F324592

General Info

Members Datasets Scaffolds Average Seq Length
213 152 426 98

Family's Representative Sequence

Representative Sequence 3300059421|Ga0590071_000088|Ga0590071_000088_5314_5640
Length 108
Sequence MIRVALPAHLRTLARVSDDVMLEVPAPVTLRSVLDALETRYPVLQGAIRDHVTHKRRPFIRFFACEQDLSHDAADTPLPAAVANGSEVFYIVGAIAGGENGGDGVNGN

Samples

Sample ID Description Type Environment
1 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
8 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
16 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
17 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
18 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
19 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
20 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
26 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
27 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
28 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
33 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
34 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
35 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
36 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
38 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
39 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
40 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
41 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
42 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
43 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
44 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
45 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
46 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
47 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
48 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
49 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
50 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
51 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
52 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
53 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
54 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
55 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
56 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
57 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
89 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
90 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
91 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
92 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
93 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
94 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
95 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
96 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
97 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
98 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
99 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
100 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
101 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
102 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
103 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
104 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
105 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
106 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
107 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
108 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
109 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
110 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
111 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
112 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
113 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
114 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
115 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
116 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
117 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
118 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
119 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
120 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
121 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
122 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
123 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
124 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
125 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
126 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
127 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
128 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
129 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
130 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
131 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
132 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
133 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
134 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
135 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
136 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
137 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
138 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
139 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
140 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
141 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
142 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
143 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
144 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
145 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
146 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
147 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
148 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
149 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
150 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
151 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
152 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 96.24
Stem 0
Stem Tuber 0
Unclassified 2.82

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0590071_000088 3300059421 Bacteria 25182
2 Ga0065707_10362025 3300005295 Unclassified 902
3 Ga0070658_10386097 3300005327 Bacteria 1202
4 Ga0070690_100784941 3300005330 Bacteria 738
5 Ga0070670_100253926 3300005331 Bacteria 1532
6 Ga0070680_100602226 3300005336 Bacteria 943
7 Ga0070680_101114578 3300005336 Bacteria 682
8 Ga0070669_100028562 3300005353 Bacteria 4017
9 Ga0070675_101932111 3300005354 Bacteria 544
10 Ga0070671_100000636 3300005355 Bacteria 25081
11 Ga0070671_100006680 3300005355 Bacteria 9222
12 Ga0070674_100056331 3300005356 Bacteria 2726
13 Ga0070673_100009000 3300005364 Bacteria 6681
14 Ga0070659_102165479 3300005366 Unclassified 500
15 Ga0070709_10047283 3300005434 Bacteria 2680
16 Ga0070713_100016796 3300005436 Bacteria 5512
17 Ga0070705_100983412 3300005440 Bacteria 684
18 Ga0070694_101594690 3300005444 Bacteria 554
19 Ga0070663_100202996 3300005455 Bacteria 1548
20 Ga0068867_101231749 3300005459 Unclassified 688
21 Ga0070706_100239512 3300005467 Bacteria 1694
22 Ga0070699_101689897 3300005518 Bacteria 580
23 Ga0070679_100880012 3300005530 Bacteria 839
24 Ga0070684_101679302 3300005535 Bacteria 599
25 Ga0070697_100504681 3300005536 Bacteria 1058
26 Ga0068853_101299692 3300005539 Bacteria 703
27 Ga0070672_101179913 3300005543 Bacteria 682
28 Ga0070695_100536894 3300005545 Bacteria 910
29 Ga0070696_100307067 3300005546 Bacteria 1217
