F324309

General Info

Members Datasets Scaffolds Average Seq Length
213 151 426 88

Family's Representative Sequence

Representative Sequence 3300041512|Ga0451853_2124689|Ga0451853_2124689_41_349
Length 102
Sequence MFDDLKEESIVNKVGGRFKLSTLIQKRLVQLNRGAPALVDAPGKPGMQTVIQEILQDKIYLDASGEVAATNMTITANLPAAFLPGIPQGPSLTVPVKQEDND

Samples

Sample ID Description Type Environment
1 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
9 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
10 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
13 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
14 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
15 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
16 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
17 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
18 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
19 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
20 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
21 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
22 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
23 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
24 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
25 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
26 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
27 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
28 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
29 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
30 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
31 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
32 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
33 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
34 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
35 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
36 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
37 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
38 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
39 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
40 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
41 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
42 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
43 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
44 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
45 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
46 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
47 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
48 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
49 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
50 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
51 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
52 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
53 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
54 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
55 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
56 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
57 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
58 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
79 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
82 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
83 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
84 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
85 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
86 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
87 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
88 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
89 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
90 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
91 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
92 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
93 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
94 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
95 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
96 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
97 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
98 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
99 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
100 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
101 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
102 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
103 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
104 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
105 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
106 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
107 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
108 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
109 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
110 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
111 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
112 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
113 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
114 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
115 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
116 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
117 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
118 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
119 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
120 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
121 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
122 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
123 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
124 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
125 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
126 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
127 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
128 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
129 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
130 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
131 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
132 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
133 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
134 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
135 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
136 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
137 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
138 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
139 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
140 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
141 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
142 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
143 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
144 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
145 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
146 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
147 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
148 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
149 2684623219 Planctomyces sp. SH-PL14 Isolate Unclassified
150 2687453257 Planctomyces sp. SH-PL62 Isolate Unclassified
151 2687453341 Pirellula sp. SH-Sr6A Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 95.77
Metatranscriptomes 2.82
Isolates 1.41

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.29
Nodule 0
Rhizoplane 4.23
Rhizosphere 81.69
Stem 0
Stem Tuber 0
Unclassified 18.78

