F324321

General Info

Members Datasets Scaffolds Average Seq Length
213 162 201 261

Family's Representative Sequence

Representative Sequence 3300042876|Ga0451577_0001634|Ga0451577_0001634_6446_7300
Length 284
Sequence MSLPNRPSGXXXXVAANPPYRLPPRLFDARCKACWFSAGLLALIVASFWSLDLQWAQFFSLDAARSMGRFLGEFFPPDTSPEFMARVLRGTWETLAMSALGTALAAAAGLVLALPASRLHEGDAARGRSATRLLLNALRSVPELVWAALLLIAAGLGPFAGTLALAIHTAGVLGRLFAEAIENAPPGPGDALRAQGVGPVRVFLYATLPQVLPQLMSYTLYRWENNIRAAAVLGVVGAGGLGQLLQFHMGLFHMGKTATLLGAMIVLVLLVDACSFTARRLLTR

Samples

Sample ID Description Type Environment
1 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
2 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
3 2643221544 Pelomonas sp. Root1444 Isolate Unclassified
4 2643221585 Pelomonas sp. Root662 Isolate Unclassified
5 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
6 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
7 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
8 2643221656 Pelomonas sp. Root405 Isolate Unclassified
9 2643221660 Methylibium sp. Root1272 Isolate Unclassified
10 2904456579 Variovorax sp. 2002 Isolate Unclassified
11 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
12 2929520902 Variovorax beijingensis 502 Isolate Unclassified
13 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
14 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
15 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
16 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
17 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
18 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
19 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
20 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
21 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
22 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
23 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
24 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
43 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
44 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
45 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
46 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
47 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
48 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
49 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
50 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
51 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
52 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
53 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
54 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
55 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
56 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
57 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
58 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
59 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
60 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
61 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
92 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
93 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
94 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
95 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
96 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
97 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
98 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
99 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
100 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
101 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
102 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
103 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
104 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
105 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
106 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
107 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
