F324671

General Info

Members Datasets Scaffolds Average Seq Length
214 133 428 136

Family's Representative Sequence

Representative Sequence 3300000044|ARSoilOldRDRAFT_c010180|ARSoilOldRDRAFT_0101801
Length 151
Sequence MAKTSASRSTVQRRASAKARPAKAGKSDDGKLPVAVTTAVRAALDKKAEDVVVLDLRKAGGFTDHFVICTGGNARQITAIADAVRETLKRELQERPTLSEGVDKSEWILLDYFNFVVHIFSRECRTFYALERLWGAAQRHQFNEPEPQHAG

Samples

Sample ID Description Type Environment
1 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
8 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
13 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
14 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
15 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
18 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
19 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
20 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
21 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
22 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
23 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
24 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
25 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
26 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
27 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
28 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
29 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
30 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
31 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
32 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
33 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
34 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
35 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
37 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
38 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
39 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
40 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
41 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
42 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
43 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
44 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
46 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
48 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
49 3300012491 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.8.old.040610 Metagenome Rhizosphere
50 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
51 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
52 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
53 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
72 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
73 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
74 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
75 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
76 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
77 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
78 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
79 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
80 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
81 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
82 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
83 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
84 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
85 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
86 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
87 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
88 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
89 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
90 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
91 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
92 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
93 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
94 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
95 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
96 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
97 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
98 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
99 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
100 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
101 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
102 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
103 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
104 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
105 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
106 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
107 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
108 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
109 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
110 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
111 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
112 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
113 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
114 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
115 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
116 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
117 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
118 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
119 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
120 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
121 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
122 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
123 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
124 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
125 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
126 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
127 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
128 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
129 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
130 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
131 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
132 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
133 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 19.63
Nodule 0
Rhizoplane 7.94
Rhizosphere 71.96
Stem 0
Stem Tuber 0
Unclassified 23.36