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451853_2124689 3300041512 Bacteria 637
2 MRS1b_contig_1754898 2162886011 Bacteria 875
3 Ga0058859_11600715 3300004798 Unclassified 528
4 Ga0065707_10792098 3300005295 Bacteria 602
5 Ga0070690_101227384 3300005330 Bacteria 599
6 Ga0070680_100634047 3300005336 Unclassified 918
7 Ga0070689_100265393 3300005340 Bacteria 1420
8 Ga0070671_101359242 3300005355 Bacteria 627
9 Ga0070674_102094423 3300005356 Bacteria 516
10 Ga0070688_100360901 3300005365 Bacteria 1066
11 Ga0070714_100175711 3300005435 Unclassified 1946
12 Ga0070710_10140442 3300005437 Unclassified 1481
13 Ga0070662_101938858 3300005457 Unclassified 509
14 Ga0070706_100382717 3300005467 Bacteria 1310
15 Ga0070679_101067500 3300005530 Unclassified 752
16 Ga0070672_101471815 3300005543 Unclassified 610
17 Ga0070665_100481822 3300005548 Bacteria 1251
18 Ga0068855_100103977 3300005563 Bacteria 3267
19 Ga0068857_102038559 3300005577 Bacteria 563
20 Ga0068859_101441724 3300005617 Bacteria 760
21 Ga0068860_100211720 3300005843 Bacteria 1880
22 Ga0068862_101535576 3300005844 Unclassified 672
23 Ga0068862_101662895 3300005844 Unclassified 646
24 Ga0068862_102424913 3300005844 Unclassified 536
25 Ga0070717_10506631 3300006028 Bacteria 1091
26 Ga0075364_10300307 3300006051 Bacteria 1093
27 Ga0075364_11057260 3300006051 Unclassified 551
28 Ga0075367_10120846 3300006178 Bacteria 1614
29 Ga0075370_10455430 3300006353 Bacteria 770
30 Ga0075428_100065860 3300006844 Bacteria 3967
31 Ga0075428_100164666 3300006844 Bacteria 2406
32 Ga0075428_101547292 3300006844 Bacteria 694
33 Ga0075431_100635051 3300006847 Bacteria 1049
34 Ga0075434_101547194 3300006871 Bacteria 672
35 Ga0075429_100902934 3300006880 Bacteria 773
36 Ga0075429_100994455 3300006880 Unclassified 733
37 Ga0068865_101705810 3300006881 Bacteria 568
38 Ga0097620_101441704 3300006931 Bacteria 760
39 Ga0105240_11956586 3300009093 Bacteria 610
40 Ga0111539_10579228 3300009094 Archaea 1307
41 Ga0111539_10865474 3300009094 Bacteria 1051
42 Ga0111539_11042884 3300009094 Unclassified 950
43 Ga0114129_11099316 3300009147 Bacteria 995
44 Ga0114129_11518401 3300009147 Bacteria 823
45 Ga0105242_12550443 3300009176 Bacteria 560
46 Ga0105248_11174563 3300009177 Bacteria 868
47 Ga0105248_11854617 3300009177 Bacteria 684
48 Ga0105248_12735920 3300009177 Unclassified 563
49 Ga0105237_10045373 3300009545 Bacteria 4424
50 Ga0105237_11383173 3300009545 Bacteria 710
51 Ga0105237_12116156 3300009545 Unclassified 572
52 Ga0105238_10558080 3300009551 Bacteria 1150
53 Ga0105249_12062605 3300009553 Bacteria 643
54 Ga0105239_12561464 3300010375 Unclassified 595
55 Ga0105239_13139266 3300010375 Bacteria 538
56 Ga0105246_10716891 3300011119 Bacteria 878
57 Ga0105246_11873976 3300011119 Bacteria 575
58 Ga0157370_10759279 3300013104 Bacteria 883
59 Ga0157374_10338535 3300013296 Bacteria 1493
60 Ga0157378_12953702 3300013297 Bacteria 527
61 Ga0163162_12934327 3300013306 Unclassified 548
62 Ga0163163_11252223 3300014325 Unclassified 804
63 Ga0163163_12084998 3300014325 Bacteria 627
64 Ga0157380_12460898 3300014326 Unclassified 586
65 Ga0206356_11352503 3300020070 Bacteria 557
66 Ga0206350_11043735 3300020080 Unclassified 523
67 Ga0206354_11145267 3300020081 Bacteria 629
68 Ga0213873_10005903 3300021358 Bacteria 2379
69 Ga0213872_10085617 3300021361 Bacteria 1413
70 Ga0213874_10369297 3300021377 Unclassified 553
71 Ga0213875_10360066 3300021388 Bacteria 691
72 Ga0213875_10383090 3300021388 Bacteria 670
73 Ga0213875_10575098 3300021388 Bacteria 544
74 Ga0213871_10019916 3300021441 Bacteria 1657
75 Ga0224712_10352389 3300022467 Bacteria 696
76 Ga0207692_10126169 3300025898 Bacteria 1440
77 Ga0207699_10191747 3300025906 Unclassified 1380
78 Ga0207684_10313363 3300025910 Bacteria 1353