108 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
109 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
110 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
111 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
112 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
113 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
114 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
115 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
116 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
117 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
118 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
119 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
120 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
121 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
122 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
123 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
124 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
125 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
126 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
127 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
128 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
129 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
130 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
131 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
132 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
133 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
134 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
135 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
136 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
137 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
138 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
139 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
140 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
141 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
142 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
143 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
144 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
145 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
146 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
147 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
148 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
149 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
150 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
151 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
152 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
153 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
154 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
155 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
156 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
157 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
158 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
159 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
160 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
161 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
162 8055225921 Achromobacter panacis KCTC 42751 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.08
Metatranscriptomes 2.82
Isolates 6.1

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.8
Nodule 0
Rhizoplane 0.94
Rhizosphere 73.71
Stem 0
Stem Tuber 0
Unclassified 14.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25153J46596_10008886 3300003215 Bacteria 4743
2 rootH1_10006074 3300003316 Bacteria 8306
3 rootH1_10006074 3300003323 Bacteria 17704
4 rootL2_10016963 3300003322 Bacteria 10134
5 rootL2_10029268 3300003322 Bacteria 8073
6 rootH1_10011999 3300003323 Bacteria 12337
7 Ga0006562J51391_1119545 3300003578 Bacteria 6600
8 Ga0006562J51391_1119546 3300003578 Bacteria 2540
9 Ga0055540_1000462 3300003792 Bacteria 31651
10 Ga0065165_1002045 3300005262 Bacteria 18698
