F324321
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 213 | 162 | 201 | 261 |
Family's Representative Sequence
| Representative Sequence | 3300042876|Ga0451577_0001634|Ga0451577_0001634_6446_7300 |
| Length | 284 |
| Sequence | MSLPNRPSGXXXXVAANPPYRLPPRLFDARCKACWFSAGLLALIVASFWSLDLQWAQFFSLDAARSMGRFLGEFFPPDTSPEFMARVLRGTWETLAMSALGTALAAAAGLVLALPASRLHEGDAARGRSATRLLLNALRSVPELVWAALLLIAAGLGPFAGTLALAIHTAGVLGRLFAEAIENAPPGPGDALRAQGVGPVRVFLYATLPQVLPQLMSYTLYRWENNIRAAAVLGVVGAGGLGQLLQFHMGLFHMGKTATLLGAMIVLVLLVDACSFTARRLLTR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2585428058 | Methylibium sp. CF468 | Isolate | Rhizosphere |
| 2 | 2588253510 | Rhizobacter sp. OV335 | Isolate | Rhizosphere |
| 3 | 2643221544 | Pelomonas sp. Root1444 | Isolate | Unclassified |
| 4 | 2643221585 | Pelomonas sp. Root662 | Isolate | Unclassified |
| 5 | 2643221592 | Rhizobacter sp. Root16D2 | Isolate | Unclassified |
| 6 | 2643221625 | Rhizobacter sp. Root29 | Isolate | Unclassified |
| 7 | 2643221648 | Rhizobacter sp. Root1238 | Isolate | Unclassified |
| 8 | 2643221656 | Pelomonas sp. Root405 | Isolate | Unclassified |
| 9 | 2643221660 | Methylibium sp. Root1272 | Isolate | Unclassified |
| 10 | 2904456579 | Variovorax sp. 2002 | Isolate | Unclassified |
| 11 | 2919704043 | Hydrogenophaga palleronii 4249 | Isolate | Unclassified |
| 12 | 2929520902 | Variovorax beijingensis 502 | Isolate | Unclassified |
| 13 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 14 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 15 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 16 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 17 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 18 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 19 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 20 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 23 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 24 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 31 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 34 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 37 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 39 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 40 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 41 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 42 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 43 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 44 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 45 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 46 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 47 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 57 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 58 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 59 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 60 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 61 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 92 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 93 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 94 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 95 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 96 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 97 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 98 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 99 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 100 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 101 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 102 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 103 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 104 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 105 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 106 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 107 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 108 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 109 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 110 | 3300042126 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 | Metagenome | Rhizosphere |
| 111 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 112 | 3300042129 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 | Metagenome | Rhizosphere |
| 113 | 3300042130 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 | Metagenome | Rhizosphere |