79 Ga0207695_10917643 3300025913 Bacteria 755
80 Ga0207671_10042017 3300025914 Bacteria 3384
81 Ga0207671_10965381 3300025914 Bacteria 672
82 Ga0207660_10745222 3300025917 Unclassified 799
83 Ga0207652_11765859 3300025921 Bacteria 523
84 Ga0207694_10390800 3300025924 Bacteria 1156
85 Ga0207664_10110265 3300025929 Bacteria 2288
86 Ga0207644_10792046 3300025931 Bacteria 793
87 Ga0207670_10172219 3300025936 Bacteria 1624
88 Ga0207669_11430160 3300025937 Bacteria 589
89 Ga0207704_10815931 3300025938 Bacteria 780
90 Ga0207704_11075821 3300025938 Bacteria 683
91 Ga0207691_11215903 3300025940 Unclassified 624
92 Ga0207711_10704342 3300025941 Unclassified 942
93 Ga0207667_10083465 3300025949 Bacteria 3308
94 Ga0207712_10369522 3300025961 Bacteria 1197
95 Ga0207668_10995777 3300025972 Unclassified 749
96 Ga0207674_11909862 3300026116 Bacteria 560
97 Ga0207675_102390980 3300026118 Bacteria 541
98 Ga0209974_10338315 3300027876 Unclassified 582
99 Ga0268266_10856788 3300028379 Bacteria 878
100 Ga0268264_10379469 3300028381 Bacteria 1353
101 Ga0307413_11355069 3300031824 Bacteria 624
102 Ga0307416_101786006 3300032002 Bacteria 719
103 Ga0373935_1488203 3300035692 Bacteria 507
104 Ga0373933_0424029 3300035724 Bacteria 869
105 Ga0436364_0004585 3300037853 Bacteria 507
106 Ga0436364_0060334 3300037853 Bacteria 1970
107 Ga0436364_0653138 3300037853 Bacteria 655
108 Ga0436364_1086400 3300037853 Bacteria 526
109 Ga0436364_1181768 3300037853 Bacteria 935
110 Ga0436364_1403617 3300037853 Bacteria 591
111 Ga0436364_1555426 3300037853 Bacteria 1096
112 Ga0436365_0143225 3300039437 Bacteria 552
113 Ga0436360_0291479 3300039438 Unclassified 561
114 Ga0436360_0688064 3300039438 Bacteria 578
115 Ga0436360_1016865 3300039438 Bacteria 5299
116 Ga0436361_0016095 3300039447 Bacteria 593
117 Ga0436361_0144144 3300039447 Unclassified 521
118 Ga0436361_0222739 3300039447 Bacteria 658
119 Ga0436361_0334897 3300039447 Unclassified 559
120 Ga0436363_0126830 3300039450 Bacteria 541
121 Ga0436363_0418619 3300039450 Bacteria 799
122 Ga0436363_0716681 3300039450 Bacteria 515
123 Ga0436363_0744824 3300039450 Bacteria 1281
124 Ga0451800_0638787 3300041459 Bacteria 520
125 Ga0451837_0422732 3300041494 Bacteria 659
126 Ga0451847_0516891 3300041503 Bacteria 635
127 Ga0466965_0879832 3300044683 Bacteria 522
128 Ga0466961_0915954 3300044693 Bacteria 522
129 Ga0466957_0672766 3300044842 Bacteria 729
130 Ga0495628_0519537 3300046516 Bacteria 858
131 Ga0495645_0955055 3300046543 Bacteria 506
132 Ga0495635_0840032 3300046663 Bacteria 590
133 Ga0495599_0547104 3300046678 Unclassified 678
134 Ga0495613_0969903 3300046689 Bacteria 547
135 Ga0495674_0417062 3300047319 Bacteria 1082
136 Ga0495672_0255484 3300047320 Bacteria 848
137 Ga0496104_0341940 3300048907 Bacteria 1409
138 Ga0496104_0402707 3300048907 Bacteria 1281
139 Ga0496105_0916462 3300048908 Bacteria 660
140 Ga0496110_0520905 3300048913 Bacteria 1082
141 Ga0496111_0010817 3300048914 Bacteria 6133
142 Ga0496112_1709939 3300048915 Bacteria 542
143 Ga0496114_1448929 3300048917 Bacteria 574
144 Ga0496115_1055561 3300048918 Bacteria 618
145 Ga0501291_170438 3300049514 Bacteria 503
146 Ga0501032_0886613 3300049569 Bacteria 562
147 Ga0501033_0013513 3300049570 Bacteria 6215
148 Ga0501033_0453674 3300049570 Bacteria 890
149 Ga0501033_0875673 3300049570 Bacteria 604
150 Ga0501034_0003548 3300049571 Bacteria 17726
151 Ga0501034_0005568 3300049571 Bacteria 13723
152 Ga0501034_0015129 3300049571 Bacteria 7930
153 Ga0501034_0146564 3300049571 Bacteria 2338
154 Ga0501034_0151699 3300049571 Unclassified 2293
155 Ga0501034_0196174 3300049571 Bacteria 1979
156 Ga0501034_0431150 3300049571 Bacteria 1238
157 Ga0501034_0882574 3300049571 Unclassified 783