11 Ga0070676_10002900 3300005328 Bacteria 8856
12 Ga0070676_10269471 3300005328 Bacteria 1143
13 Ga0070670_100251681 3300005331 Bacteria 1539
14 Ga0070670_100308182 3300005331 Bacteria 1386
15 Ga0068869_100171535 3300005334 Bacteria 1695
16 Ga0068868_100059827 3300005338 Bacteria 3014
17 Ga0070660_100009229 3300005339 Bacteria 6930
18 Ga0070669_100224386 3300005353 Bacteria 1487
19 Ga0070673_100003978 3300005364 Bacteria 9298
20 Ga0070673_100024601 3300005364 Bacteria 4419
21 Ga0070667_100001512 3300005367 Bacteria 20800
22 Ga0070667_100431653 3300005367 Bacteria 1202
23 Ga0070714_100344622 3300005435 Bacteria 1398
24 Ga0070708_100170232 3300005445 Bacteria 2033
25 Ga0068867_100009546 3300005459 Bacteria 6840
26 Ga0070706_100029455 3300005467 Bacteria 5057
27 Ga0070707_100086200 3300005468 Bacteria 3037
28 Ga0070679_100005097 3300005530 Bacteria 12139
29 Ga0070672_100009105 3300005543 Bacteria 6829
30 Ga0070672_100152426 3300005543 Bacteria 1913
31 Ga0070665_100254138 3300005548 Bacteria 1758
32 Ga0068855_100008712 3300005563 Bacteria 12265
33 Ga0070664_100212803 3300005564 Bacteria 1728
34 Ga0068857_100057228 3300005577 Bacteria 3460
35 Ga0068856_100067412 3300005614 Bacteria 3537
36 Ga0068856_100137735 3300005614 Bacteria 2447
37 Ga0068852_100720878 3300005616 Bacteria 1008
38 Ga0068860_100356093 3300005843 Bacteria 1441
39 Ga0075362_10023997 3300006177 Bacteria 2584
40 Ga0075367_10029218 3300006178 Bacteria 3151
41 Ga0075366_10043666 3300006195 Bacteria 2655
42 Ga0075370_10003165 3300006353 Bacteria 7783
43 Ga0075370_10178946 3300006353 Bacteria 1248
44 Ga0068865_100012780 3300006881 Bacteria 5292
45 Ga0105240_10003348 3300009093 Bacteria 24944
46 Ga0105245_10158779 3300009098 Bacteria 2144
47 Ga0105238_10047030 3300009551 Bacteria 4351
48 Ga0105246_10072732 3300011119 Bacteria 2425
49 Ga0157373_10129806 3300013100 Bacteria 1772
50 Ga0157374_10422144 3300013296 Bacteria 1332
51 Ga0163163_10347028 3300014325 Bacteria 1540
52 Ga0157380_10643975 3300014326 Bacteria 1056
53 Ga0157376_10017237 3300014969 Bacteria 5503
54 Ga0182007_10092194 3300015262 Bacteria 998
55 Ga0213872_10086680 3300021361 Bacteria 1403
56 Ga0209676_1013991 3300025292 Bacteria 3049
57 Ga0209758_1000096 3300025297 Bacteria 231496
58 Ga0209051_1000049 3300025303 Bacteria 287483
59 Ga0209051_1022117 3300025303 Bacteria 2686
60 Ga0207682_10040325 3300025893 Bacteria 1902
61 Ga0207680_10358616 3300025903 Bacteria 1025
62 Ga0207645_10000870 3300025907 Bacteria 25116
63 Ga0207684_10010915 3300025910 Bacteria 7965
64 Ga0207657_10043417 3300025919 Bacteria 3960
65 Ga0207652_10162653 3300025921 Bacteria 2001
66 Ga0207652_10190173 3300025921 Bacteria 1846
67 Ga0207646_10080856 3300025922 Bacteria 2905
68 Ga0207681_10020039 3300025923 Bacteria 4235
69 Ga0207694_10369278 3300025924 Bacteria 1190
70 Ga0207650_10125591 3300025925 Bacteria 2002
71 Ga0207659_10469252 3300025926 Bacteria 1062
72 Ga0207687_10213893 3300025927 Bacteria 1514
73 Ga0207687_10258174 3300025927 Bacteria 1388
74 Ga0207644_10111055 3300025931 Bacteria 2073
75 Ga0207709_10178720 3300025935 Bacteria 1496
76 Ga0207704_10005904 3300025938 Bacteria 5670
77 Ga0207691_10010807 3300025940 Bacteria 8762
78 Ga0207689_10182435 3300025942 Bacteria 1731
79 Ga0207667_10072580 3300025949 Bacteria 3577
80 Ga0207667_10287942 3300025949 Bacteria 1679
81 Ga0207651_10060117 3300025960 Bacteria 2636
82 Ga0207651_10142847 3300025960 Bacteria 1851
83 Ga0207668_10537254 3300025972 Bacteria 1011
84 Ga0207658_10002279 3300025986 Bacteria 14184
85 Ga0207658_10063146 3300025986 Bacteria 2775
86 Ga0207677_10015977 3300026023 Bacteria 4432
87 Ga0207677_10026109 3300026023 Bacteria 3657
88 Ga0207678_10311192 3300026067 Bacteria 1354
89 Ga0207702_10047691 3300026078 Bacteria 3611
90 Ga0207641_10294508 3300026088 Bacteria 1531
91 Ga0207648_10004343 3300026089 Bacteria 14588
92 Ga0207648_10160903 3300026089 Bacteria 1983
93 Ga0207648_10239050 3300026089 Bacteria 1617