| 114 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 115 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 116 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 117 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 118 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 119 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 120 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 121 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 138 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 139 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 140 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 141 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 142 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 143 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 144 | 3300049687 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought | Metagenome | Rhizosphere |
| 145 | 3300049706 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control | Metagenome | Rhizosphere |
| 146 | 3300049764 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control | Metagenome | Rhizosphere |
| 147 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 148 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 149 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 150 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 151 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 152 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 153 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 154 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 155 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 156 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 157 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 158 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 159 | 3300059513 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 160 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 161 | 3300059644 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 162 | 8055225921 | Achromobacter panacis KCTC 42751 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 91.08 |
| Metatranscriptomes | 2.82 |
| Isolates | 6.1 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 10.8 |
| Nodule | 0 |
| Rhizoplane | 0.94 |
| Rhizosphere | 73.71 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 14.55 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25153J46596_10008886 | 3300003215 | Bacteria | 4743 |
| 2 | rootH1_10006074 | 3300003316 | Bacteria | 8306 |
| 3 | rootH1_10006074 | 3300003323 | Bacteria | 17704 |
| 4 | rootL2_10016963 | 3300003322 | Bacteria | 10134 |
| 5 | rootL2_10029268 | 3300003322 | Bacteria | 8073 |
| 6 | rootH1_10011999 | 3300003323 | Bacteria | 12337 |
| 7 | Ga0006562J51391_1119545 | 3300003578 | Bacteria | 6600 |
| 8 | Ga0006562J51391_1119546 | 3300003578 | Bacteria | 2540 |
| 9 | Ga0055540_1000462 | 3300003792 | Bacteria | 31651 |
| 10 | Ga0065165_1002045 | 3300005262 | Bacteria | 18698 |
| 11 | Ga0070676_10002900 | 3300005328 | Bacteria | 8856 |
| 12 | Ga0070676_10269471 | 3300005328 | Bacteria | 1143 |
| 13 | Ga0070670_100251681 | 3300005331 | Bacteria | 1539 |
| 14 | Ga0070670_100308182 | 3300005331 | Bacteria | 1386 |
| 15 | Ga0068869_100171535 | 3300005334 | Bacteria | 1695 |
| 16 | Ga0068868_100059827 | 3300005338 | Bacteria | 3014 |
| 17 | Ga0070660_100009229 | 3300005339 | Bacteria | 6930 |
| 18 | Ga0070669_100224386 | 3300005353 | Bacteria | 1487 |
| 19 | Ga0070673_100003978 | 3300005364 | Bacteria | 9298 |
| 20 | Ga0070673_100024601 | 3300005364 | Bacteria | 4419 |
| 21 | Ga0070667_100001512 | 3300005367 | Bacteria | 20800 |
| 22 | Ga0070667_100431653 | 3300005367 | Bacteria | 1202 |
| 23 | Ga0070714_100344622 | 3300005435 | Bacteria | 1398 |
| 24 | Ga0070708_100170232 | 3300005445 | Bacteria | 2033 |
| 25 | Ga0068867_100009546 | 3300005459 | Bacteria | 6840 |
| 26 | Ga0070706_100029455 | 3300005467 | Bacteria | 5057 |
| 27 | Ga0070707_100086200 | 3300005468 | Bacteria | 3037 |
| 28 | Ga0070679_100005097 | 3300005530 | Bacteria | 12139 |
| 29 | Ga0070672_100009105 | 3300005543 | Bacteria | 6829 |
| 30 | Ga0070672_100152426 | 3300005543 | Bacteria | 1913 |
| 31 | Ga0070665_100254138 | 3300005548 | Bacteria | 1758 |
| 32 | Ga0068855_100008712 | 3300005563 | Bacteria | 12265 |
| 33 | Ga0070664_100212803 | 3300005564 | Bacteria | 1728 |
| 34 | Ga0068857_100057228 | 3300005577 | Bacteria | 3460 |
| 35 | Ga0068856_100067412 | 3300005614 | Bacteria | 3537 |
| 36 | Ga0068856_100137735 | 3300005614 | Bacteria | 2447 |
| 37 | Ga0068852_100720878 | 3300005616 | Bacteria | 1008 |
| 38 | Ga0068860_100356093 | 3300005843 | Bacteria | 1441 |