158 Ga0501036_0090692 3300049572 Unclassified 2582
159 Ga0501036_0296357 3300049572 Unclassified 1353
160 Ga0501038_1169846 3300049574 Bacteria 559
161 Ga0501039_0252517 3300049575 Bacteria 1386
162 Ga0501040_0534672 3300049576 Unclassified 846
163 Ga0501041_0181581 3300049577 Bacteria 1317
164 Ga0501042_0291916 3300049578 Bacteria 1178
165 Ga0501042_0387149 3300049578 Unclassified 1013
166 Ga0501042_1408542 3300049578 Bacteria 508
167 Ga0501043_0222799 3300049579 Bacteria 1458
168 Ga0501046_0012504 3300049580 Bacteria 7223
169 Ga0501046_0179796 3300049580 Unclassified 1582
170 Ga0501047_0066623 3300049581 Bacteria 3471
171 Ga0501047_0099982 3300049581 Bacteria 2779
172 Ga0501048_0585618 3300049582 Bacteria 801
173 Ga0501048_1084619 3300049582 Bacteria 576
174 Ga0501070_0012915 3300049586 Bacteria 7038
175 Ga0501070_0856558 3300049586 Bacteria 711
176 Ga0501072_0329070 3300049588 Bacteria 1214
177 Ga0501072_0954233 3300049588 Bacteria 669
178 Ga0501073_0431748 3300049589 Bacteria 910
179 Ga0501075_1024922 3300049591 Bacteria 627
180 Ga0501076_0213428 3300049592 Bacteria 1577
181 Ga0501076_1557940 3300049592 Bacteria 542
182 Ga0501080_1632737 3300049742 Unclassified 545
183 Ga0501081_0368866 3300049743 Bacteria 1060
184 Ga0501081_0564816 3300049743 Bacteria 850
185 Ga0501083_0743353 3300049744 Bacteria 638
186 Ga0501035_0523571 3300049822 Bacteria 974
187 Ga0501035_0974756 3300049822 Bacteria 668
188 Ga0501044_0084226 3300049823 Bacteria 3214
189 Ga0501044_0151648 3300049823 Bacteria 2300
190 Ga0501044_0347253 3300049823 Bacteria 1404
191 Ga0501044_1255307 3300049823 Bacteria 608
192 Ga0501044_1392856 3300049823 Bacteria 567
193 Ga0501045_0168526 3300049824 Bacteria 1631
194 nmdc:mga00v17_241749_c1 3300050491 Bacteria 1170
195 nmdc:mga06z11_152849_c1 3300050494 Bacteria 1313
196 nmdc:mga07m45_677875_c1 3300050496 Bacteria 593
197 nmdc:mga05p37_1775113_c1 3300050507 Bacteria 597
198 nmdc:mga09592_1319232_c1 3300050508 Bacteria 593
199 nmdc:mga06r32_1617907_c1 3300050510 Bacteria 586
200 nmdc:mga08y16_1064048_c1 3300050511 Unclassified 786
201 nmdc:mga08y16_1937555_c1 3300050511 Bacteria 539
202 Ga0495601_0302332 3300053077 Bacteria 1042
203 Ga0495612_0505286 3300053078 Bacteria 555
204 Ga0495619_0037381 3300053085 Bacteria 3163
205 Ga0495619_0623380 3300053085 Bacteria 737
206 Ga0501084_1334784 3300054114 Bacteria 601
207 Ga0587077_230138 3300059493 Bacteria 527
208 Ga0501082_0247705 3300060353 Bacteria 1551
209 Ga0530510_0291711 3300061734 Bacteria 1220
210 Ga0530510_0857128 3300061734 Bacteria 694
211 2687240410 2684623219 Bacteria 8442773
212 2688070180 2687453257 Bacteria 6784659
213 2688391193 2687453341 Bacteria 6534136
214 Ga0451853_2124689
215 MRS1b_contig_1754898
216 Ga0058859_11600715
217 Ga0065707_10792098
218 Ga0070690_101227384
219 Ga0070680_100634047
220 Ga0070689_100265393
221 Ga0070671_101359242
222 Ga0070674_102094423
223 Ga0070688_100360901
224 Ga0070714_100175711
225 Ga0070710_10140442
226 Ga0070662_101938858
227 Ga0070706_100382717
228 Ga0070679_101067500
229 Ga0070672_101471815
230 Ga0070665_100481822
231 Ga0068855_100103977
232 Ga0068857_102038559
233 Ga0068859_101441724
234 Ga0068860_100211720
235 Ga0068862_101535576
236 Ga0068862_101662895
237 Ga0068862_102424913
238 Ga0070717_10506631
239 Ga0075364_10300307
240 Ga0075364_11057260
241 Ga0075367_10120846
242 Ga0075370_10455430
243 Ga0075428_100065860
244 Ga0075428_100164666
245 Ga0075428_101547292
246 Ga0075431_100635051
247 Ga0075434_101547194
248 Ga0075429_100902934
249 Ga0075429_100994455
250 Ga0068865_101705810
251 Ga0097620_101441704
252 Ga0105240_11956586
253 Ga0111539_10579228
254 Ga0111539_10865474
255 Ga0111539_11042884
256 Ga0114129_11099316
257 Ga0114129_11518401
258 Ga0105242_12550443
259 Ga0105248_11174563
260 Ga0105248_11854617