94 Ga0207674_10009884 3300026116 Bacteria 10854
95 Ga0207683_10053644 3300026121 Bacteria 3535
96 Ga0268266_10199182 3300028379 Bacteria 1832
97 Ga0268264_10101722 3300028381 Bacteria 2499
98 Ga0268264_10305351 3300028381 Bacteria 1499
99 Ga0307515_10000089 3300028794 Bacteria 215736
100 Ga0307515_10007639 3300028794 Bacteria 21327
101 Ga0307515_10122573 3300028794 Bacteria 2930
102 Ga0307515_10310955 3300028794 Bacteria 1251
103 Ga0307513_10009879 3300031456 Bacteria 12041
104 Ga0307513_10328373 3300031456 Bacteria 1285
105 Ga0307509_10107388 3300031507 Bacteria 2807
106 Ga0307408_100000029 3300031548 Bacteria 227806
107 Ga0307408_100010516 3300031548 Bacteria 6100
108 Ga0307408_100337573 3300031548 Bacteria 1274
109 Ga0307516_10000017 3300031730 Bacteria 202506
110 Ga0307516_10080986 3300031730 Bacteria 3090
111 Ga0307516_10154563 3300031730 Bacteria 2051
112 Ga0307405_10151012 3300031731 Bacteria 1633
113 Ga0307406_10013344 3300031901 Bacteria 4706
114 Ga0307407_10374120 3300031903 Bacteria 1015
115 Ga0307414_10103398 3300032004 Bacteria 2149
116 Ga0307411_10000600 3300032005 Bacteria 12915
117 Ga0395899_0000598 3300037312 Bacteria 37911
118 Ga0395899_0001703 3300037312 Bacteria 18328
119 Ga0395900_0002829 3300037418 Bacteria 18935
120 Ga0395900_0036357 3300037418 Bacteria 5077
121 Ga0395898_0013861 3300037466 Bacteria 8285
122 Ga0395898_0157552 3300037466 Bacteria 2172
123 Ga0395905_0000212 3300037471 Bacteria 89838
124 Ga0395905_0001304 3300037471 Bacteria 30620
125 Ga0395905_0009814 3300037471 Bacteria 9331
126 Ga0395905_0025048 3300037471 Bacteria 5627
127 Ga0395905_0032415 3300037471 Bacteria 4914
128 Ga0395905_0050374 3300037471 Bacteria 3901
129 Ga0395905_0109831 3300037471 Bacteria 2589
130 Ga0395905_0113515 3300037471 Bacteria 2545
131 Ga0395905_0293269 3300037471 Bacteria 1513
132 Ga0395901_0027107 3300038443 Bacteria 5884
133 Ga0395901_0043024 3300038443 Bacteria 4685
134 Ga0395901_0052192 3300038443 Bacteria 4250
135 Ga0436361_0484610 3300039447 Bacteria 8642
136 Ga0451853_2758859 3300041512 Bacteria 1759
137 Ga0450920_033781 3300042122 Bacteria 1011
138 Ga0450923_039369 3300042125 Bacteria 989
139 Ga0450888_000400 3300042126 Bacteria 4106
140 Ga0450890_003015 3300042127 Bacteria 2261
141 Ga0450891_001169 3300042129 Bacteria 2733
142 Ga0450892_002527 3300042130 Bacteria 1555
143 Ga0450903_011526 3300042138 Bacteria 1423
144 Ga0439446_0002741 3300042156 Bacteria 4268
145 Ga0450909_012775 3300042185 Bacteria 1232
146 Ga0451577_0001634 3300042876 Bacteria 29063
147 Ga0451577_0006801 3300042876 Bacteria 11332
148 Ga0451577_0029529 3300042876 Bacteria 4956
149 Ga0451577_0140796 3300042876 Bacteria 2167
150 Ga0451577_0257108 3300042876 Bacteria 1581
151 Ga0453683_0002111 3300044673 Bacteria 15856
152 Ga0453684_0247194 3300044712 Bacteria 2050
153 Ga0451576_0000650 3300045051 Bacteria 71790
154 Ga0451576_0004140 3300045051 Bacteria 19114
155 Ga0451576_0658336 3300045051 Bacteria 1100
156 Ga0495590_0019292 3300046457 Bacteria 2431
157 Ga0495638_0131419 3300046460 Bacteria 1470
158 Ga0495605_0098080 3300046474 Bacteria 1350
159 Ga0495583_0000134 3300046506 Bacteria 124077
160 Ga0495583_0001082 3300046506 Bacteria 30273
161 Ga0495583_0004085 3300046506 Bacteria 10713
162 Ga0495616_0000485 3300046513 Bacteria 30262
163 Ga0495632_0008481 3300046519 Bacteria 6303
164 Ga0495643_0000844 3300046522 Bacteria 33256
165 Ga0495648_0053743 3300046524 Bacteria 2438
166 Ga0495642_0048435 3300046528 Bacteria 1743
167 Ga0495621_0005038 3300046539 Bacteria 3765
168 Ga0495621_0026036 3300046539 Bacteria 1969
169 Ga0495633_0057096 3300046558 Bacteria 1834
170 Ga0495588_0055679 3300046674 Bacteria 2041
171 Ga0495672_0083875 3300047320 Bacteria 1769
172 Ga0495677_0163470 3300047445 Bacteria 860
173 Ga0495686_0000282 3300047472 Bacteria 89471
174 Ga0495615_0002504 3300048090 Bacteria 2955
175 Ga0496102_0098308 3300048905 Bacteria 2716
176 Ga0496103_0003879 3300048906 Bacteria 9094