| 39 | Ga0075362_10023997 | 3300006177 | Bacteria | 2584 |
| 40 | Ga0075367_10029218 | 3300006178 | Bacteria | 3151 |
| 41 | Ga0075366_10043666 | 3300006195 | Bacteria | 2655 |
| 42 | Ga0075370_10003165 | 3300006353 | Bacteria | 7783 |
| 43 | Ga0075370_10178946 | 3300006353 | Bacteria | 1248 |
| 44 | Ga0068865_100012780 | 3300006881 | Bacteria | 5292 |
| 45 | Ga0105240_10003348 | 3300009093 | Bacteria | 24944 |
| 46 | Ga0105245_10158779 | 3300009098 | Bacteria | 2144 |
| 47 | Ga0105238_10047030 | 3300009551 | Bacteria | 4351 |
| 48 | Ga0105246_10072732 | 3300011119 | Bacteria | 2425 |
| 49 | Ga0157373_10129806 | 3300013100 | Bacteria | 1772 |
| 50 | Ga0157374_10422144 | 3300013296 | Bacteria | 1332 |
| 51 | Ga0163163_10347028 | 3300014325 | Bacteria | 1540 |
| 52 | Ga0157380_10643975 | 3300014326 | Bacteria | 1056 |
| 53 | Ga0157376_10017237 | 3300014969 | Bacteria | 5503 |
| 54 | Ga0182007_10092194 | 3300015262 | Bacteria | 998 |
| 55 | Ga0213872_10086680 | 3300021361 | Bacteria | 1403 |
| 56 | Ga0209676_1013991 | 3300025292 | Bacteria | 3049 |
| 57 | Ga0209758_1000096 | 3300025297 | Bacteria | 231496 |
| 58 | Ga0209051_1000049 | 3300025303 | Bacteria | 287483 |
| 59 | Ga0209051_1022117 | 3300025303 | Bacteria | 2686 |
| 60 | Ga0207682_10040325 | 3300025893 | Bacteria | 1902 |
| 61 | Ga0207680_10358616 | 3300025903 | Bacteria | 1025 |
| 62 | Ga0207645_10000870 | 3300025907 | Bacteria | 25116 |
| 63 | Ga0207684_10010915 | 3300025910 | Bacteria | 7965 |
| 64 | Ga0207657_10043417 | 3300025919 | Bacteria | 3960 |
| 65 | Ga0207652_10162653 | 3300025921 | Bacteria | 2001 |
| 66 | Ga0207652_10190173 | 3300025921 | Bacteria | 1846 |
| 67 | Ga0207646_10080856 | 3300025922 | Bacteria | 2905 |
| 68 | Ga0207681_10020039 | 3300025923 | Bacteria | 4235 |
| 69 | Ga0207694_10369278 | 3300025924 | Bacteria | 1190 |
| 70 | Ga0207650_10125591 | 3300025925 | Bacteria | 2002 |
| 71 | Ga0207659_10469252 | 3300025926 | Bacteria | 1062 |
| 72 | Ga0207687_10213893 | 3300025927 | Bacteria | 1514 |
| 73 | Ga0207687_10258174 | 3300025927 | Bacteria | 1388 |
| 74 | Ga0207644_10111055 | 3300025931 | Bacteria | 2073 |
| 75 | Ga0207709_10178720 | 3300025935 | Bacteria | 1496 |
| 76 | Ga0207704_10005904 | 3300025938 | Bacteria | 5670 |
| 77 | Ga0207691_10010807 | 3300025940 | Bacteria | 8762 |
| 78 | Ga0207689_10182435 | 3300025942 | Bacteria | 1731 |
| 79 | Ga0207667_10072580 | 3300025949 | Bacteria | 3577 |
| 80 | Ga0207667_10287942 | 3300025949 | Bacteria | 1679 |
| 81 | Ga0207651_10060117 | 3300025960 | Bacteria | 2636 |
| 82 | Ga0207651_10142847 | 3300025960 | Bacteria | 1851 |
| 83 | Ga0207668_10537254 | 3300025972 | Bacteria | 1011 |
| 84 | Ga0207658_10002279 | 3300025986 | Bacteria | 14184 |
| 85 | Ga0207658_10063146 | 3300025986 | Bacteria | 2775 |
| 86 | Ga0207677_10015977 | 3300026023 | Bacteria | 4432 |
| 87 | Ga0207677_10026109 | 3300026023 | Bacteria | 3657 |
| 88 | Ga0207678_10311192 | 3300026067 | Bacteria | 1354 |
| 89 | Ga0207702_10047691 | 3300026078 | Bacteria | 3611 |
| 90 | Ga0207641_10294508 | 3300026088 | Bacteria | 1531 |
| 91 | Ga0207648_10004343 | 3300026089 | Bacteria | 14588 |
| 92 | Ga0207648_10160903 | 3300026089 | Bacteria | 1983 |
| 93 | Ga0207648_10239050 | 3300026089 | Bacteria | 1617 |
| 94 | Ga0207674_10009884 | 3300026116 | Bacteria | 10854 |
| 95 | Ga0207683_10053644 | 3300026121 | Bacteria | 3535 |
| 96 | Ga0268266_10199182 | 3300028379 | Bacteria | 1832 |
| 97 | Ga0268264_10101722 | 3300028381 | Bacteria | 2499 |
| 98 | Ga0268264_10305351 | 3300028381 | Bacteria | 1499 |
| 99 | Ga0307515_10000089 | 3300028794 | Bacteria | 215736 |
| 100 | Ga0307515_10007639 | 3300028794 | Bacteria | 21327 |
| 101 | Ga0307515_10122573 | 3300028794 | Bacteria | 2930 |
| 102 | Ga0307515_10310955 | 3300028794 | Bacteria | 1251 |
| 103 | Ga0307513_10009879 | 3300031456 | Bacteria | 12041 |
| 104 | Ga0307513_10328373 | 3300031456 | Bacteria | 1285 |
| 105 | Ga0307509_10107388 | 3300031507 | Bacteria | 2807 |
| 106 | Ga0307408_100000029 | 3300031548 | Bacteria | 227806 |
| 107 | Ga0307408_100010516 | 3300031548 | Bacteria | 6100 |
| 108 | Ga0307408_100337573 | 3300031548 | Bacteria | 1274 |
| 109 | Ga0307516_10000017 | 3300031730 | Bacteria | 202506 |
| 110 | Ga0307516_10080986 | 3300031730 | Bacteria | 3090 |
| 111 | Ga0307516_10154563 | 3300031730 | Bacteria | 2051 |
| 112 | Ga0307405_10151012 | 3300031731 | Bacteria | 1633 |
| 113 | Ga0307406_10013344 | 3300031901 | Bacteria | 4706 |