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 ARSoilOldRDRAFT_c010180 3300000044 Unclassified 786
2 Ga0065712_10072381 3300005290 Bacteria 4776
3 Ga0065715_10021686 3300005293 Bacteria 1764
4 Ga0065707_10463950 3300005295 Unclassified 788
5 Ga0065707_11056271 3300005295 Unclassified 525
6 Ga0068869_100504913 3300005334 Bacteria 1010
7 Ga0068868_100361707 3300005338 Bacteria 1245
8 Ga0070687_100751556 3300005343 Bacteria 686
9 Ga0070669_100446530 3300005353 Unclassified 1065
10 Ga0070675_100503385 3300005354 Bacteria 1092
11 Ga0070671_100856156 3300005355 Bacteria 793
12 Ga0070674_100034244 3300005356 Bacteria 3390
13 Ga0070703_10269647 3300005406 Unclassified 698
14 Ga0070701_10205732 3300005438 Unclassified 1166
15 Ga0070694_100442206 3300005444 Bacteria 1025
16 Ga0070663_100451348 3300005455 Bacteria 1060
17 Ga0070678_100085583 3300005456 Bacteria 2403
18 Ga0070678_100732203 3300005456 Bacteria 893
19 Ga0070706_101565185 3300005467 Bacteria 602
20 Ga0070699_100450323 3300005518 Bacteria 1167
21 Ga0070672_100063480 3300005543 Bacteria 2917
22 Ga0070695_100362477 3300005545 Bacteria 1089
23 Ga0070696_100291337 3300005546 Unclassified 1247
24 Ga0070693_100095175 3300005547 Bacteria 1803
25 Ga0070664_100073700 3300005564 Bacteria 2930
26 Ga0068857_100376696 3300005577 Bacteria 1317
27 Ga0068854_100999846 3300005578 Bacteria 740
28 Ga0068861_101401751 3300005719 Unclassified 683
29 Ga0068858_100790308 3300005842 Bacteria 926
30 Ga0075365_10000951 3300006038 Bacteria 12285
31 Ga0075365_10087804 3300006038 Bacteria 2115
32 Ga0075368_10025260 3300006042 Bacteria 2279
33 Ga0075368_10507318 3300006042 Bacteria 539
34 Ga0075363_100011958 3300006048 Bacteria 4171
35 Ga0075364_10004582 3300006051 Bacteria 7960
36 Ga0075364_10005737 3300006051 Bacteria 7239
37 Ga0075364_10063833 3300006051 Bacteria 2418
38 Ga0075364_10296330 3300006051 Unclassified 1101
39 Ga0075362_10000489 3300006177 Bacteria 11538
40 Ga0075362_10772354 3300006177 Unclassified 504
41 Ga0075367_10004668 3300006178 Bacteria 6721
42 Ga0075367_10195714 3300006178 Bacteria 1262
43 Ga0075367_10905576 3300006178 Unclassified 562
44 Ga0075366_10012749 3300006195 Bacteria 4775
45 Ga0075366_10126822 3300006195 Bacteria 1539
46 Ga0097621_100139857 3300006237 Bacteria 2068
47 Ga0075370_10109584 3300006353 Bacteria 1602
48 Ga0075430_100033124 3300006846 Bacteria 4386
49 Ga0075430_100034774 3300006846 Bacteria 4277
50 Ga0075431_100008733 3300006847 Bacteria 10151
51 Ga0075431_100157380 3300006847 Bacteria 2337
52 Ga0075431_100901304 3300006847 Unclassified 854
53 Ga0075433_10001675 3300006852 Bacteria 16487
54 Ga0075433_10018553 3300006852 Bacteria 5786
55 Ga0075433_11007908 3300006852 Unclassified 725
56 Ga0075434_100004577 3300006871 Bacteria 12494
57 Ga0075434_100005218 3300006871 Bacteria 11802
58 Ga0075434_100006752 3300006871 Bacteria 10542
59 Ga0075429_100085831 3300006880 Unclassified 2743
60 Ga0075429_100086464 3300006880 Bacteria 2733
61 Ga0068865_100038983 3300006881 Bacteria 3220
62 Ga0075435_100010308 3300007076 Bacteria 6829
63 Ga0075435_100549195 3300007076 Unclassified 1000
64 Ga0111539_11640898 3300009094 Bacteria 746
65 Ga0111539_12052325 3300009094 Archaea 663
66 Ga0105245_11717470 3300009098 Unclassified 680
67 Ga0114129_10011087 3300009147 Bacteria 12841
68 Ga0114129_10136172 3300009147 Bacteria 3370
69 Ga0114129_12210988 3300009147 Unclassified 662
70 Ga0105243_10540475 3300009148 Bacteria 1111
71 Ga0105246_11404600 3300011119 Unclassified 651
72 Ga0157329_1014499 3300012491 Unclassified 670
73 Ga0163163_10504963 3300014325 Bacteria 1271
74 Ga0157380_10472412 3300014326 Bacteria 1210
75 Ga0157380_10899767 3300014326 Unclassified 911
76 Ga0157380_10985026 3300014326 Unclassified 875
77 Ga0157377_10576163 3300014745 Bacteria 799
78 Ga0207684_10790073 3300025910 Bacteria 803
79 Ga0207662_10692041 3300025918 Bacteria 714
80 Ga0207657_10141624 3300025919 Bacteria 1964