177 Ga0496121_0135761 3300048924 Bacteria 1833
178 Ga0496124_0000151 3300048927 Bacteria 142761
179 Ga0496125_0068079 3300048928 Bacteria 2802
180 Ga0496125_0098038 3300048928 Bacteria 2170
181 Ga0501222_001764 3300049662 Bacteria 3001
182 Ga0501235_035876 3300049669 Bacteria 1127
183 Ga0501258_000149 3300049687 Bacteria 3924
184 Ga0501229_002586 3300049706 Bacteria 2136
185 Ga0501267_000927 3300049764 Bacteria 2406
186 nmdc:mga03683_17667_c2 3300050489 Bacteria 1642
187 nmdc:mga0k408_172193_c1 3300050493 Bacteria 1291
188 nmdc:mga07m45_1232_c1 3300050496 Bacteria 11593
189 nmdc:mga07m45_182422_c1 3300050496 Bacteria 1220
190 Ga0500578_0000115 3300053086 Bacteria 95966
191 Ga0500651_0207611 3300053093 Bacteria 1153
192 Ga0500642_0000982 3300053130 Bacteria 8190
193 Ga0500652_024904 3300053131 Bacteria 2288
194 Ga0500655_009908 3300053133 Bacteria 1719
195 Ga0500619_000283 3300053154 Bacteria 10316
196 Ga0500622_0000205 3300053156 Bacteria 62937
197 Ga0590071_001930 3300059421 Bacteria 5307
198 Ga0587066_004870 3300059490 Bacteria 1681
199 Ga0587094_002768 3300059513 Bacteria 1840
200 Ga0587072_008659 3300059643 Bacteria 1616
201 Ga0587075_005744 3300059644 Bacteria 1498

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300047472 Ga0495686_0000282 Ga0495686_0000282_56035_56838 220
2 3300005367 Ga0070667_100001512 Ga0070667_10000151215 227
3 3300005548 Ga0070665_100254138 Ga0070665_1002541382 227
4 3300006881 Ga0068865_100012780 Ga0068865_1000127806 227
5 3300025927 Ga0207687_10258174 Ga0207687_102581742 227
6 3300025938 Ga0207704_10005904 Ga0207704_100059046 227
7 3300025986 Ga0207658_10002279 Ga0207658_100022798 227
8 3300028379 Ga0268266_10199182 Ga0268266_101991822 227
9 3300028381 Ga0268264_10305351 Ga0268264_103053511 227
10 3300003578 Ga0006562J51391_1119545 Ga0006562J51391_11195453 229
11 3300003578 Ga0006562J51391_1119546 Ga0006562J51391_11195462 229
12 3300013100 Ga0157373_10129806 Ga0157373_101298062 229
13 3300031731 Ga0307405_10151012 Ga0307405_101510122 229
14 3300050496 nmdc:mga07m45_182422_c1 nmdc:mga07m45_182422_c1_203_1042 229
15 3300031548 Ga0307408_100010516 Ga0307408_1000105164 230
16 3300031901 Ga0307406_10013344 Ga0307406_100133442 230
17 3300003792 Ga0055540_1000462 Ga0055540_100046214 231
18 3300006177 Ga0075362_10023997 Ga0075362_100239972 231
19 3300025292 Ga0209676_1013991 Ga0209676_10139913 231
20 3300025303 Ga0209051_1000049 Ga0209051_100004923 231
21 3300050489 nmdc:mga03683_17667_c2 nmdc:mga03683_17667_c2_494_1333 231
22 3300003316 rootH1_10006074 rootH1_100060744 233
23 3300003322 rootL2_10016963 rootL2_100169634 233
24 3300005445 Ga0070708_100170232 Ga0070708_1001702323 233
25 3300037471 Ga0395905_0113515 Ga0395905_0113515_1181_2008 233
26 3300005467 Ga0070706_100029455 Ga0070706_1000294553 234
27 3300005468 Ga0070707_100086200 Ga0070707_1000862002 234
28 3300006178 Ga0075367_10029218 Ga0075367_100292182 234
29 3300006195 Ga0075366_10043666 Ga0075366_100436663 234
30 3300006353 Ga0075370_10003165 Ga0075370_100031653 234
31 3300025910 Ga0207684_10010915 Ga0207684_100109154 234
32 3300025922 Ga0207646_10080856 Ga0207646_100808562 234
33 3300031456 Ga0307513_10009879 Ga0307513_100098792 234
34 3300050493 nmdc:mga0k408_172193_c1 nmdc:mga0k408_172193_c1_250_1083 234
35 3300050496 nmdc:mga07m45_1232_c1 nmdc:mga07m45_1232_c1_4598_5419 235
36 3300031456 Ga0307513_10328373 Ga0307513_103283732 236
37 3300031730 Ga0307516_10154563 Ga0307516_101545631 236
38 3300042122 Ga0450920_033781 Ga0450920_033781_81_878 236
39 3300042876 Ga0451577_0140796 Ga0451577_0140796_1030_1854 236
40 3300044712 Ga0453684_0247194 Ga0453684_0247194_459_1283 236
41 3300045051 Ga0451576_0000650 Ga0451576_0000650_26620_27444 236
42 3300005262 Ga0065165_1002045 Ga0065165_100204519 237
43 3300042156 Ga0439446_0002741 Ga0439446_0002741_2090_2929 237
44 3300005616 Ga0068852_100720878 Ga0068852_1007208781 238
45 3300005843 Ga0068860_100356093 Ga0068860_1003560932 238