30 Ga0070704_101203769 3300005549 Bacteria 691
31 Ga0068855_101624304 3300005563 Bacteria 661
32 Ga0070664_100008121 3300005564 Bacteria 8487
33 Ga0068856_100272041 3300005614 Bacteria 1710
34 Ga0068864_100044062 3300005618 Bacteria 3822
35 Ga0068851_10050526 3300005834 Bacteria 2111
36 Ga0068870_10248816 3300005840 Bacteria 1101
37 Ga0068858_100005594 3300005842 Bacteria 12291
38 Ga0097621_100170282 3300006237 Bacteria 1877
39 Ga0097621_100914586 3300006237 Bacteria 818
40 Ga0068871_100284624 3300006358 Bacteria 1447
41 Ga0075428_100024409 3300006844 Bacteria 6691
42 Ga0075431_100237736 3300006847 Bacteria 1854
43 Ga0075431_100357646 3300006847 Bacteria 1467
44 Ga0075431_101314110 3300006847 Bacteria 684
45 Ga0075434_100852338 3300006871 Bacteria 927
46 Ga0075435_100410877 3300007076 Bacteria 1165
47 Ga0075435_100869059 3300007076 Bacteria 786
48 Ga0105240_10003549 3300009093 Bacteria 24198
49 Ga0105240_10196439 3300009093 Bacteria 2368
50 Ga0105240_10319953 3300009093 Bacteria 1769
51 Ga0105243_10461517 3300009148 Bacteria 1194
52 Ga0105241_10088734 3300009174 Bacteria 2435
53 Ga0105241_10201722 3300009174 Bacteria 1662
54 Ga0105237_11842631 3300009545 Bacteria 613
55 Ga0105238_10006590 3300009551 Bacteria 11570
56 Ga0105238_10928084 3300009551 Bacteria 889
57 Ga0105246_11506637 3300011119 Bacteria 632
58 Ga0157370_10171250 3300013104 Bacteria 2018
59 Ga0157369_10287765 3300013105 Bacteria 1711
60 Ga0157372_12774767 3300013307 Bacteria 562
61 Ga0157375_12008959 3300013308 Bacteria 687
62 Ga0163163_10055975 3300014325 Bacteria 3898
63 Ga0163163_10800996 3300014325 Bacteria 1006
64 Ga0157377_10093411 3300014745 Bacteria 1780
65 Ga0157376_11041337 3300014969 Bacteria 842
66 Ga0213874_10164477 3300021377 Bacteria 781
67 Ga0213874_10378793 3300021377 Bacteria 547
68 Ga0213871_10003443 3300021441 Bacteria 3050
69 Ga0207656_10034276 3300025321 Bacteria 2119
70 Ga0207699_10020124 3300025906 Bacteria 3571
71 Ga0207705_10312718 3300025909 Bacteria 1206
72 Ga0207684_10722340 3300025910 Bacteria 845
73 Ga0207695_10025964 3300025913 Bacteria 6546
74 Ga0207695_10473909 3300025913 Bacteria 1134
75 Ga0207660_10814898 3300025917 Bacteria 762
76 Ga0207657_11074968 3300025919 Bacteria 615
77 Ga0207649_10220551 3300025920 Bacteria 1350
78 Ga0207652_10343809 3300025921 Bacteria 1347
79 Ga0207681_10017248 3300025923 Bacteria 4532
80 Ga0207681_10691000 3300025923 Bacteria 848
81 Ga0207694_10748278 3300025924 Bacteria 825
82 Ga0207650_10037820 3300025925 Bacteria 3520
83 Ga0207650_10323722 3300025925 Bacteria 1263
84 Ga0207650_11160441 3300025925 Bacteria 658
85 Ga0207659_10046629 3300025926 Bacteria 3062
86 Ga0207659_10156674 3300025926 Bacteria 1784
87 Ga0207700_10036339 3300025928 Bacteria 3556
88 Ga0207664_11194071 3300025929 Unclassified 679
89 Ga0207644_10003541 3300025931 Bacteria 10108
90 Ga0207644_11528950 3300025931 Bacteria 560
91 Ga0207706_10982976 3300025933 Bacteria 710
92 Ga0207709_10529824 3300025935 Bacteria 923
93 Ga0207669_10097772 3300025937 Bacteria 1931
94 Ga0207691_10946390 3300025940 Bacteria 720
95 Ga0207689_10279539 3300025942 Bacteria 1382
96 Ga0207679_10609838 3300025945 Bacteria 984
97 Ga0207679_12131648 3300025945 Bacteria 509
98 Ga0207667_11120778 3300025949 Bacteria 769
99 Ga0207651_10032772 3300025960 Bacteria 3342
100 Ga0207651_10095803 3300025960 Bacteria 2187
101 Ga0207677_11236021 3300026023 Bacteria 685
102 Ga0207703_10003930 3300026035 Bacteria 12330
103 Ga0207676_10035277 3300026095 Bacteria 3795
104 Ga0207676_11679116 3300026095 Bacteria 633
105 Ga0207675_100448565 3300026118 Bacteria 1278
106 Ga0207675_100750281 3300026118 Bacteria 987
107 Ga0207683_10131011 3300026121 Bacteria 2256
108 Ga0268265_11155282 3300028380 Bacteria 770
109 Ga0268264_10974743 3300028381 Bacteria 854