81 Ga0207681_10255615 3300025923 Unclassified 1370
82 Ga0207650_10004255 3300025925 Bacteria 9769
83 Ga0207709_10265595 3300025935 Bacteria 1260
84 Ga0207669_10037299 3300025937 Bacteria 2787
85 Ga0207704_10385906 3300025938 Bacteria 1101
86 Ga0207691_10241042 3300025940 Bacteria 1563
87 Ga0207691_10399121 3300025940 Bacteria 1173
88 Ga0207679_10030058 3300025945 Bacteria 3789
89 Ga0207668_10126849 3300025972 Unclassified 1942
90 Ga0207677_11329344 3300026023 Bacteria 661
91 Ga0207639_11096186 3300026041 Bacteria 747
92 Ga0207678_10472545 3300026067 Bacteria 1091
93 Ga0207678_10784214 3300026067 Unclassified 841
94 Ga0207708_10043708 3300026075 Bacteria 3414
95 Ga0207708_10438899 3300026075 Unclassified 1085
96 Ga0207674_10030225 3300026116 Bacteria 5697
97 Ga0207674_11036210 3300026116 Unclassified 790
98 Ga0207675_100947154 3300026118 Unclassified 878
99 Ga0207683_10750222 3300026121 Unclassified 905
100 Ga0209813_10028847 3300027866 Bacteria 1621
101 Ga0209813_10045523 3300027866 Bacteria 1352
102 Ga0209813_10052751 3300027866 Bacteria 1276
103 Ga0307408_100117088 3300031548 Unclassified 2057
104 Ga0307405_10289230 3300031731 Archaea 1238
105 Ga0307412_10590597 3300031911 Unclassified 939
106 Ga0307409_102126916 3300031995 Bacteria 591
107 Ga0307416_100146263 3300032002 Unclassified 2158
108 Ga0307416_100280020 3300032002 Bacteria 1644
109 Ga0307415_100030760 3300032126 Bacteria 3450
110 Ga0242420_079345 3300038996 Bacteria 676
111 Ga0436365_0372794 3300039437 Bacteria 2043
112 Ga0451807_2600604 3300041486 Unclassified 611
113 Ga0439431_0153756 3300041997 Unclassified 655
114 Ga0439451_037544 3300042009 Bacteria 973
115 Ga0451577_0076264 3300042876 Bacteria 2989
116 Ga0451577_0312195 3300042876 Bacteria 1425
117 Ga0453684_0159195 3300044712 Unclassified 2673
118 Ga0451576_0396807 3300045051 Bacteria 1446
119 Ga0451576_1760566 3300045051 Unclassified 641
120 Ga0451576_2367108 3300045051 Bacteria 544
121 Ga0495603_0415160 3300046455 Unclassified 771
122 Ga0495647_0104632 3300046681 Bacteria 1175
123 Ga0495684_0142497 3300047471 Bacteria 1797
124 Ga0496100_0079241 3300048903 Bacteria 2213
125 Ga0496101_0058339 3300048904 Bacteria 2795
126 Ga0496102_0302451 3300048905 Bacteria 1508
127 Ga0496102_0597639 3300048905 Bacteria 1026
128 Ga0496103_0326337 3300048906 Bacteria 987
129 Ga0496104_1126064 3300048907 Bacteria 688
130 Ga0496106_0126153 3300048909 Bacteria 2004
131 Ga0496106_0666738 3300048909 Bacteria 830
132 Ga0496107_0503512 3300048910 Bacteria 898
133 Ga0496108_0402168 3300048911 Unclassified 1196
134 Ga0496108_1151202 3300048911 Bacteria 657
135 Ga0496109_1022574 3300048912 Bacteria 764
136 Ga0496111_0421051 3300048914 Bacteria 986
137 Ga0496112_0136776 3300048915 Unclassified 2420
138 Ga0496112_0211328 3300048915 Bacteria 1897
139 Ga0496112_0767004 3300048915 Bacteria 890
140 Ga0501036_0076421 3300049572 Bacteria 2833
141 Ga0501040_0250608 3300049576 Bacteria 1263
142 Ga0501040_0300783 3300049576 Bacteria 1147
143 Ga0501040_0469505 3300049576 Bacteria 906
144 Ga0501041_0103295 3300049577 Bacteria 1765
145 Ga0501042_0813501 3300049578 Bacteria 680
146 Ga0501043_0338463 3300049579 Bacteria 1145
147 Ga0501048_0448516 3300049582 Bacteria 924
148 Ga0501048_0952449 3300049582 Bacteria 617
149 Ga0501067_0547891 3300049583 Bacteria 648
150 Ga0501069_0882514 3300049585 Bacteria 544
151 Ga0501070_0426344 3300049586 Bacteria 1071
152 Ga0501070_1387156 3300049586 Bacteria 534
153 Ga0501071_0072851 3300049587 Bacteria 2505
154 Ga0501071_0167810 3300049587 Bacteria 1643
155 Ga0501072_0042341 3300049588 Bacteria 3577
156 Ga0501072_0093286 3300049588 Bacteria 2391
157 Ga0501074_0213864 3300049590 Bacteria 1373
158 Ga0501075_0024470 3300049591 Bacteria 4429
159 Ga0501075_0025191 3300049591 Bacteria 4371
160 Ga0501075_0485348 3300049591 Unclassified 943
161 Ga0501075_1291131 3300049591 Bacteria 553
162 Ga0501076_0218466 3300049592 Bacteria 1558