46 3300028381 Ga0268264_10101722 Ga0268264_101017222 238
47 3300031548 Ga0307408_100000029 Ga0307408_10000002959 238
48 3300042125 Ga0450923_039369 Ga0450923_039369_11_850 238
49 3300042185 Ga0450909_012775 Ga0450909_012775_304_1143 238
50 3300013296 Ga0157374_10422144 Ga0157374_104221442 239
51 3300045051 Ga0451576_0658336 Ga0451576_0658336_52_870 239
52 3300048906 Ga0496103_0003879 Ga0496103_0003879_7646_8437 239
53 3300048924 Ga0496121_0135761 Ga0496121_0135761_869_1672 239
54 3300048928 Ga0496125_0098038 Ga0496125_0098038_1261_2064 239
55 3300028794 Ga0307515_10007639 Ga0307515_100076397 240
56 3300037466 Ga0395898_0157552 Ga0395898_0157552_351_1136 240
57 3300044673 Ga0453683_0002111 Ga0453683_0002111_14021_14857 240
58 3300045051 Ga0451576_0004140 Ga0451576_0004140_4051_4887 240
59 3300037418 Ga0395900_0036357 Ga0395900_0036357_26_862 241
60 3300037471 Ga0395905_0050374 Ga0395905_0050374_583_1419 241
61 3300038443 Ga0395901_0043024 Ga0395901_0043024_2491_3327 241
62 iso_pu_bacteria 2643221660 2644340357 241
63 3300049764 Ga0501267_000927 Ga0501267_000927_1288_2091 242
64 3300005339 Ga0070660_100009229 Ga0070660_1000092297 243
65 3300005435 Ga0070714_100344622 Ga0070714_1003446222 243
66 3300005530 Ga0070679_100005097 Ga0070679_1000050974 243
67 3300005563 Ga0068855_100008712 Ga0068855_10000871212 243
68 3300009093 Ga0105240_10003348 Ga0105240_100033485 243
69 3300009551 Ga0105238_10047030 Ga0105238_100470303 243
70 3300025919 Ga0207657_10043417 Ga0207657_100434174 243
71 3300025921 Ga0207652_10190173 Ga0207652_101901732 243
72 3300025924 Ga0207694_10369278 Ga0207694_103692782 243
73 3300025949 Ga0207667_10072580 Ga0207667_100725804 243
74 3300028794 Ga0307515_10000089 Ga0307515_10000089105 243
75 3300042126 Ga0450888_000400 Ga0450888_000400_2584_3381 243
76 3300042127 Ga0450890_003015 Ga0450890_003015_781_1578 243
77 3300042129 Ga0450891_001169 Ga0450891_001169_1240_2037 243
78 3300042130 Ga0450892_002527 Ga0450892_002527_398_1195 243
79 3300042138 Ga0450903_011526 Ga0450903_011526_429_1226 243
80 3300049662 Ga0501222_001764 Ga0501222_001764_231_1034 243
81 3300049669 Ga0501235_035876 Ga0501235_035876_282_1085 243
82 3300049687 Ga0501258_000149 Ga0501258_000149_489_1292 243
83 3300049706 Ga0501229_002586 Ga0501229_002586_934_1737 243
84 3300053154 Ga0500619_000283 Ga0500619_000283_5642_6454 243
85 3300031548 Ga0307408_100337573 Ga0307408_1003375732 244
86 3300042876 Ga0451577_0257108 Ga0451577_0257108_310_1056 244
87 3300048090 Ga0495615_0002504 Ga0495615_0002504_1930_2745 244
88 3300005614 Ga0068856_100137735 Ga0068856_1001377352 245
89 3300025949 Ga0207667_10287942 Ga0207667_102879422 245
90 3300031507 Ga0307509_10107388 Ga0307509_101073883 245
91 3300059421 Ga0590071_001930 Ga0590071_001930_490_1257 245
92 3300028794 Ga0307515_10310955 Ga0307515_103109552 246
93 3300046513 Ga0495616_0000485 Ga0495616_0000485_19170_19955 246
94 3300026088 Ga0207641_10294508 Ga0207641_102945082 248
95 3300031903 Ga0307407_10374120 Ga0307407_103741202 248
96 3300032004 Ga0307414_10103398 Ga0307414_101033982 248
97 3300032005 Ga0307411_10000600 Ga0307411_100006004 248
98 3300037471 Ga0395905_0009814 Ga0395905_0009814_7512_8345 248
99 3300048927 Ga0496124_0000151 Ga0496124_0000151_3128_3931 248
100 3300048928 Ga0496125_0068079 Ga0496125_0068079_800_1603 248
101 3300026023 Ga0207677_10026109 Ga0207677_100261093 251
102 3300046519 Ga0495632_0008481 Ga0495632_0008481_2774_3559 251
103 3300037471 Ga0395905_0025048 Ga0395905_0025048_3732_4541 252
104 3300046474 Ga0495605_0098080 Ga0495605_0098080_57_842 252
105 3300046506 Ga0495583_0000134 Ga0495583_0000134_35588_36370 252
106 3300046506 Ga0495583_0001082 Ga0495583_0001082_10336_11121 252
107 3300046522 Ga0495643_0000844 Ga0495643_0000844_10786_11571 252
108 3300046524 Ga0495648_0053743 Ga0495648_0053743_1161_1943 252
109 3300047320 Ga0495672_0083875 Ga0495672_0083875_312_1097 252
110 3300047445 Ga0495677_0163470 Ga0495677_0163470_58_843 252