| 114 | Ga0307407_10374120 | 3300031903 | Bacteria | 1015 |
| 115 | Ga0307414_10103398 | 3300032004 | Bacteria | 2149 |
| 116 | Ga0307411_10000600 | 3300032005 | Bacteria | 12915 |
| 117 | Ga0395899_0000598 | 3300037312 | Bacteria | 37911 |
| 118 | Ga0395899_0001703 | 3300037312 | Bacteria | 18328 |
| 119 | Ga0395900_0002829 | 3300037418 | Bacteria | 18935 |
| 120 | Ga0395900_0036357 | 3300037418 | Bacteria | 5077 |
| 121 | Ga0395898_0013861 | 3300037466 | Bacteria | 8285 |
| 122 | Ga0395898_0157552 | 3300037466 | Bacteria | 2172 |
| 123 | Ga0395905_0000212 | 3300037471 | Bacteria | 89838 |
| 124 | Ga0395905_0001304 | 3300037471 | Bacteria | 30620 |
| 125 | Ga0395905_0009814 | 3300037471 | Bacteria | 9331 |
| 126 | Ga0395905_0025048 | 3300037471 | Bacteria | 5627 |
| 127 | Ga0395905_0032415 | 3300037471 | Bacteria | 4914 |
| 128 | Ga0395905_0050374 | 3300037471 | Bacteria | 3901 |
| 129 | Ga0395905_0109831 | 3300037471 | Bacteria | 2589 |
| 130 | Ga0395905_0113515 | 3300037471 | Bacteria | 2545 |
| 131 | Ga0395905_0293269 | 3300037471 | Bacteria | 1513 |
| 132 | Ga0395901_0027107 | 3300038443 | Bacteria | 5884 |
| 133 | Ga0395901_0043024 | 3300038443 | Bacteria | 4685 |
| 134 | Ga0395901_0052192 | 3300038443 | Bacteria | 4250 |
| 135 | Ga0436361_0484610 | 3300039447 | Bacteria | 8642 |
| 136 | Ga0451853_2758859 | 3300041512 | Bacteria | 1759 |
| 137 | Ga0450920_033781 | 3300042122 | Bacteria | 1011 |
| 138 | Ga0450923_039369 | 3300042125 | Bacteria | 989 |
| 139 | Ga0450888_000400 | 3300042126 | Bacteria | 4106 |
| 140 | Ga0450890_003015 | 3300042127 | Bacteria | 2261 |
| 141 | Ga0450891_001169 | 3300042129 | Bacteria | 2733 |
| 142 | Ga0450892_002527 | 3300042130 | Bacteria | 1555 |
| 143 | Ga0450903_011526 | 3300042138 | Bacteria | 1423 |
| 144 | Ga0439446_0002741 | 3300042156 | Bacteria | 4268 |
| 145 | Ga0450909_012775 | 3300042185 | Bacteria | 1232 |
| 146 | Ga0451577_0001634 | 3300042876 | Bacteria | 29063 |
| 147 | Ga0451577_0006801 | 3300042876 | Bacteria | 11332 |
| 148 | Ga0451577_0029529 | 3300042876 | Bacteria | 4956 |
| 149 | Ga0451577_0140796 | 3300042876 | Bacteria | 2167 |
| 150 | Ga0451577_0257108 | 3300042876 | Bacteria | 1581 |
| 151 | Ga0453683_0002111 | 3300044673 | Bacteria | 15856 |
| 152 | Ga0453684_0247194 | 3300044712 | Bacteria | 2050 |
| 153 | Ga0451576_0000650 | 3300045051 | Bacteria | 71790 |
| 154 | Ga0451576_0004140 | 3300045051 | Bacteria | 19114 |
| 155 | Ga0451576_0658336 | 3300045051 | Bacteria | 1100 |
| 156 | Ga0495590_0019292 | 3300046457 | Bacteria | 2431 |
| 157 | Ga0495638_0131419 | 3300046460 | Bacteria | 1470 |
| 158 | Ga0495605_0098080 | 3300046474 | Bacteria | 1350 |
| 159 | Ga0495583_0000134 | 3300046506 | Bacteria | 124077 |
| 160 | Ga0495583_0001082 | 3300046506 | Bacteria | 30273 |
| 161 | Ga0495583_0004085 | 3300046506 | Bacteria | 10713 |
| 162 | Ga0495616_0000485 | 3300046513 | Bacteria | 30262 |
| 163 | Ga0495632_0008481 | 3300046519 | Bacteria | 6303 |
| 164 | Ga0495643_0000844 | 3300046522 | Bacteria | 33256 |
| 165 | Ga0495648_0053743 | 3300046524 | Bacteria | 2438 |
| 166 | Ga0495642_0048435 | 3300046528 | Bacteria | 1743 |
| 167 | Ga0495621_0005038 | 3300046539 | Bacteria | 3765 |
| 168 | Ga0495621_0026036 | 3300046539 | Bacteria | 1969 |
| 169 | Ga0495633_0057096 | 3300046558 | Bacteria | 1834 |
| 170 | Ga0495588_0055679 | 3300046674 | Bacteria | 2041 |
| 171 | Ga0495672_0083875 | 3300047320 | Bacteria | 1769 |
| 172 | Ga0495677_0163470 | 3300047445 | Bacteria | 860 |
| 173 | Ga0495686_0000282 | 3300047472 | Bacteria | 89471 |
| 174 | Ga0495615_0002504 | 3300048090 | Bacteria | 2955 |
| 175 | Ga0496102_0098308 | 3300048905 | Bacteria | 2716 |
| 176 | Ga0496103_0003879 | 3300048906 | Bacteria | 9094 |
| 177 | Ga0496121_0135761 | 3300048924 | Bacteria | 1833 |
| 178 | Ga0496124_0000151 | 3300048927 | Bacteria | 142761 |
| 179 | Ga0496125_0068079 | 3300048928 | Bacteria | 2802 |
| 180 | Ga0496125_0098038 | 3300048928 | Bacteria | 2170 |
| 181 | Ga0501222_001764 | 3300049662 | Bacteria | 3001 |
| 182 | Ga0501235_035876 | 3300049669 | Bacteria | 1127 |
| 183 | Ga0501258_000149 | 3300049687 | Bacteria | 3924 |
| 184 | Ga0501229_002586 | 3300049706 | Bacteria | 2136 |
| 185 | Ga0501267_000927 | 3300049764 | Bacteria | 2406 |
| 186 | nmdc:mga03683_17667_c2 | 3300050489 | Bacteria | 1642 |
| 187 | nmdc:mga0k408_172193_c1 | 3300050493 | Bacteria | 1291 |
| 188 | nmdc:mga07m45_1232_c1 | 3300050496 | Bacteria | 11593 |
| 189 | nmdc:mga07m45_182422_c1 | 3300050496 | Bacteria | 1220 |