163 Ga0501076_0418771 3300049592 Bacteria 1102
164 Ga0501080_0238320 3300049742 Bacteria 1661
165 Ga0501080_1261647 3300049742 Bacteria 634
166 Ga0501081_0051693 3300049743 Bacteria 2834
167 Ga0501081_0199976 3300049743 Bacteria 1449
168 Ga0501081_0353544 3300049743 Bacteria 1083
169 Ga0501081_0354750 3300049743 Bacteria 1081
170 Ga0501045_0035210 3300049824 Bacteria 3634
171 Ga0501045_0222492 3300049824 Bacteria 1405
172 nmdc:mga03683_3561_c1 3300050489 Bacteria 5046
173 nmdc:mga03683_691714_c1 3300050489 Unclassified 504
174 nmdc:mga03n38_17500_c1 3300050490 Bacteria 2808
175 nmdc:mga00v17_166950_c1 3300050491 Unclassified 1418
176 nmdc:mga00v17_28425_c1 3300050491 Bacteria 3275
177 nmdc:mga00v17_3738_c2 3300050491 Bacteria 4454
178 nmdc:mga00v17_46190_c1 3300050491 Bacteria 2634
179 nmdc:mga00v17_729965_c1 3300050491 Bacteria 634
180 nmdc:mga0yw44_1977_c1 3300050492 Bacteria 8496
181 nmdc:mga0yw44_308051_c1 3300050492 Bacteria 1062
182 nmdc:mga0yw44_58199_c1 3300050492 Bacteria 2360
183 nmdc:mga0k408_117395_c1 3300050493 Bacteria 1575
184 nmdc:mga0k408_168526_c1 3300050493 Bacteria 1305
185 nmdc:mga0k408_7377_c1 3300050493 Bacteria 5870
186 nmdc:mga0k408_8269_c1 3300050493 Bacteria 5581
187 nmdc:mga06z11_247100_c1 3300050494 Unclassified 1050
188 nmdc:mga06z11_42007_c1 3300050494 Bacteria 2291
189 nmdc:mga06z11_54799_c1 3300050494 Bacteria 2057
190 nmdc:mga04h51_15230_c1 3300050495 Bacteria 2212
191 nmdc:mga04h51_29463_c1 3300050495 Bacteria 1720
192 nmdc:mga07m45_156852_c1 3300050496 Bacteria 1321
193 nmdc:mga05p37_156704_c1 3300050507 Bacteria 2782
194 nmdc:mga05p37_46502_c1 3300050507 Bacteria 5336
195 nmdc:mga05p37_879365_c1 3300050507 Unclassified 969
196 nmdc:mga05p37_921876_c1 3300050507 Bacteria 939
197 nmdc:mga05p37_93925_c1 3300050507 Bacteria 3696
198 nmdc:mga09592_34681_c1 3300050508 Bacteria 4219
199 nmdc:mga09592_367295_c1 3300050508 Bacteria 1245
200 nmdc:mga0qj67_131673_c1 3300050509 Unclassified 2026
201 nmdc:mga0qj67_61456_c1 3300050509 Bacteria 2983
202 nmdc:mga06r32_904395_c1 3300050510 Unclassified 839
203 nmdc:mga08y16_410188_c1 3300050511 Unclassified 1385
204 nmdc:mga0n895_163044_c1 3300050512 Unclassified 2261
205 nmdc:mga0n895_20618_c1 3300050512 Bacteria 6151
206 nmdc:mga0n895_25746_c1 3300050512 Bacteria 5563
207 nmdc:mga0n895_88908_c2 3300050512 Unclassified 2189
208 nmdc:mga0rr50_60672_c1 3300050513 Bacteria 2846
209 nmdc:mga0rr50_613867_c1 3300050513 Unclassified 927
210 nmdc:mga0rr50_762399_c1 3300050513 Bacteria 826
211 nmdc:mga0a205_107877_c1 3300050515 Unclassified 2683
212 nmdc:mga0a205_492_c1 3300050515 Bacteria 30923
213 nmdc:mga0a205_986_c1 3300050515 Bacteria 23556
214 Ga0500556_0090137 3300053104 Bacteria 1170
215 ARSoilOldRDRAFT_c010180
216 Ga0065712_10072381
217 Ga0065715_10021686
218 Ga0065707_10463950
219 Ga0065707_11056271
220 Ga0068869_100504913
221 Ga0068868_100361707
222 Ga0070687_100751556
223 Ga0070669_100446530
224 Ga0070675_100503385
225 Ga0070671_100856156
226 Ga0070674_100034244
227 Ga0070703_10269647
228 Ga0070701_10205732
229 Ga0070694_100442206
230 Ga0070663_100451348
231 Ga0070678_100085583
232 Ga0070678_100732203
233 Ga0070706_101565185
234 Ga0070699_100450323
235 Ga0070672_100063480
236 Ga0070695_100362477
237 Ga0070696_100291337
238 Ga0070693_100095175
239 Ga0070664_100073700
240 Ga0068857_100376696
241 Ga0068854_100999846
242 Ga0068861_101401751
243 Ga0068858_100790308
244 Ga0075365_10000951
245 Ga0075365_10087804
246 Ga0075368_10025260
247 Ga0075368_10507318
248 Ga0075363_100011958
249 Ga0075364_10004582
250 Ga0075364_10005737
251 Ga0075364_10063833
252 Ga0075364_10296330
253 Ga0075362_10000489
254 Ga0075362_10772354
255 Ga0075367_10004668
256 Ga0075367_10195714
257 Ga0075367_10905576
258 Ga0075366_10012749
259 Ga0075366_10126822
260 Ga0097621_100139857
261 Ga0075370_10109584
262 Ga0075430_100033124
263 Ga0075430_100034774
264 Ga0075431_100008733