111 3300053086 Ga0500578_0000115 Ga0500578_0000115_64983_65795 252
112 iso_pu_bacteria 2643221544 2643745140 252
113 3300003322 rootL2_10029268 rootL2_100292682 253
114 3300003323 rootH1_10011999 rootH1_100119998 253
115 3300031730 Ga0307516_10080986 Ga0307516_100809863 253
116 3300037312 Ga0395899_0000598 Ga0395899_0000598_3254_4042 253
117 3300037471 Ga0395905_0293269 Ga0395905_0293269_650_1438 253
118 3300038443 Ga0395901_0052192 Ga0395901_0052192_3373_4161 253
119 3300041512 Ga0451853_2758859 Ga0451853_2758859_115_900 253
120 3300042876 Ga0451577_0006801 Ga0451577_0006801_10133_10954 253
121 3300046460 Ga0495638_0131419 Ga0495638_0131419_508_1293 253
122 3300053130 Ga0500642_0000982 Ga0500642_0000982_6003_6788 253
123 3300053131 Ga0500652_024904 Ga0500652_024904_1322_2107 253
124 3300053133 Ga0500655_009908 Ga0500655_009908_768_1553 253
125 3300059490 Ga0587066_004870 Ga0587066_004870_391_1179 253
126 3300059513 Ga0587094_002768 Ga0587094_002768_662_1450 253
127 3300059643 Ga0587072_008659 Ga0587072_008659_389_1177 253
128 3300059644 Ga0587075_005744 Ga0587075_005744_315_1103 253
129 3300005353 Ga0070669_100224386 Ga0070669_1002243861 254
130 3300005364 Ga0070673_100024601 Ga0070673_1000246015 254
131 3300005543 Ga0070672_100152426 Ga0070672_1001524262 254
132 3300025903 Ga0207680_10358616 Ga0207680_103586161 254
133 3300025923 Ga0207681_10020039 Ga0207681_100200395 254
134 3300025960 Ga0207651_10060117 Ga0207651_100601173 254
135 3300026067 Ga0207678_10311192 Ga0207678_103111922 254
136 3300026089 Ga0207648_10160903 Ga0207648_101609033 254
137 iso_pu_bacteria 2588253510 2588293561 254
138 iso_pu_bacteria 2643221585 2643935703 254
139 iso_pu_bacteria 2643221592 2643968921 254
140 iso_pu_bacteria 2643221625 2644144053 254
141 iso_pu_bacteria 2643221648 2644273172 254
142 iso_pu_bacteria 2643221656 2644317486 254
143 3300009098 Ga0105245_10158779 Ga0105245_101587792 255
144 3300014969 Ga0157376_10017237 Ga0157376_100172374 255
145 3300028794 Ga0307515_10122573 Ga0307515_101225733 255
146 3300046506 Ga0495583_0004085 Ga0495583_0004085_8479_9273 255
147 3300046674 Ga0495588_0055679 Ga0495588_0055679_35_829 255
148 3300048905 Ga0496102_0098308 Ga0496102_0098308_462_1259 255
149 iso_pu_bacteria 2585428058 2587734771 255
150 iso_pu_bacteria 2919704043 2919706552 255
151 3300005614 Ga0068856_100067412 Ga0068856_1000674123 256
152 3300026078 Ga0207702_10047691 Ga0207702_100476913 256
153 3300037312 Ga0395899_0001703 Ga0395899_0001703_12785_13609 256
154 3300037418 Ga0395900_0002829 Ga0395900_0002829_2979_3803 256
155 3300037466 Ga0395898_0013861 Ga0395898_0013861_5878_6702 256
156 3300037471 Ga0395905_0000212 Ga0395905_0000212_70163_70987 256
157 3300037471 Ga0395905_0109831 Ga0395905_0109831_1573_2397 256
158 3300038443 Ga0395901_0027107 Ga0395901_0027107_4737_5561 256
159 3300005328 Ga0070676_10269471 Ga0070676_102694711 257
160 3300005331 Ga0070670_100308182 Ga0070670_1003081822 257
161 3300014326 Ga0157380_10643975 Ga0157380_106439752 257
162 3300025303 Ga0209051_1022117 Ga0209051_10221172 257
163 3300025893 Ga0207682_10040325 Ga0207682_100403252 257
164 3300046539 Ga0495621_0005038 Ga0495621_0005038_698_1507 257
165 3300046539 Ga0495621_0026036 Ga0495621_0026036_503_1312 257
166 iso_pu_bacteria 2904456579 2904457458 257
167 iso_pu_bacteria 2929520902 2929527438 257
168 3300025935 Ga0207709_10178720 Ga0207709_101787202 258
169 3300053156 Ga0500622_0000205 Ga0500622_0000205_43918_44703 258
170 3300005328 Ga0070676_10002900 Ga0070676_100029003 260
171 3300005331 Ga0070670_100251681 Ga0070670_1002516812 260
172 3300005334 Ga0068869_100171535 Ga0068869_1001715352 260
173 3300005338 Ga0068868_100059827 Ga0068868_1000598272 260
174 3300005364 Ga0070673_100003978 Ga0070673_1000039782 260
175 3300005367 Ga0070667_100431653 Ga0070667_1004316532 260
176 3300005459 Ga0068867_100009546 Ga0068867_1000095468 260
177 3300005543 Ga0070672_100009105 Ga0070672_1000091057 260