110 Ga0307408_100012353 3300031548 Bacteria 5654
111 Ga0307405_10419311 3300031731 Bacteria 1053
112 Ga0307410_10044694 3300031852 Bacteria 2944
113 Ga0307406_10168713 3300031901 Bacteria 1582
114 Ga0307416_100038666 3300032002 Bacteria 3683
115 Ga0307416_100854041 3300032002 Bacteria 1008
116 Ga0307414_10292984 3300032004 Bacteria 1373
117 Ga0307414_10763248 3300032004 Bacteria 880
118 Ga0307415_100349418 3300032126 Bacteria 1244
119 Ga0395899_0004058 3300037312 Bacteria 11545
120 Ga0395900_0013311 3300037418 Bacteria 8410
121 Ga0395898_0011068 3300037466 Bacteria 9395
122 Ga0395905_1108748 3300037471 Bacteria 695
123 Ga0436360_1100667 3300039438 Bacteria 1312
124 Ga0436363_0119618 3300039450 Bacteria 643
125 Ga0436363_0866405 3300039450 Bacteria 774
126 Ga0436363_1306871 3300039450 Bacteria 1868
127 Ga0436363_1521990 3300039450 Bacteria 532
128 Ga0436363_1605068 3300039450 Bacteria 1026
129 Ga0451853_2508972 3300041512 Bacteria 735
130 Ga0439431_0115857 3300041997 Bacteria 745
131 Ga0450893_0031054 3300042532 Bacteria 953
132 Ga0451577_0783467 3300042876 Bacteria 862
133 Ga0466967_0051950 3300045976 Bacteria 3595
134 Ga0466967_0917778 3300045976 Bacteria 871
135 Ga0466967_1218234 3300045976 Bacteria 750
136 Ga0495603_0725137 3300046455 Bacteria 568
137 Ga0495639_0761999 3300046475 Bacteria 501
138 Ga0495636_0295412 3300047318 Bacteria 757
139 Ga0501031_0180002 3300049568 Bacteria 1381
140 Ga0501031_0538613 3300049568 Unclassified 752
141 Ga0501032_0336733 3300049569 Bacteria 973
142 Ga0501033_0040685 3300049570 Bacteria 3470
143 Ga0501033_0090891 3300049570 Bacteria 2233
144 Ga0501034_0052405 3300049571 Bacteria 4110
145 Ga0501036_0040976 3300049572 Bacteria 3919
146 Ga0501037_0367468 3300049573 Bacteria 990
147 Ga0501037_0381214 3300049573 Bacteria 969
148 Ga0501038_0156056 3300049574 Bacteria 1858
149 Ga0501038_1260799 3300049574 Bacteria 535
150 Ga0501039_0293253 3300049575 Bacteria 1279
151 Ga0501040_0009508 3300049576 Bacteria 6339
152 Ga0501041_0001652 3300049577 Bacteria 12472
153 Ga0501042_0005358 3300049578 Bacteria 8250
154 Ga0501043_0022943 3300049579 Bacteria 4894
155 Ga0501043_0276538 3300049579 Bacteria 1288
156 Ga0501046_0029689 3300049580 Bacteria 4444
157 Ga0501046_1067868 3300049580 Bacteria 559
158 Ga0501047_0043435 3300049581 Bacteria 4342
159 Ga0501047_0098536 3300049581 Bacteria 2802
160 Ga0501048_0101406 3300049582 Bacteria 2031
161 Ga0501069_0573641 3300049585 Bacteria 676
162 Ga0501071_0015913 3300049587 Bacteria 5167
163 Ga0501071_0048260 3300049587 Bacteria 3061
164 Ga0501071_0661091 3300049587 Bacteria 804
165 Ga0501072_0082953 3300049588 Bacteria 2541
166 Ga0501073_0022772 3300049589 Bacteria 4507
167 Ga0501073_0550698 3300049589 Bacteria 797
168 Ga0501074_0095804 3300049590 Bacteria 2125
169 Ga0501074_0483446 3300049590 Bacteria 878
170 Ga0501075_0042559 3300049591 Bacteria 3405
171 Ga0501075_0447746 3300049591 Bacteria 985
172 Ga0501075_0550578 3300049591 Bacteria 880
173 Ga0501076_0008167 3300049592 Bacteria 7660
174 Ga0501076_0035138 3300049592 Bacteria 3921
175 Ga0501076_0378013 3300049592 Bacteria 1164
176 Ga0501076_0488898 3300049592 Bacteria 1014
177 Ga0501077_0060846 3300049593 Bacteria 2396
178 Ga0501077_0089783 3300049593 Bacteria 1947
179 Ga0501077_0323718 3300049593 Bacteria 983
180 Ga0501077_0332553 3300049593 Bacteria 969
181 Ga0501077_0498150 3300049593 Bacteria 781
182 Ga0501209_221640 3300049656 Bacteria 586
183 Ga0501257_066127 3300049686 Bacteria 919
184 Ga0501079_0075743 3300049741 Bacteria 2602
185 Ga0501079_0411123 3300049741 Bacteria 1061
186 Ga0501080_0014632 3300049742 Bacteria 7227
187 Ga0501080_0068470 3300049742 Bacteria 3302
188 Ga0501080_0792078 3300049742 Bacteria 832
189 Ga0501081_0000945 3300049743 Bacteria 17260