| 190 | Ga0500578_0000115 | 3300053086 | Bacteria | 95966 |
| 191 | Ga0500651_0207611 | 3300053093 | Bacteria | 1153 |
| 192 | Ga0500642_0000982 | 3300053130 | Bacteria | 8190 |
| 193 | Ga0500652_024904 | 3300053131 | Bacteria | 2288 |
| 194 | Ga0500655_009908 | 3300053133 | Bacteria | 1719 |
| 195 | Ga0500619_000283 | 3300053154 | Bacteria | 10316 |
| 196 | Ga0500622_0000205 | 3300053156 | Bacteria | 62937 |
| 197 | Ga0590071_001930 | 3300059421 | Bacteria | 5307 |
| 198 | Ga0587066_004870 | 3300059490 | Bacteria | 1681 |
| 199 | Ga0587094_002768 | 3300059513 | Bacteria | 1840 |
| 200 | Ga0587072_008659 | 3300059643 | Bacteria | 1616 |
| 201 | Ga0587075_005744 | 3300059644 | Bacteria | 1498 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300047472 | Ga0495686_0000282 | Ga0495686_0000282_56035_56838 | 220 |
| 2 | 3300005367 | Ga0070667_100001512 | Ga0070667_10000151215 | 227 |
| 3 | 3300005548 | Ga0070665_100254138 | Ga0070665_1002541382 | 227 |
| 4 | 3300006881 | Ga0068865_100012780 | Ga0068865_1000127806 | 227 |
| 5 | 3300025927 | Ga0207687_10258174 | Ga0207687_102581742 | 227 |
| 6 | 3300025938 | Ga0207704_10005904 | Ga0207704_100059046 | 227 |
| 7 | 3300025986 | Ga0207658_10002279 | Ga0207658_100022798 | 227 |
| 8 | 3300028379 | Ga0268266_10199182 | Ga0268266_101991822 | 227 |
| 9 | 3300028381 | Ga0268264_10305351 | Ga0268264_103053511 | 227 |
| 10 | 3300003578 | Ga0006562J51391_1119545 | Ga0006562J51391_11195453 | 229 |
| 11 | 3300003578 | Ga0006562J51391_1119546 | Ga0006562J51391_11195462 | 229 |
| 12 | 3300013100 | Ga0157373_10129806 | Ga0157373_101298062 | 229 |
| 13 | 3300031731 | Ga0307405_10151012 | Ga0307405_101510122 | 229 |
| 14 | 3300050496 | nmdc:mga07m45_182422_c1 | nmdc:mga07m45_182422_c1_203_1042 | 229 |
| 15 | 3300031548 | Ga0307408_100010516 | Ga0307408_1000105164 | 230 |
| 16 | 3300031901 | Ga0307406_10013344 | Ga0307406_100133442 | 230 |
| 17 | 3300003792 | Ga0055540_1000462 | Ga0055540_100046214 | 231 |
| 18 | 3300006177 | Ga0075362_10023997 | Ga0075362_100239972 | 231 |
| 19 | 3300025292 | Ga0209676_1013991 | Ga0209676_10139913 | 231 |
| 20 | 3300025303 | Ga0209051_1000049 | Ga0209051_100004923 | 231 |
| 21 | 3300050489 | nmdc:mga03683_17667_c2 | nmdc:mga03683_17667_c2_494_1333 | 231 |
| 22 | 3300003316 | rootH1_10006074 | rootH1_100060744 | 233 |
| 23 | 3300003322 | rootL2_10016963 | rootL2_100169634 | 233 |
| 24 | 3300005445 | Ga0070708_100170232 | Ga0070708_1001702323 | 233 |
| 25 | 3300037471 | Ga0395905_0113515 | Ga0395905_0113515_1181_2008 | 233 |
| 26 | 3300005467 | Ga0070706_100029455 | Ga0070706_1000294553 | 234 |
| 27 | 3300005468 | Ga0070707_100086200 | Ga0070707_1000862002 | 234 |
| 28 | 3300006178 | Ga0075367_10029218 | Ga0075367_100292182 | 234 |
| 29 | 3300006195 | Ga0075366_10043666 | Ga0075366_100436663 | 234 |
| 30 | 3300006353 | Ga0075370_10003165 | Ga0075370_100031653 | 234 |
| 31 | 3300025910 | Ga0207684_10010915 | Ga0207684_100109154 | 234 |
| 32 | 3300025922 | Ga0207646_10080856 | Ga0207646_100808562 | 234 |
| 33 | 3300031456 | Ga0307513_10009879 | Ga0307513_100098792 | 234 |
| 34 | 3300050493 | nmdc:mga0k408_172193_c1 | nmdc:mga0k408_172193_c1_250_1083 | 234 |
| 35 | 3300050496 | nmdc:mga07m45_1232_c1 | nmdc:mga07m45_1232_c1_4598_5419 | 235 |
| 36 | 3300031456 | Ga0307513_10328373 | Ga0307513_103283732 | 236 |
| 37 | 3300031730 | Ga0307516_10154563 | Ga0307516_101545631 | 236 |
| 38 | 3300042122 | Ga0450920_033781 | Ga0450920_033781_81_878 | 236 |
| 39 | 3300042876 | Ga0451577_0140796 | Ga0451577_0140796_1030_1854 | 236 |
| 40 | 3300044712 | Ga0453684_0247194 | Ga0453684_0247194_459_1283 | 236 |
| 41 | 3300045051 | Ga0451576_0000650 | Ga0451576_0000650_26620_27444 | 236 |
| 42 | 3300005262 | Ga0065165_1002045 | Ga0065165_100204519 | 237 |
| 43 | 3300042156 | Ga0439446_0002741 | Ga0439446_0002741_2090_2929 | 237 |
| 44 | 3300005616 | Ga0068852_100720878 | Ga0068852_1007208781 | 238 |
| 45 | 3300005843 | Ga0068860_100356093 | Ga0068860_1003560932 | 238 |
| 46 | 3300028381 | Ga0268264_10101722 | Ga0268264_101017222 | 238 |
| 47 | 3300031548 | Ga0307408_100000029 | Ga0307408_10000002959 | 238 |
| 48 | 3300042125 | Ga0450923_039369 | Ga0450923_039369_11_850 | 238 |
| 49 | 3300042185 | Ga0450909_012775 | Ga0450909_012775_304_1143 | 238 |
| 50 | 3300013296 | Ga0157374_10422144 | Ga0157374_104221442 | 239 |
| 51 | 3300045051 | Ga0451576_0658336 | Ga0451576_0658336_52_870 | 239 |
| 52 | 3300048906 | Ga0496103_0003879 | Ga0496103_0003879_7646_8437 | 239 |
