300053092 Bacteria 1207
188 Ga0500566_0015516 3300053094 Bacteria 4471
189 Ga0500566_0018845 3300053094 Bacteria 4052
190 Ga0500566_0190863 3300053094 Bacteria 1043
191 Ga0500640_013638 3300053095 Bacteria 3367
192 Ga0500554_000173 3300053102 Bacteria 13352
193 Ga0500554_164189 3300053102 Bacteria 749
194 Ga0500572_040685 3300053111 Unclassified 1346
195 Ga0500595_000369 3300053119 Bacteria 29007
196 Ga0500597_008939 3300053120 Bacteria 3496
197 Ga0500597_415360 3300053120 Bacteria 508
198 Ga0500614_001559 3300053123 Bacteria 5422
199 Ga0500614_004277 3300053123 Bacteria 3030
200 Ga0500642_0321733 3300053130 Bacteria 693
201 Ga0500658_0195864 3300053134 Bacteria 923
202 Ga0500559_0023982 3300053136 Bacteria 2592
203 Ga0500559_0283283 3300053136 Bacteria 779
204 Ga0500564_063765 3300053138 Unclassified 1669
205 Ga0500568_0056272 3300053139 Bacteria 1533
206 Ga0500585_210503 3300053144 Bacteria 642
207 Ga0500590_213029 3300053148 Bacteria 805
208 Ga0500603_002028 3300053150 Bacteria 4486
209 Ga0500603_051715 3300053150 Unclassified 1126
210 Ga0500636_0155782 3300053177 Unclassified 1251
211 Ga0500637_0441663 3300053178 Bacteria 663
212 Ga0500637_0580118 3300053178 Unclassified 536
213 Ga0500576_139014 3300053725 Bacteria 927
214 Ga0501082_0019612 3300060353 Bacteria 5831
215 Ga0068855_100577666
216 Ga0070658_10064809
217 Ga0070658_10525392
218 Ga0070683_101087819
219 Ga0070690_100009028
220 Ga0068869_100030316
221 Ga0068869_100144701
222 Ga0068868_100418540
223 Ga0070689_100020402
224 Ga0070688_100020894
225 Ga0070709_10736887
226 Ga0070700_100690044
227 Ga0070678_100054816
228 Ga0068867_101047549
229 Ga0070685_10239331
230 Ga0070706_100034050
231 Ga0070707_101232522
232 Ga0070679_100004999
233 Ga0070679_100366140
234 Ga0070679_101179834
235 Ga0070684_100923260
236 Ga0070684_100982575
237 Ga0070665_100034073
238 Ga0070702_100761022
239 Ga0068859_100554412
240 Ga0068864_101834150
241 Ga0068861_100122805
242 Ga0068861_101721287
243 Ga0068860_100023308
244 Ga0068860_100501373
245 Ga0081455_10184911
246 Ga0070717_10028398
247 Ga0070717_10588114
248 Ga0075362_10646134
249 Ga0097621_101549529
250 Ga0097621_102230043
251 Ga0068871_100186519
252 Ga0068871_101009679
253 Ga0068871_101079832
254 Ga0068865_100998107
255 Ga0097620_100554414
256 Ga0105245_10016845
257 Ga0105245_10215142
258 Ga0105242_10363663
259 Ga0105242_10407794
260 Ga0105242_12557954
261 Ga0105249_10172804
262 Ga0105239_10602725
263 Ga0157374_10016147
264 Ga0157374_10463640
265 Ga0157378_10809778
266 Ga0157378_12529356
267 Ga0157378_12821445
268 Ga0157379_11269960
269 Ga0157376_10058277
270 Ga0157376_10621368
271 Ga0207692_10435327
272 Ga0207643_10370395
273 Ga0207684_10023826
274 Ga0207660_10337122
275 Ga0207662_10049367
276 Ga0207662_10072184
277 Ga0207652_10097587
278 Ga0207652_10422619
279 Ga0207652_10580162
280 Ga0207687_10027368
281 Ga0207687_10034866
282 Ga0207686_10598279
283 Ga0207686_11484920
284 Ga0207670_10010832
285 Ga0207670_10165936
286 Ga0207669_10102360
287 Ga0207704_10071093
288 Ga0207711_10885642
289 Ga0207689_10008479
290 Ga0207689_10067167
291 Ga0207689_10075740
292 Ga0207661_10369467
293 Ga0207661_11082607
294 Ga0207667_10310185
295 Ga0207668_11602165
296 Ga0207677_10381492
297 Ga0207708_10084256
298 Ga0207702_11722517
299 Ga0207641_10249548
300 Ga0207648_10953730
301 Ga0207676_10250758
302 Ga0207675_100110800
303 Ga0207683_10095152
304 Ga0268266_10072343
305 Ga0268265_10172009
306 Ga0268264_10033754
307 Ga0268264_10623001
308 Ga0307517_10066479
309 Ga0307515_10072994
310 Ga0307515_10544957
311 Ga0265332_10015118
312 Ga0307513_10036050
313 Ga0307513_10342341
314 Ga0307509_10000024
315 Ga0307509_10009331
316 Ga0307509_10078020
317 Ga0307509_10089185
318 Ga0307509_10320713
319 Ga0307508_10233300
320 Ga0307508_10563432
321 Ga0307516_10026164
322 Ga0307516_10213640
323 Ga0307406_10031533
324 Ga0307406_10230298
325 Ga0307416_100356235
326 Ga0307415_100041338
327 Ga0307415_100284543
328 Ga0373949_0000430
329 Ga0373936_0000021
330 Ga0373941_0062432
331 Ga0373961_0000006
332 Ga0395899_0020488
333 Ga0395899_0040472
334 Ga0395900_0141888
335 Ga0395898_0108343
336 Ga0395905_0475818
337 Ga0395901_1928706
338 Ga0436365_0861475
339 Ga0436365_1396562
340 Ga0436363_1026119
341 Ga0451787_029092
342 Ga0451807_2481607
343 Ga0466961_0802246
344 Ga0466963_1011367
345 Ga0495638_0130663
346 Ga0495650_0007496
347 Ga0495594_0561295
348 Ga0495669_0632758
349 Ga0495649_0094416
350 Ga0495686_0010843
351 Ga0495686_0031620
352 Ga0496110_1224123
353 Ga0501291_092989
354 Ga0501292_008811
355 Ga0501298_139588
356 Ga0501032_0101466
357 Ga0501032_0292006
358 Ga0501034_0384627
359 Ga0501034_0477504
360 Ga0501034_0858111
361 Ga0501038_1270081
362 Ga0501043_0069813
363 Ga0501046_0114754
364 Ga0501047_0012172
365 Ga0501067_0162870
366 Ga0501068_0208559
367 Ga0501069_0058292
368 Ga0501070_0017572
369 Ga0501070_0142651
370 Ga0501070_0179927
371 Ga0501070_0229151
372 Ga0501070_0590376
373 Ga0501071_0240781
374 Ga0501071_0481495
375 Ga0501072_0144097
376 Ga0501072_1256128
377 Ga0501073_0186675
378 Ga0501073_0397834
379 Ga0501073_0614880
380 Ga0501074_0701985
381 Ga0501217_006247
382 Ga0501227_002481
383 Ga0501230_002817
384 Ga0501221_049176
385 Ga0501229_002774
386 Ga0501079_0359356
387 Ga0501080_0349012
388 Ga0501080_0414471
389 Ga0501081_0407725
390 Ga0501083_0079994
391 Ga0501035_0179171
392 Ga0501035_0961631
393 Ga0501044_0057387
394 nmdc:mga09592_990181_c1
395 Ga0500635_0009859
396 Ga0495595_0226743
397 Ga0495619_0581498
398 Ga0500578_0613568
399 Ga0500646_0039056
400 Ga0500647_0045643
401 Ga0500583_0138944
402 Ga0500566_0015516
403 Ga0500566_0018845
404 Ga0500566_0190863
405 Ga0500640_013638
406 Ga0500554_000173
407 Ga0500554_164189
408 Ga0500572_040685
409 Ga0500595_000369
410 Ga0500597_008939
411 Ga0500597_415360
412 Ga0500614_001559
413 Ga0500614_004277
414 Ga0500642_0321733
415 Ga0500658_0195864
416 Ga0500559_0023982
417 Ga0500559_0283283
418 Ga0500564_063765
419 Ga0500568_0056272
420 Ga0500585_210503
421 Ga0500590_213029
422 Ga0500603_002028
423 Ga0500603_051715
424 Ga0500636_0155782
425 Ga0500637_0441663
426 Ga0500637_0580118
427 Ga0500576_139014
428 Ga0501082_0019612