265 Ga0075431_100157380
266 Ga0075431_100901304
267 Ga0075433_10001675
268 Ga0075433_10018553
269 Ga0075433_11007908
270 Ga0075434_100004577
271 Ga0075434_100005218
272 Ga0075434_100006752
273 Ga0075429_100085831
274 Ga0075429_100086464
275 Ga0068865_100038983
276 Ga0075435_100010308
277 Ga0075435_100549195
278 Ga0111539_11640898
279 Ga0111539_12052325
280 Ga0105245_11717470
281 Ga0114129_10011087
282 Ga0114129_10136172
283 Ga0114129_12210988
284 Ga0105243_10540475
285 Ga0105246_11404600
286 Ga0157329_1014499
287 Ga0163163_10504963
288 Ga0157380_10472412
289 Ga0157380_10899767
290 Ga0157380_10985026
291 Ga0157377_10576163
292 Ga0207684_10790073
293 Ga0207662_10692041
294 Ga0207657_10141624
295 Ga0207681_10255615
296 Ga0207650_10004255
297 Ga0207709_10265595
298 Ga0207669_10037299
299 Ga0207704_10385906
300 Ga0207691_10241042
301 Ga0207691_10399121
302 Ga0207679_10030058
303 Ga0207668_10126849
304 Ga0207677_11329344
305 Ga0207639_11096186
306 Ga0207678_10472545
307 Ga0207678_10784214
308 Ga0207708_10043708
309 Ga0207708_10438899
310 Ga0207674_10030225
311 Ga0207674_11036210
312 Ga0207675_100947154
313 Ga0207683_10750222
314 Ga0209813_10028847
315 Ga0209813_10045523
316 Ga0209813_10052751
317 Ga0307408_100117088
318 Ga0307405_10289230
319 Ga0307412_10590597
320 Ga0307409_102126916
321 Ga0307416_100146263
322 Ga0307416_100280020
323 Ga0307415_100030760
324 Ga0242420_079345
325 Ga0436365_0372794
326 Ga0451807_2600604
327 Ga0439431_0153756
328 Ga0439451_037544
329 Ga0451577_0076264
330 Ga0451577_0312195
331 Ga0453684_0159195
332 Ga0451576_0396807
333 Ga0451576_1760566
334 Ga0451576_2367108
335 Ga0495603_0415160
336 Ga0495647_0104632
337 Ga0495684_0142497
338 Ga0496100_0079241
339 Ga0496101_0058339
340 Ga0496102_0302451
341 Ga0496102_0597639
342 Ga0496103_0326337
343 Ga0496104_1126064
344 Ga0496106_0126153
345 Ga0496106_0666738
346 Ga0496107_0503512
347 Ga0496108_0402168
348 Ga0496108_1151202
349 Ga0496109_1022574
350 Ga0496111_0421051
351 Ga0496112_0136776
352 Ga0496112_0211328
353 Ga0496112_0767004
354 Ga0501036_0076421
355 Ga0501040_0250608
356 Ga0501040_0300783
357 Ga0501040_0469505
358 Ga0501041_0103295
359 Ga0501042_0813501
360 Ga0501043_0338463
361 Ga0501048_0448516
362 Ga0501048_0952449
363 Ga0501067_0547891
364 Ga0501069_0882514
365 Ga0501070_0426344
366 Ga0501070_1387156
367 Ga0501071_0072851
368 Ga0501071_0167810
369 Ga0501072_0042341
370 Ga0501072_0093286
371 Ga0501074_0213864
372 Ga0501075_0024470
373 Ga0501075_0025191
374 Ga0501075_0485348
375 Ga0501075_1291131
376 Ga0501076_0218466
377 Ga0501076_0418771
378 Ga0501080_0238320
379 Ga0501080_1261647
380 Ga0501081_0051693
381 Ga0501081_0199976
382 Ga0501081_0353544
383 Ga0501081_0354750
384 Ga0501045_0035210
385 Ga0501045_0222492
386 nmdc:mga03683_3561_c1
387 nmdc:mga03683_691714_c1
388 nmdc:mga03n38_17500_c1
389 nmdc:mga00v17_166950_c1
390 nmdc:mga00v17_28425_c1
391 nmdc:mga00v17_3738_c2
392 nmdc:mga00v17_46190_c1
393 nmdc:mga00v17_729965_c1
394 nmdc:mga0yw44_1977_c1
395 nmdc:mga0yw44_308051_c1
396 nmdc:mga0yw44_58199_c1
397 nmdc:mga0k408_117395_c1
398 nmdc:mga0k408_168526_c1
399 nmdc:mga0k408_7377_c1
400 nmdc:mga0k408_8269_c1
401 nmdc:mga06z11_247100_c1
402 nmdc:mga06z11_42007_c1
403 nmdc:mga06z11_54799_c1
404 nmdc:mga04h51_15230_c1
405 nmdc:mga04h51_29463_c1
406 nmdc:mga07m45_156852_c1
407 nmdc:mga05p37_156704_c1
408 nmdc:mga05p37_46502_c1
409 nmdc:mga05p37_879365_c1
410 nmdc:mga05p37_921876_c1
411 nmdc:mga05p37_93925_c1
412 nmdc:mga09592_34681_c1
413 nmdc:mga09592_367295_c1
414 nmdc:mga0qj67_131673_c1
415 nmdc:mga0qj67_61456_c1
416 nmdc:mga06r32_904395_c1
417 nmdc:mga08y16_410188_c1
418 nmdc:mga0n895_163044_c1
419 nmdc:mga0n895_20618_c1
420 nmdc:mga0n895_25746_c1
421 nmdc:mga0n895_88908_c2
422 nmdc:mga0rr50_60672_c1
423 nmdc:mga0rr50_613867_c1
424 nmdc:mga0rr50_762399_c1
425 nmdc:mga0a205_107877_c1
426 nmdc:mga0a205_492_c1
427 nmdc:mga0a205_986_c1
428 Ga0500556_0090137