261 Ga0105248_12735920
262 Ga0105237_10045373
263 Ga0105237_11383173
264 Ga0105237_12116156
265 Ga0105238_10558080
266 Ga0105249_12062605
267 Ga0105239_12561464
268 Ga0105239_13139266
269 Ga0105246_10716891
270 Ga0105246_11873976
271 Ga0157370_10759279
272 Ga0157374_10338535
273 Ga0157378_12953702
274 Ga0163162_12934327
275 Ga0163163_11252223
276 Ga0163163_12084998
277 Ga0157380_12460898
278 Ga0206356_11352503
279 Ga0206350_11043735
280 Ga0206354_11145267
281 Ga0213873_10005903
282 Ga0213872_10085617
283 Ga0213874_10369297
284 Ga0213875_10360066
285 Ga0213875_10383090
286 Ga0213875_10575098
287 Ga0213871_10019916
288 Ga0224712_10352389
289 Ga0207692_10126169
290 Ga0207699_10191747
291 Ga0207684_10313363
292 Ga0207695_10917643
293 Ga0207671_10042017
294 Ga0207671_10965381
295 Ga0207660_10745222
296 Ga0207652_11765859
297 Ga0207694_10390800
298 Ga0207664_10110265
299 Ga0207644_10792046
300 Ga0207670_10172219
301 Ga0207669_11430160
302 Ga0207704_10815931
303 Ga0207704_11075821
304 Ga0207691_11215903
305 Ga0207711_10704342
306 Ga0207667_10083465
307 Ga0207712_10369522
308 Ga0207668_10995777
309 Ga0207674_11909862
310 Ga0207675_102390980
311 Ga0209974_10338315
312 Ga0268266_10856788
313 Ga0268264_10379469
314 Ga0307413_11355069
315 Ga0307416_101786006
316 Ga0373935_1488203
317 Ga0373933_0424029
318 Ga0436364_0004585
319 Ga0436364_0060334
320 Ga0436364_0653138
321 Ga0436364_1086400
322 Ga0436364_1181768
323 Ga0436364_1403617
324 Ga0436364_1555426
325 Ga0436365_0143225
326 Ga0436360_0291479
327 Ga0436360_0688064
328 Ga0436360_1016865
329 Ga0436361_0016095
330 Ga0436361_0144144
331 Ga0436361_0222739
332 Ga0436361_0334897
333 Ga0436363_0126830
334 Ga0436363_0418619
335 Ga0436363_0716681
336 Ga0436363_0744824
337 Ga0451800_0638787
338 Ga0451837_0422732
339 Ga0451847_0516891
340 Ga0466965_0879832
341 Ga0466961_0915954
342 Ga0466957_0672766
343 Ga0495628_0519537
344 Ga0495645_0955055
345 Ga0495635_0840032
346 Ga0495599_0547104
347 Ga0495613_0969903
348 Ga0495674_0417062
349 Ga0495672_0255484
350 Ga0496104_0341940
351 Ga0496104_0402707
352 Ga0496105_0916462
353 Ga0496110_0520905
354 Ga0496111_0010817
355 Ga0496112_1709939
356 Ga0496114_1448929
357 Ga0496115_1055561
358 Ga0501291_170438
359 Ga0501032_0886613
360 Ga0501033_0013513
361 Ga0501033_0453674
362 Ga0501033_0875673
363 Ga0501034_0003548
364 Ga0501034_0005568
365 Ga0501034_0015129
366 Ga0501034_0146564
367 Ga0501034_0151699
368 Ga0501034_0196174
369 Ga0501034_0431150
370 Ga0501034_0882574
371 Ga0501036_0090692
372 Ga0501036_0296357
373 Ga0501038_1169846
374 Ga0501039_0252517
375 Ga0501040_0534672
376 Ga0501041_0181581
377 Ga0501042_0291916
378 Ga0501042_0387149
379 Ga0501042_1408542
380 Ga0501043_0222799
381 Ga0501046_0012504
382 Ga0501046_0179796
383 Ga0501047_0066623
384 Ga0501047_0099982
385 Ga0501048_0585618
386 Ga0501048_1084619
387 Ga0501070_0012915
388 Ga0501070_0856558
389 Ga0501072_0329070
390 Ga0501072_0954233
391 Ga0501073_0431748
392 Ga0501075_1024922
393 Ga0501076_0213428
394 Ga0501076_1557940
395 Ga0501080_1632737
396 Ga0501081_0368866
397 Ga0501081_0564816
398 Ga0501083_0743353
399 Ga0501035_0523571
400 Ga0501035_0974756
401 Ga0501044_0084226
402 Ga0501044_0151648
403 Ga0501044_0347253
404 Ga0501044_1255307
405 Ga0501044_1392856
406 Ga0501045_0168526
407 nmdc:mga00v17_241749_c1
408 nmdc:mga06z11_152849_c1
409 nmdc:mga07m45_677875_c1
410 nmdc:mga05p37_1775113_c1
411 nmdc:mga09592_1319232_c1
412 nmdc:mga06r32_1617907_c1
413 nmdc:mga08y16_1064048_c1
414 nmdc:mga08y16_1937555_c1
415 Ga0495601_0302332
416 Ga0495612_0505286
417 Ga0495619_0037381
418 Ga0495619_0623380
419 Ga0501084_1334784
420 Ga0587077_230138
421 Ga0501082_0247705
422 Ga0530510_0291711
423 Ga0530510_0857128
424 2687240410
425 2688070180
426 2688391193