| 53 | 3300048924 | Ga0496121_0135761 | Ga0496121_0135761_869_1672 | 239 |
| 54 | 3300048928 | Ga0496125_0098038 | Ga0496125_0098038_1261_2064 | 239 |
| 55 | 3300028794 | Ga0307515_10007639 | Ga0307515_100076397 | 240 |
| 56 | 3300037466 | Ga0395898_0157552 | Ga0395898_0157552_351_1136 | 240 |
| 57 | 3300044673 | Ga0453683_0002111 | Ga0453683_0002111_14021_14857 | 240 |
| 58 | 3300045051 | Ga0451576_0004140 | Ga0451576_0004140_4051_4887 | 240 |
| 59 | 3300037418 | Ga0395900_0036357 | Ga0395900_0036357_26_862 | 241 |
| 60 | 3300037471 | Ga0395905_0050374 | Ga0395905_0050374_583_1419 | 241 |
| 61 | 3300038443 | Ga0395901_0043024 | Ga0395901_0043024_2491_3327 | 241 |
| 62 | iso_pu_bacteria | 2643221660 | 2644340357 | 241 |
| 63 | 3300049764 | Ga0501267_000927 | Ga0501267_000927_1288_2091 | 242 |
| 64 | 3300005339 | Ga0070660_100009229 | Ga0070660_1000092297 | 243 |
| 65 | 3300005435 | Ga0070714_100344622 | Ga0070714_1003446222 | 243 |
| 66 | 3300005530 | Ga0070679_100005097 | Ga0070679_1000050974 | 243 |
| 67 | 3300005563 | Ga0068855_100008712 | Ga0068855_10000871212 | 243 |
| 68 | 3300009093 | Ga0105240_10003348 | Ga0105240_100033485 | 243 |
| 69 | 3300009551 | Ga0105238_10047030 | Ga0105238_100470303 | 243 |
| 70 | 3300025919 | Ga0207657_10043417 | Ga0207657_100434174 | 243 |
| 71 | 3300025921 | Ga0207652_10190173 | Ga0207652_101901732 | 243 |
| 72 | 3300025924 | Ga0207694_10369278 | Ga0207694_103692782 | 243 |
| 73 | 3300025949 | Ga0207667_10072580 | Ga0207667_100725804 | 243 |
| 74 | 3300028794 | Ga0307515_10000089 | Ga0307515_10000089105 | 243 |
| 75 | 3300042126 | Ga0450888_000400 | Ga0450888_000400_2584_3381 | 243 |
| 76 | 3300042127 | Ga0450890_003015 | Ga0450890_003015_781_1578 | 243 |
| 77 | 3300042129 | Ga0450891_001169 | Ga0450891_001169_1240_2037 | 243 |
| 78 | 3300042130 | Ga0450892_002527 | Ga0450892_002527_398_1195 | 243 |
| 79 | 3300042138 | Ga0450903_011526 | Ga0450903_011526_429_1226 | 243 |
| 80 | 3300049662 | Ga0501222_001764 | Ga0501222_001764_231_1034 | 243 |
| 81 | 3300049669 | Ga0501235_035876 | Ga0501235_035876_282_1085 | 243 |
| 82 | 3300049687 | Ga0501258_000149 | Ga0501258_000149_489_1292 | 243 |
| 83 | 3300049706 | Ga0501229_002586 | Ga0501229_002586_934_1737 | 243 |
| 84 | 3300053154 | Ga0500619_000283 | Ga0500619_000283_5642_6454 | 243 |
| 85 | 3300031548 | Ga0307408_100337573 | Ga0307408_1003375732 | 244 |
| 86 | 3300042876 | Ga0451577_0257108 | Ga0451577_0257108_310_1056 | 244 |
| 87 | 3300048090 | Ga0495615_0002504 | Ga0495615_0002504_1930_2745 | 244 |
| 88 | 3300005614 | Ga0068856_100137735 | Ga0068856_1001377352 | 245 |
| 89 | 3300025949 | Ga0207667_10287942 | Ga0207667_102879422 | 245 |
| 90 | 3300031507 | Ga0307509_10107388 | Ga0307509_101073883 | 245 |
| 91 | 3300059421 | Ga0590071_001930 | Ga0590071_001930_490_1257 | 245 |
| 92 | 3300028794 | Ga0307515_10310955 | Ga0307515_103109552 | 246 |
| 93 | 3300046513 | Ga0495616_0000485 | Ga0495616_0000485_19170_19955 | 246 |
| 94 | 3300026088 | Ga0207641_10294508 | Ga0207641_102945082 | 248 |
| 95 | 3300031903 | Ga0307407_10374120 | Ga0307407_103741202 | 248 |
| 96 | 3300032004 | Ga0307414_10103398 | Ga0307414_101033982 | 248 |
| 97 | 3300032005 | Ga0307411_10000600 | Ga0307411_100006004 | 248 |
| 98 | 3300037471 | Ga0395905_0009814 | Ga0395905_0009814_7512_8345 | 248 |
| 99 | 3300048927 | Ga0496124_0000151 | Ga0496124_0000151_3128_3931 | 248 |
| 100 | 3300048928 | Ga0496125_0068079 | Ga0496125_0068079_800_1603 | 248 |
| 101 | 3300026023 | Ga0207677_10026109 | Ga0207677_100261093 | 251 |
| 102 | 3300046519 | Ga0495632_0008481 | Ga0495632_0008481_2774_3559 | 251 |
| 103 | 3300037471 | Ga0395905_0025048 | Ga0395905_0025048_3732_4541 | 252 |
| 104 | 3300046474 | Ga0495605_0098080 | Ga0495605_0098080_57_842 | 252 |
| 105 | 3300046506 | Ga0495583_0000134 | Ga0495583_0000134_35588_36370 | 252 |
| 106 | 3300046506 | Ga0495583_0001082 | Ga0495583_0001082_10336_11121 | 252 |
| 107 | 3300046522 | Ga0495643_0000844 | Ga0495643_0000844_10786_11571 | 252 |
| 108 | 3300046524 | Ga0495648_0053743 | Ga0495648_0053743_1161_1943 | 252 |
| 109 | 3300047320 | Ga0495672_0083875 | Ga0495672_0083875_312_1097 | 252 |
| 110 | 3300047445 | Ga0495677_0163470 | Ga0495677_0163470_58_843 | 252 |
| 111 | 3300053086 | Ga0500578_0000115 | Ga0500578_0000115_64983_65795 | 252 |
| 112 | iso_pu_bacteria | 2643221544 | 2643745140 | 252 |
| 113 | 3300003322 | rootL2_10029268 | rootL2_100292682 | 253 |
| 114 | 3300003323 | rootH1_10011999 | rootH1_100119998 | 253 |
| 115 | 3300031730 | Ga0307516_10080986 | Ga0307516_100809863 | 253 |