190 Ga0501081_0109940 3300049743 Bacteria 1956
191 Ga0501081_0413797 3300049743 Bacteria 999
192 Ga0501081_1362455 3300049743 Unclassified 538
193 Ga0501267_027856 3300049764 Bacteria 653
194 Ga0501272_004445 3300049769 Bacteria 1458
195 Ga0501035_0080199 3300049822 Bacteria 2882
196 Ga0501035_0254574 3300049822 Bacteria 1490
197 Ga0501044_0028967 3300049823 Bacteria 5841
198 Ga0501045_0001624 3300049824 Bacteria 15074
199 nmdc:mga09592_1745092_c1 3300050508 Bacteria 501
200 nmdc:mga06r32_313250_c1 3300050510 Bacteria 1555
201 nmdc:mga06r32_88204_c1 3300050510 Bacteria 3028
202 nmdc:mga08y16_891162_c1 3300050511 Bacteria 876
203 nmdc:mga0n895_361284_c1 3300050512 Bacteria 1470
204 nmdc:mga0n895_945645_c1 3300050512 Bacteria 845
205 nmdc:mga0rr50_361092_c1 3300050513 Bacteria 1222
206 nmdc:mga08x19_23569_c1 3300050514 Bacteria 3819
207 Ga0501084_0026568 3300054114 Bacteria 4832
208 Ga0501084_0065018 3300054114 Bacteria 3052
209 Ga0501084_1783129 3300054114 Bacteria 514
210 Ga0590074_035147 3300059423 Bacteria 892
211 Ga0590075_021973 3300059424 Bacteria 1594
212 Ga0501082_0003287 3300060353 Bacteria 14109
213 Ga0530510_0013827 3300061734 Bacteria 5683
214 Ga0590071_000088
215 Ga0065707_10362025
216 Ga0070658_10386097
217 Ga0070690_100784941
218 Ga0070670_100253926
219 Ga0070680_100602226
220 Ga0070680_101114578
221 Ga0070669_100028562
222 Ga0070675_101932111
223 Ga0070671_100000636
224 Ga0070671_100006680
225 Ga0070674_100056331
226 Ga0070673_100009000
227 Ga0070659_102165479
228 Ga0070709_10047283
229 Ga0070713_100016796
230 Ga0070705_100983412
231 Ga0070694_101594690
232 Ga0070663_100202996
233 Ga0068867_101231749
234 Ga0070706_100239512
235 Ga0070699_101689897
236 Ga0070679_100880012
237 Ga0070684_101679302
238 Ga0070697_100504681
239 Ga0068853_101299692
240 Ga0070672_101179913
241 Ga0070695_100536894
242 Ga0070696_100307067
243 Ga0070704_101203769
244 Ga0068855_101624304
245 Ga0070664_100008121
246 Ga0068856_100272041
247 Ga0068864_100044062
248 Ga0068851_10050526
249 Ga0068870_10248816
250 Ga0068858_100005594
251 Ga0097621_100170282
252 Ga0097621_100914586
253 Ga0068871_100284624
254 Ga0075428_100024409
255 Ga0075431_100237736
256 Ga0075431_100357646
257 Ga0075431_101314110
258 Ga0075434_100852338
259 Ga0075435_100410877
260 Ga0075435_100869059
261 Ga0105240_10003549
262 Ga0105240_10196439
263 Ga0105240_10319953
264 Ga0105243_10461517
265 Ga0105241_10088734
266 Ga0105241_10201722
267 Ga0105237_11842631
268 Ga0105238_10006590
269 Ga0105238_10928084
270 Ga0105246_11506637
271 Ga0157370_10171250
272 Ga0157369_10287765
273 Ga0157372_12774767
274 Ga0157375_12008959
275 Ga0163163_10055975
276 Ga0163163_10800996
277 Ga0157377_10093411
278 Ga0157376_11041337
279 Ga0213874_10164477
280 Ga0213874_10378793
281 Ga0213871_10003443
282 Ga0207656_10034276
283 Ga0207699_10020124
284 Ga0207705_10312718
285 Ga0207684_10722340
286 Ga0207695_10025964
287 Ga0207695_10473909
288 Ga0207660_10814898
289 Ga0207657_11074968
290 Ga0207649_10220551
291 Ga0207652_10343809
292 Ga0207681_10017248
293 Ga0207681_10691000
294 Ga0207694_10748278
295 Ga0207650_10037820
296 Ga0207650_10323722
297 Ga0207650_11160441
298 Ga0207659_10046629
299 Ga0207659_10156674
300 Ga0207700_10036339
301 Ga0207664_11194071
302 Ga0207644_10003541
303 Ga0207644_11528950
304 Ga0207706_10982976
305 Ga0207709_10529824
306 Ga0207669_10097772
307 Ga0207691_10946390
308 Ga0207689_10279539
309 Ga0207679_10609838
310 Ga0207679_12131648
311 Ga0207667_11120778
312 Ga0207651_10032772
313 Ga0207651_10095803
314 Ga0207677_11236021
315 Ga0207703_10003930
316 Ga0207676_10035277
317 Ga0207676_11679116
318 Ga0207675_100448565
319 Ga0207675_100750281
320 Ga0207683_10131011
321 Ga0268265_11155282
322 Ga0268264_10974743