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01192

RNA_pol_Rpb6

RNA polymerase Rpb6

9

60

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
7z1m-assembly1.cif.gz_F structure of yeast rna polymerase iii elongation complex (ec) 0.9152 17 58
6z9t-assembly1.cif.gz_W transcription termination intermediate complex 5 0.9124 8 60
8e6x-assembly1.cif.gz_E escherichia coli rho-dependent transcription pre-termination complex containing 18 nt long rna spacer, lambda-tr1 rut rna, mg-adp-bef3, and nusg; tec part 0.9065 8 60
8e3f-assembly1.cif.gz_E escherichia coli rho-dependent transcription pre-termination complex containing 18 nt long rna spacer, mg-adp-bef3, and nusg; tec part 0.9065 8 60
8e6z-assembly1.cif.gz_E escherichia coli rho-dependent transcription pre-termination complex containing 18 nt long rna spacer, dc75 rut mimic rna, mg-adp-bef3, and nusg; tec part 0.9065 8 60
ID Description Score Start End Superfamily
2nvsF00 Alpha Beta;Alpha-Beta Complex;Eukaryotic RPB6 RNA polymerase subunit;RNA polymerase subunit, RPB6/omega 0.8994 17 59 3.90.940.10
6govW00 Alpha Beta;Alpha-Beta Complex;Eukaryotic RPB6 RNA polymerase subunit;RNA polymerase subunit, RPB6/omega 0.8913 8 56 3.90.940.10
6asxK00 Alpha Beta;Alpha-Beta Complex;Eukaryotic RPB6 RNA polymerase subunit;RNA polymerase subunit, RPB6/omega 0.8892 8 56 3.90.940.10
5iplE00 Alpha Beta;Alpha-Beta Complex;Eukaryotic RPB6 RNA polymerase subunit;RNA polymerase subunit, RPB6/omega 0.8799 8 56 3.90.940.10
6n60E00 Alpha Beta;Alpha-Beta Complex;Eukaryotic RPB6 RNA polymerase subunit;RNA polymerase subunit, RPB6/omega 0.8745 8 56 3.90.940.10
ID Description Score Start End GO Terms
AF-A0A177QQR3-F1-model_v4 deleted 1.006 1 62
AF-A0A2S8F5Q1-F1-model_v4 DNA-directed RNA polymerase subunit omega (RNAP omega subunit) (EC 2.7.7.6) (RNA polymerase omega subunit) (Transcriptase subunit omega) 0.9992 1 72 GO:0000428
GO:0001054
GO:0001055
GO:0001056
GO:0001057
GO:0001058
GO:0001066
GO:0003677
AF-A0A7C4UFX1-F1-model_v4 DNA-directed RNA polymerase subunit omega (RNAP omega subunit) (EC 2.7.7.6) (RNA polymerase omega subunit) (Transcriptase subunit omega) 0.9968 1 72 GO:0000428
GO:0001054
GO:0001055
GO:0001056
GO:0001057
GO:0001058
GO:0001066
GO:0003677
AF-A0A2E1X0G0-F1-model_v4 DNA-directed RNA polymerase subunit omega 0.9892 6 62 GO:0000428
GO:0003677
GO:0003899
GO:0006351
AF-A0A177QQR3-F1-model_v4 deleted 0.9746 1 62

Map