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07238

PilZ

PilZ domain

2

137

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
5vx6-assembly2.cif.gz_B structure of bacillus subtilis inhibitor of motility (moti/dgra) 0.7389 4 138
5y4r-assembly1.cif.gz_D structure of a methyltransferase complex 0.7296 3 138
5vx6-assembly1.cif.gz_A structure of bacillus subtilis inhibitor of motility (moti/dgra) 0.7252 4 138
5y6f-assembly1.cif.gz_A crystal structure of ycgr in complex with c-di-gmp from escherichia coli 0.7 4 138
4rt1-assembly1.cif.gz_A structure of the alg44 pilz domain (r95a mutant) from pseudomonas aeruginosa pao1 in complex with c-di-gmp 0.6829 4 138
ID Description Score Start End Superfamily
5y4rC00 Mainly Beta;Beta Barrel;Thrombin, subunit H;predicted glycosyltransferase like domains 0.716 3 138 2.40.10.220
af_P76010_114_240_2.40.10.220 Mainly Beta;Beta Barrel;Thrombin, subunit H;predicted glycosyltransferase like domains 0.7017 5 138 2.40.10.220
af_P37653_690_796_2.40.10.220 Mainly Beta;Beta Barrel;Thrombin, subunit H;predicted glycosyltransferase like domains 0.6849 1 130 2.40.10.220
3kyfA02 Mainly Beta;Beta Barrel;Thrombin, subunit H;predicted glycosyltransferase like domains 0.6695 4 138 2.40.10.220
5kedC02 Mainly Beta;Beta Barrel;Thrombin, subunit H;predicted glycosyltransferase like domains 0.6599 1 138 2.40.10.220
ID Description Score Start End GO Terms
AF-A0A7W0QAG5-F1-model_v4 PilZ domain-containing protein 0.9412 1 139 GO:0035438
AF-A0A7W0QAG5-F1-model_v4 PilZ domain-containing protein 0.9346 1 139 GO:0035438
AF-A0A2N2IRV5-F1-model_v4 PilZ domain-containing protein 0.9191 15 139
AF-A0A7W0VCB7-F1-model_v4 PilZ domain-containing protein 0.9117 1 116
AF-A0A7W0VCB7-F1-model_v4 PilZ domain-containing protein 0.8969 1 116

Map