178 3300005564 Ga0070664_100212803 Ga0070664_1002128032 260
179 3300005577 Ga0068857_100057228 Ga0068857_1000572282 260
180 3300011119 Ga0105246_10072732 Ga0105246_100727322 260
181 3300014325 Ga0163163_10347028 Ga0163163_103470282 260
182 3300025907 Ga0207645_10000870 Ga0207645_1000087024 260
183 3300025921 Ga0207652_10162653 Ga0207652_101626532 260
184 3300025925 Ga0207650_10125591 Ga0207650_101255912 260
185 3300025926 Ga0207659_10469252 Ga0207659_104692521 260
186 3300025927 Ga0207687_10213893 Ga0207687_102138932 260
187 3300025931 Ga0207644_10111055 Ga0207644_101110552 260
188 3300025940 Ga0207691_10010807 Ga0207691_100108071 260
189 3300025942 Ga0207689_10182435 Ga0207689_101824352 260
190 3300025960 Ga0207651_10142847 Ga0207651_101428472 260
191 3300025972 Ga0207668_10537254 Ga0207668_105372541 260
192 3300025986 Ga0207658_10063146 Ga0207658_100631462 260
193 3300026023 Ga0207677_10015977 Ga0207677_100159774 260
194 3300026089 Ga0207648_10004343 Ga0207648_100043432 260
195 3300026116 Ga0207674_10009884 Ga0207674_1000988412 260
196 3300026121 Ga0207683_10053644 Ga0207683_100536441 260
197 3300031730 Ga0307516_10000017 Ga0307516_1000001757 260
198 3300037471 Ga0395905_0001304 Ga0395905_0001304_24608_25441 260
199 3300042876 Ga0451577_0029529 Ga0451577_0029529_3036_3863 260
200 3300046457 Ga0495590_0019292 Ga0495590_0019292_1574_2407 260
201 3300046528 Ga0495642_0048435 Ga0495642_0048435_294_1103 260
202 3300046558 Ga0495633_0057096 Ga0495633_0057096_49_858 260
203 3300003215 JGI25153J46596_10008886 JGI25153J46596_100088865 261
204 3300006353 Ga0075370_10178946 Ga0075370_101789462 261
205 3300015262 Ga0182007_10092194 Ga0182007_100921942 261
206 3300021361 Ga0213872_10086680 Ga0213872_100866801 261
207 3300025297 Ga0209758_1000096 Ga0209758_1000096114 261
208 3300026089 Ga0207648_10239050 Ga0207648_102390502 261
209 3300037471 Ga0395905_0032415 Ga0395905_0032415_2899_3732 261
210 3300039447 Ga0436361_0484610 Ga0436361_0484610_2596_3441 261
211 3300042876 Ga0451577_0001634 Ga0451577_0001634_6446_7300 261
212 3300053093 Ga0500651_0207611 Ga0500651_0207611_44_829 261
213 iso_pu_bacteria 8055225921 8055228700 261

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

107

284

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
3tuz-assembly2.cif.gz_F inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form 0.7765 56 259
3tui-assembly2.cif.gz_E inward facing conformations of the metni methionine abc transporter: cy5 native crystal form 0.7754 56 259
3dhw-assembly2.cif.gz_E crystal structure of methionine importer metni 0.7424 63 252
3tuz-assembly2.cif.gz_F inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form 0.7364 56 259
3tui-assembly2.cif.gz_E inward facing conformations of the metni methionine abc transporter: cy5 native crystal form 0.7353 56 259
ID Description Score Start End Superfamily
af_Q2G225_74_270_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8801 64 257 1.10.3720.10
af_Q2G225_74_270_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8594 64 257 1.10.3720.10
af_Q2G1L9_66_265_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8463 60 257 1.10.3720.10
af_P0DP70_1_121_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.845 140 257 1.10.3720.10
af_Q2G1L9_66_265_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8312 60 257 1.10.3720.10
ID Description Score Start End GO Terms
AF-A0A246GPH9-F1-model_v4 deleted 0.9115 55 259
AF-A0A246GPH9-F1-model_v4 deleted 0.8947 55 259
AF-A0A7C4KYC2-F1-model_v4 Phosphonate ABC transporter, permease protein PhnE 0.8928 60 259 GO:0005886
GO:0015416
GO:0030313
AF-A0A3D3MBC4-F1-model_v4 Phosphonate ABC transporter, permease protein PhnE 0.8925 72 260 GO:0005886
GO:0015416
AF-A0A1F3VA10-F1-model_v4 Phosphonate ABC transporter, permease protein PhnE 0.8896 51 257 GO:0005886
GO:0015416
GO:0030313

Feature Viewer

pLDDT pTM Quality
84.24 0.73 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map