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02410

RsfS

Ribosomal silencing factor during starvation

37

134

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
6sj6-assembly1.cif.gz_9 cryo-em structure of 50s-rsfs complex from staphylococcus aureus 0.9033 36 142
4wcw-assembly1.cif.gz_B ribosomal silencing factor during starvation or stationary phase (rsfs) from mycobacterium tuberculosis 0.897 35 138
2o5a-assembly1.cif.gz_B crystal structure of q9kd89 from bacillus halodurans. northeast structural genomics target bhr21 0.8896 36 142
7bl5-assembly1.cif.gz_6 pre-50s-obge particle 0.8716 40 128
4wcw-assembly2.cif.gz_C ribosomal silencing factor during starvation or stationary phase (rsfs) from mycobacterium tuberculosis 0.8683 35 144
ID Description Score Start End Superfamily
2id1B01 Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2;Beta Polymerase, domain 2 0.9279 35 135 3.30.460.10
af_P0AAT6_2_105_3.30.460.10 Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2;Beta Polymerase, domain 2 0.9251 35 135 3.30.460.10
4wcwD01 Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2;Beta Polymerase, domain 2 0.9015 35 138 3.30.460.10
af_A0A0R0INC8_150_261_3.30.460.10 Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2;Beta Polymerase, domain 2 0.8966 35 144 3.30.460.10
2o5aB01 Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2;Beta Polymerase, domain 2 0.8958 36 134 3.30.460.10
ID Description Score Start End GO Terms
AF-A0A432K2I6-F1-model_v4 Ribosomal silencing factor RsfS 0.9718 35 143 GO:0005737
GO:0017148
GO:0042256
GO:0043023
GO:0090071
AF-A0A239G279-F1-model_v4 Ribosomal silencing factor RsfS 0.9704 35 143 GO:0005737
GO:0017148
GO:0042256
GO:0043023
GO:0090071
AF-A0A831L6W3-F1-model_v4 Ribosomal silencing factor RsfS 0.9684 31 142 GO:0005737
GO:0017148
GO:0042256
GO:0043023
GO:0090071
AF-A0A2A5XKF9-F1-model_v4 Ribosomal silencing factor RsfS 0.9674 35 143 GO:0005737
GO:0017148
GO:0042256
GO:0043023
GO:0090071
AF-A0A800F0Z8-F1-model_v4 Ribosomal silencing factor RsfS 0.967 35 144 GO:0005737
GO:0017148
GO:0042256
GO:0043023
GO:0090071

Map