323 Ga0307408_100012353
324 Ga0307405_10419311
325 Ga0307410_10044694
326 Ga0307406_10168713
327 Ga0307416_100038666
328 Ga0307416_100854041
329 Ga0307414_10292984
330 Ga0307414_10763248
331 Ga0307415_100349418
332 Ga0395899_0004058
333 Ga0395900_0013311
334 Ga0395898_0011068
335 Ga0395905_1108748
336 Ga0436360_1100667
337 Ga0436363_0119618
338 Ga0436363_0866405
339 Ga0436363_1306871
340 Ga0436363_1521990
341 Ga0436363_1605068
342 Ga0451853_2508972
343 Ga0439431_0115857
344 Ga0450893_0031054
345 Ga0451577_0783467
346 Ga0466967_0051950
347 Ga0466967_0917778
348 Ga0466967_1218234
349 Ga0495603_0725137
350 Ga0495639_0761999
351 Ga0495636_0295412
352 Ga0501031_0180002
353 Ga0501031_0538613
354 Ga0501032_0336733
355 Ga0501033_0040685
356 Ga0501033_0090891
357 Ga0501034_0052405
358 Ga0501036_0040976
359 Ga0501037_0367468
360 Ga0501037_0381214
361 Ga0501038_0156056
362 Ga0501038_1260799
363 Ga0501039_0293253
364 Ga0501040_0009508
365 Ga0501041_0001652
366 Ga0501042_0005358
367 Ga0501043_0022943
368 Ga0501043_0276538
369 Ga0501046_0029689
370 Ga0501046_1067868
371 Ga0501047_0043435
372 Ga0501047_0098536
373 Ga0501048_0101406
374 Ga0501069_0573641
375 Ga0501071_0015913
376 Ga0501071_0048260
377 Ga0501071_0661091
378 Ga0501072_0082953
379 Ga0501073_0022772
380 Ga0501073_0550698
381 Ga0501074_0095804
382 Ga0501074_0483446
383 Ga0501075_0042559
384 Ga0501075_0447746
385 Ga0501075_0550578
386 Ga0501076_0008167
387 Ga0501076_0035138
388 Ga0501076_0378013
389 Ga0501076_0488898
390 Ga0501077_0060846
391 Ga0501077_0089783
392 Ga0501077_0323718
393 Ga0501077_0332553
394 Ga0501077_0498150
395 Ga0501209_221640
396 Ga0501257_066127
397 Ga0501079_0075743
398 Ga0501079_0411123
399 Ga0501080_0014632
400 Ga0501080_0068470
401 Ga0501080_0792078
402 Ga0501081_0000945
403 Ga0501081_0109940
404 Ga0501081_0413797
405 Ga0501081_1362455
406 Ga0501267_027856
407 Ga0501272_004445
408 Ga0501035_0080199
409 Ga0501035_0254574
410 Ga0501044_0028967
411 Ga0501045_0001624
412 nmdc:mga09592_1745092_c1
413 nmdc:mga06r32_313250_c1
414 nmdc:mga06r32_88204_c1
415 nmdc:mga08y16_891162_c1
416 nmdc:mga0n895_361284_c1
417 nmdc:mga0n895_945645_c1
418 nmdc:mga0rr50_361092_c1
419 nmdc:mga08x19_23569_c1
420 Ga0501084_0026568
421 Ga0501084_0065018
422 Ga0501084_1783129
423 Ga0590074_035147
424 Ga0590075_021973
425 Ga0501082_0003287
426 Ga0530510_0013827

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
3po0-assembly1.cif.gz_A crystal structure of samp1 from haloferax volcanii 0.8453 3 98
1v8c-assembly3.cif.gz_B crystal structure of moad related protein from thermus thermophilus hb8 0.8177 3 93
1v8c-assembly1.cif.gz_A crystal structure of moad related protein from thermus thermophilus hb8 0.8163 3 98
3po0-assembly1.cif.gz_A crystal structure of samp1 from haloferax volcanii 0.8119 3 98
4n6e-assembly1.cif.gz_B-2 crystal structure of amycolatopsis orientalis bexx/cyso complex 0.8001 1 98
ID Description Score Start End Superfamily
af_Q54NM8_4_86_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8454 1 98 3.10.20.30
af_Q54NM8_4_86_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8364 1 98 3.10.20.30
1v8cB01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8166 3 94 3.10.20.30
af_Q6MWY3_4_79_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8113 2 95 3.10.20.30
af_Q6MWY3_4_79_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8024 2 95 3.10.20.30
ID Description Score Start End GO Terms
AF-A0A7V9SE48-F1-model_v4 MoaD/ThiS family protein 0.9927 2 98
AF-A0A3N5LTQ9-F1-model_v4 MoaD/ThiS family protein 0.9908 19 98
AF-A0A1F8SIJ2-F1-model_v4 Molybdopterin synthase sulfur carrier subunit 0.9862 1 94
AF-H8G793-F1-model_v4 MoaD/ThiS family protein 0.9811 1 98
AF-A0A535NE45-F1-model_v4 MoaD/ThiS family protein 0.9794 1 46

Map