| 116 | 3300037312 | Ga0395899_0000598 | Ga0395899_0000598_3254_4042 | 253 |
| 117 | 3300037471 | Ga0395905_0293269 | Ga0395905_0293269_650_1438 | 253 |
| 118 | 3300038443 | Ga0395901_0052192 | Ga0395901_0052192_3373_4161 | 253 |
| 119 | 3300041512 | Ga0451853_2758859 | Ga0451853_2758859_115_900 | 253 |
| 120 | 3300042876 | Ga0451577_0006801 | Ga0451577_0006801_10133_10954 | 253 |
| 121 | 3300046460 | Ga0495638_0131419 | Ga0495638_0131419_508_1293 | 253 |
| 122 | 3300053130 | Ga0500642_0000982 | Ga0500642_0000982_6003_6788 | 253 |
| 123 | 3300053131 | Ga0500652_024904 | Ga0500652_024904_1322_2107 | 253 |
| 124 | 3300053133 | Ga0500655_009908 | Ga0500655_009908_768_1553 | 253 |
| 125 | 3300059490 | Ga0587066_004870 | Ga0587066_004870_391_1179 | 253 |
| 126 | 3300059513 | Ga0587094_002768 | Ga0587094_002768_662_1450 | 253 |
| 127 | 3300059643 | Ga0587072_008659 | Ga0587072_008659_389_1177 | 253 |
| 128 | 3300059644 | Ga0587075_005744 | Ga0587075_005744_315_1103 | 253 |
| 129 | 3300005353 | Ga0070669_100224386 | Ga0070669_1002243861 | 254 |
| 130 | 3300005364 | Ga0070673_100024601 | Ga0070673_1000246015 | 254 |
| 131 | 3300005543 | Ga0070672_100152426 | Ga0070672_1001524262 | 254 |
| 132 | 3300025903 | Ga0207680_10358616 | Ga0207680_103586161 | 254 |
| 133 | 3300025923 | Ga0207681_10020039 | Ga0207681_100200395 | 254 |
| 134 | 3300025960 | Ga0207651_10060117 | Ga0207651_100601173 | 254 |
| 135 | 3300026067 | Ga0207678_10311192 | Ga0207678_103111922 | 254 |
| 136 | 3300026089 | Ga0207648_10160903 | Ga0207648_101609033 | 254 |
| 137 | iso_pu_bacteria | 2588253510 | 2588293561 | 254 |
| 138 | iso_pu_bacteria | 2643221585 | 2643935703 | 254 |
| 139 | iso_pu_bacteria | 2643221592 | 2643968921 | 254 |
| 140 | iso_pu_bacteria | 2643221625 | 2644144053 | 254 |
| 141 | iso_pu_bacteria | 2643221648 | 2644273172 | 254 |
| 142 | iso_pu_bacteria | 2643221656 | 2644317486 | 254 |
| 143 | 3300009098 | Ga0105245_10158779 | Ga0105245_101587792 | 255 |
| 144 | 3300014969 | Ga0157376_10017237 | Ga0157376_100172374 | 255 |
| 145 | 3300028794 | Ga0307515_10122573 | Ga0307515_101225733 | 255 |
| 146 | 3300046506 | Ga0495583_0004085 | Ga0495583_0004085_8479_9273 | 255 |
| 147 | 3300046674 | Ga0495588_0055679 | Ga0495588_0055679_35_829 | 255 |
| 148 | 3300048905 | Ga0496102_0098308 | Ga0496102_0098308_462_1259 | 255 |
| 149 | iso_pu_bacteria | 2585428058 | 2587734771 | 255 |
| 150 | iso_pu_bacteria | 2919704043 | 2919706552 | 255 |
| 151 | 3300005614 | Ga0068856_100067412 | Ga0068856_1000674123 | 256 |
| 152 | 3300026078 | Ga0207702_10047691 | Ga0207702_100476913 | 256 |
| 153 | 3300037312 | Ga0395899_0001703 | Ga0395899_0001703_12785_13609 | 256 |
| 154 | 3300037418 | Ga0395900_0002829 | Ga0395900_0002829_2979_3803 | 256 |
| 155 | 3300037466 | Ga0395898_0013861 | Ga0395898_0013861_5878_6702 | 256 |
| 156 | 3300037471 | Ga0395905_0000212 | Ga0395905_0000212_70163_70987 | 256 |
| 157 | 3300037471 | Ga0395905_0109831 | Ga0395905_0109831_1573_2397 | 256 |
| 158 | 3300038443 | Ga0395901_0027107 | Ga0395901_0027107_4737_5561 | 256 |
| 159 | 3300005328 | Ga0070676_10269471 | Ga0070676_102694711 | 257 |
| 160 | 3300005331 | Ga0070670_100308182 | Ga0070670_1003081822 | 257 |
| 161 | 3300014326 | Ga0157380_10643975 | Ga0157380_106439752 | 257 |
| 162 | 3300025303 | Ga0209051_1022117 | Ga0209051_10221172 | 257 |
| 163 | 3300025893 | Ga0207682_10040325 | Ga0207682_100403252 | 257 |
| 164 | 3300046539 | Ga0495621_0005038 | Ga0495621_0005038_698_1507 | 257 |
| 165 | 3300046539 | Ga0495621_0026036 | Ga0495621_0026036_503_1312 | 257 |
| 166 | iso_pu_bacteria | 2904456579 | 2904457458 | 257 |
| 167 | iso_pu_bacteria | 2929520902 | 2929527438 | 257 |
| 168 | 3300025935 | Ga0207709_10178720 | Ga0207709_101787202 | 258 |
| 169 | 3300053156 | Ga0500622_0000205 | Ga0500622_0000205_43918_44703 | 258 |
| 170 | 3300005328 | Ga0070676_10002900 | Ga0070676_100029003 | 260 |
| 171 | 3300005331 | Ga0070670_100251681 | Ga0070670_1002516812 | 260 |
| 172 | 3300005334 | Ga0068869_100171535 | Ga0068869_1001715352 | 260 |
| 173 | 3300005338 | Ga0068868_100059827 | Ga0068868_1000598272 | 260 |
| 174 | 3300005364 | Ga0070673_100003978 | Ga0070673_1000039782 | 260 |
| 175 | 3300005367 | Ga0070667_100431653 | Ga0070667_1004316532 | 260 |
| 176 | 3300005459 | Ga0068867_100009546 | Ga0068867_1000095468 | 260 |
| 177 | 3300005543 | Ga0070672_100009105 | Ga0070672_1000091057 | 260 |
| 178 | 3300005564 | Ga0070664_100212803 | Ga0070664_1002128032 | 260 |
| 179 | 3300005577 | Ga0068857_100057228 | Ga0068857_1000572282 | 260 |
| 180 | 3300011119 | Ga0105246_10072732 | Ga0105246_100727322 | 260 |
| 181 | 3300014325 | Ga0163163_10347028 | Ga0163163_103470282 | 260 |
| 182 | 3300025907 | Ga0207645_10000870 | Ga0207645_1000087024 | 260 |
| 183 | 3300025921 | Ga0207652_10162653 | Ga0207652_101626532 | 260 |
| 184 | 3300025925 | Ga0207650_10125591 | Ga0207650_101255912 | 260 |
| 185 | 3300025926 | Ga0207659_10469252 | Ga0207659_104692521 | 260 |
| 186 | 3300025927 | Ga0207687_10213893 | Ga0207687_102138932 | 260 |
| 187 | 3300025931 | Ga0207644_10111055 | Ga0207644_101110552 | 260 |
| 188 | 3300025940 | Ga0207691_10010807 | Ga0207691_100108071 | 260 |
| 189 | 3300025942 | Ga0207689_10182435 | Ga0207689_101824352 | 260 |
| 190 | 3300025960 | Ga0207651_10142847 | Ga0207651_101428472 | 260 |
| 191 | 3300025972 | Ga0207668_10537254 | Ga0207668_105372541 | 260 |
| 192 | 3300025986 | Ga0207658_10063146 | Ga0207658_100631462 | 260 |
| 193 | 3300026023 | Ga0207677_10015977 | Ga0207677_100159774 | 260 |
| 194 | 3300026089 | Ga0207648_10004343 | Ga0207648_100043432 | 260 |
| 195 | 3300026116 | Ga0207674_10009884 | Ga0207674_1000988412 | 260 |
| 196 | 3300026121 | Ga0207683_10053644 | Ga0207683_100536441 | 260 |
| 197 | 3300031730 | Ga0307516_10000017 | Ga0307516_1000001757 | 260 |
| 198 | 3300037471 | Ga0395905_0001304 | Ga0395905_0001304_24608_25441 | 260 |
| 199 | 3300042876 | Ga0451577_0029529 | Ga0451577_0029529_3036_3863 | 260 |
| 200 | 3300046457 | Ga0495590_0019292 | Ga0495590_0019292_1574_2407 | 260 |
| 201 | 3300046528 | Ga0495642_0048435 | Ga0495642_0048435_294_1103 | 260 |
| 202 | 3300046558 | Ga0495633_0057096 | Ga0495633_0057096_49_858 | 260 |
| 203 | 3300003215 | JGI25153J46596_10008886 | JGI25153J46596_100088865 | 261 |
| 204 | 3300006353 | Ga0075370_10178946 | Ga0075370_101789462 | 261 |
| 205 | 3300015262 | Ga0182007_10092194 | Ga0182007_100921942 | 261 |
| 206 | 3300021361 | Ga0213872_10086680 | Ga0213872_100866801 | 261 |
| 207 | 3300025297 | Ga0209758_1000096 | Ga0209758_1000096114 | 261 |
| 208 | 3300026089 | Ga0207648_10239050 | Ga0207648_102390502 | 261 |
| 209 | 3300037471 | Ga0395905_0032415 | Ga0395905_0032415_2899_3732 | 261 |
| 210 | 3300039447 | Ga0436361_0484610 | Ga0436361_0484610_2596_3441 | 261 |
| 211 | 3300042876 | Ga0451577_0001634 | Ga0451577_0001634_6446_7300 | 261 |
| 212 | 3300053093 | Ga0500651_0207611 | Ga0500651_0207611_44_829 | 261 |
| 213 | iso_pu_bacteria | 8055225921 | 8055228700 | 261 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
PF00528
BPD_transp_1
Binding-protein-dependent transport system inner membrane component
107
284
0.81
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3tuz-assembly2.cif.gz_F | inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form | 0.7765 | 56 | 259 |
| 3tui-assembly2.cif.gz_E | inward facing conformations of the metni methionine abc transporter: cy5 native crystal form | 0.7754 | 56 | 259 |
| 3dhw-assembly2.cif.gz_E | crystal structure of methionine importer metni | 0.7424 | 63 | 252 |
| 3tuz-assembly2.cif.gz_F | inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form | 0.7364 | 56 | 259 |
| 3tui-assembly2.cif.gz_E | inward facing conformations of the metni methionine abc transporter: cy5 native crystal form | 0.7353 | 56 | 259 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2G225_74_270_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.8801 | 64 | 257 | 1.10.3720.10 |
| af_Q2G225_74_270_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.8594 | 64 | 257 | 1.10.3720.10 |
| af_Q2G1L9_66_265_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.8463 | 60 | 257 | 1.10.3720.10 |
| af_P0DP70_1_121_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.845 | 140 | 257 | 1.10.3720.10 |
| af_Q2G1L9_66_265_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.8312 | 60 | 257 | 1.10.3720.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A246GPH9-F1-model_v4 | deleted | 0.9115 | 55 | 259 |
|
| AF-A0A246GPH9-F1-model_v4 | deleted | 0.8947 | 55 | 259 |
|
| AF-A0A7C4KYC2-F1-model_v4 | Phosphonate ABC transporter, permease protein PhnE | 0.8928 | 60 | 259 |
GO:0005886
GO:0015416 GO:0030313 |
| AF-A0A3D3MBC4-F1-model_v4 | Phosphonate ABC transporter, permease protein PhnE | 0.8925 | 72 | 260 |
GO:0005886
GO:0015416 |
| AF-A0A1F3VA10-F1-model_v4 | Phosphonate ABC transporter, permease protein PhnE | 0.8896 | 51 | 257 |
GO:0005886
GO:0015416 GO:0030313 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar