F324278

General Info

Members Datasets Scaffolds Average Seq Length
213 155 426 209

Family's Representative Sequence

Representative Sequence 3300037471|Ga0395905_0082373|Ga0395905_0082373_1446_2168
Length 240
Sequence MGGDFSAAAQDTRASDAGLRWCRRRAARDDAGMSPHAFVPLRRTCVAAIALGPVFIRDLRAQPRLAPTPAQTEGPFYPVDTSGDTDYDLLQRAGHPAYAKGRPVWLEGTVTDTSGRPLAGAQVEIWQCDEQGHYHHPGDGGRADPSFQGFGRVTLDREGRYRFHTIRPAPYSGRTPHIHVKVRQGGRELLTTQLYVAGEARNARDGLWRSLSAAQRERLTMPFVERAEGLAVRFPIVVEG

Samples

Sample ID Description Type Environment
1 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
2 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
3 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
4 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
5 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
6 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
7 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
21 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
22 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
23 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
24 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
25 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
26 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
27 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
28 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
29 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
30 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
31 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
32 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
33 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
34 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
35 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
36 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
37 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
38 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
40 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
41 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
42 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
43 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
44 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
45 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
46 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
47 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
48 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
49 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
50 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
51 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
52 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
53 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
54 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
55 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
56 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
69 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
71 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
72 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
73 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
74 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
75 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
76 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
77 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
78 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
79 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
80 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
81 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
82 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
83 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
84 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
85 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
86 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
87 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
88 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
89 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
90 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
91 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
92 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
93 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
94 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
95 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
96 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
97 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
98 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
99 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
100 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
101 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
102 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
103 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
104 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
105 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
106 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
107 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
108 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
109 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
110 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
111 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
112 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
113 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
114 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
115 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
116 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
117 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
118 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
119 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
120 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
121 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
122 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
123 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
124 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
125 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
126 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
127 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
128 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
129 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
130 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
131 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
132 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
133 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
134 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
135 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
136 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
137 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
138 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
139 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
140 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
141 2547132374 Acidovorax radicis N35 Isolate Unclassified
142 2643221609 Acidovorax sp. Root217 Isolate Unclassified
143 2643221611 Acidovorax sp. Root219 Isolate Unclassified
144 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
145 2643221717 Acidovorax sp. Root267 Isolate Unclassified
146 2738543012 Acidovorax sp. CF301 Isolate Unclassified
147 2842677519 Variovorax sp. R-72495 Isolate Unclassified
148 2842733646 Variovorax sp. R-72446 Isolate Unclassified
149 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
150 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
151 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
152 2904456579 Variovorax sp. 2002 Isolate Unclassified
153 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
154 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
155 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.08
Metatranscriptomes 0.94
Isolates 7.98

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 23.47
Nodule 1.41
Rhizoplane 0.47
Rhizosphere 62.91
Stem 0
Stem Tuber 0
Unclassified 1.88

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395905_0082373 3300037471 Bacteria 3015
2 Ga0006562J51391_1205898 3300003578 Bacteria 1625
3 Ga0006562J51391_1205899 3300003578 Bacteria 1540
4 Ga0055537_1000068 3300003773 Bacteria 75642
5 Ga0055534_1000080 3300003784 Bacteria 75642
6 Ga0055534_1015664 3300003784 Bacteria 1383
7 Ga0055528_1000159 3300003790 Bacteria 56331
8 Ga0055540_1000446 3300003792 Bacteria 32406
9 Ga0065714_10068956 3300005288 Bacteria 4451
10 Ga0065715_10235697 3300005293 Bacteria 1197
11 Ga0070658_10441279 3300005327 Bacteria 1121
12 Ga0070676_10004809 3300005328 Bacteria 7148
13 Ga0070670_100310226 3300005331 Bacteria 1381
14 Ga0070677_10053365 3300005333 Bacteria 1643
15 Ga0068869_100121422 3300005334 Bacteria 1999
16 Ga0068869_100578149 3300005334 Bacteria 947
17 Ga0070680_100149004 3300005336 Bacteria 1964
18 Ga0070669_100558751 3300005353 Bacteria 955
19 Ga0070671_100399477 3300005355 Bacteria 1176
20 Ga0070674_100856278 3300005356 Bacteria 789
21 Ga0068867_100006868 3300005459 Bacteria 8052
22 Ga0068867_100103455 3300005459 Bacteria 2178
23 Ga0068867_100808107 3300005459 Unclassified 837
24 Ga0070679_100015358 3300005530 Bacteria 7358
25 Ga0070679_100096880 3300005530 Bacteria 2938
26 Ga0068853_100212662 3300005539 Bacteria 1763
27 Ga0070665_100111594 3300005548 Bacteria 2736
28 Ga0068856_100421766 3300005614 Bacteria 1354
29 Ga0068859_100050598 3300005617 Bacteria 4173
30 Ga0068859_100933396 3300005617 Unclassified 952
31 Ga0068864_100029457 3300005618 Bacteria 4650
32 Ga0068861_100695227 3300005719 Bacteria 944
33 Ga0068863_100501549 3300005841 Bacteria 1195
34 Ga0068858_100209256 3300005842 Unclassified 1846
35 Ga0068860_100015561 3300005843 Bacteria 7429
36 Ga0068862_100240490 3300005844 Bacteria 1646
37 Ga0075365_10006671 3300006038 Bacteria 6377
38 Ga0075365_10098211 3300006038 Bacteria 2003
39 Ga0075363_100031256 3300006048 Bacteria 2759
40 Ga0075432_10080803 3300006058 Bacteria 1178
41 Ga0075362_10016748 3300006177 Bacteria 3007
42 Ga0075362_10077212 3300006177 Bacteria 1530
43 Ga0075367_10019976 3300006178 Bacteria 3724
44 Ga0075367_10058937 3300006178 Bacteria 2285
45 Ga0075369_10030946 3300006186 Bacteria 2256
46 Ga0075366_10000418 3300006195 Bacteria 19907
47 Ga0075366_10036220 3300006195 Bacteria 2909
48 Ga0075366_10061954 3300006195 Bacteria 2224
49 Ga0075366_10375526 3300006195 Bacteria 874
50 Ga0075366_10471183 3300006195 Bacteria 775
51 Ga0075370_10004420 3300006353 Bacteria 6824
52 Ga0075370_10131983 3300006353 Bacteria 1458
53 Ga0075370_10282876 3300006353 Bacteria 985
54 Ga0097620_100050599 3300006931 Bacteria 4173
55 Ga0097620_100933283 3300006931 Unclassified 952
56 Ga0099826_10000121 3300006948 Bacteria 35285
57 Ga0099826_10074340 3300006948 Bacteria 2144
58 Ga0105240_10014846 3300009093 Bacteria 10617
59 Ga0105243_11107963 3300009148 Bacteria 800
60 Ga0105248_10039077 3300009177 Bacteria 5314
61 Ga0105248_10287624 3300009177 Bacteria 1851
62 Ga0105238_10731316 3300009551 Bacteria 1003
63 Ga0105249_10331240 3300009553 Bacteria 1536
64 Ga0157374_10048575 3300013296 Bacteria 3937
65 Ga0163162_10287223 3300013306 Bacteria 1777
66 Ga0182008_10000904 3300014497 Bacteria 20630
67 Ga0183362_10005 3300015683 Bacteria 437616
68 Ga0163161_10019554 3300017792 Bacteria 4752
69 Ga0209565_1000073 3300025263 Bacteria 164695
70 Ga0209673_1000127 3300025273 Bacteria 164695
71 Ga0209673_1005202 3300025273 Bacteria 6636
72 Ga0209675_1000029 3300025291 Bacteria 281053
73 Ga0209675_1047351 3300025291 Bacteria 904
74 Ga0209676_1046738 3300025292 Bacteria 1168
75 Ga0209025_1044223 3300025294 Bacteria 1865
76 Ga0209051_1000298 3300025303 Bacteria 78777
77 Ga0207682_10029505 3300025893 Bacteria 2193
78 Ga0207695_10086300 3300025913 Bacteria 3166
79 Ga0207657_10024844 3300025919 Bacteria 5538
80 Ga0207652_10093027 3300025921 Bacteria 2653
81 Ga0207681_10543449 3300025923 Bacteria 955
82 Ga0207709_10382662 3300025935 Bacteria 1071
83 Ga0207669_10916259 3300025937 Bacteria 733
84 Ga0207711_10348556 3300025941 Bacteria 1371
85 Ga0207667_10334676 3300025949 Bacteria 1545
86 Ga0207639_10224015 3300026041 Bacteria 1626
87 Ga0207639_11042587 3300026041 Bacteria 766
88 Ga0207702_10393745 3300026078 Bacteria 1335
89 Ga0207641_10365762 3300026088 Bacteria 1378
90 Ga0207641_10406208 3300026088 Bacteria 1309
91 Ga0209282_1000488 3300027666 Bacteria 19243
92 Ga0268266_10082805 3300028379 Bacteria 2799
93 Ga0314311_1104870 3300030733 Bacteria 2990
94 Ga0316180_1192479 3300030736 Bacteria 2523
95 Ga0316183_1026033 3300030742 Bacteria 4388
96 Ga0316181_1161636 3300030744 Bacteria 1306
97 Ga0316182_1032218 3300030745 Bacteria 1315
98 Ga0316182_1446246 3300030745 Bacteria 1555
99 Ga0307513_10000017 3300031456 Bacteria 282386
100 Ga0307513_10496523 3300031456 Bacteria 938
101 Ga0307514_10003203 3300031649 Bacteria 15988
102 Ga0307516_10005084 3300031730 Bacteria 15902
103 Ga0307516_10018427 3300031730 Bacteria 7255
104 Ga0307516_10064470 3300031730 Bacteria 3543
105 Ga0307412_10057752 3300031911 Bacteria 2592
106 Ga0307412_10328242 3300031911 Bacteria 1220
107 Ga0307412_10366691 3300031911 Bacteria 1162
108 Ga0307412_10473897 3300031911 Bacteria 1036
109 Ga0307412_10500013 3300031911 Bacteria 1012
110 Ga0307412_10624776 3300031911 Bacteria 915
111 Ga0307416_100745533 3300032002 Bacteria 1072
112 Ga0307416_101175700 3300032002 Bacteria 872
113 Ga0307416_102030905 3300032002 Bacteria 677
114 Ga0307414_10201706 3300032004 Bacteria 1618
115 Ga0307411_10091228 3300032005 Bacteria 2127
116 Ga0307411_10201587 3300032005 Bacteria 1528
117 Ga0395899_0003428 3300037312 Bacteria 12573
118 Ga0395900_0432174 3300037418 Bacteria 1276
119 Ga0395900_0619859 3300037418 Bacteria 1021
120 Ga0395898_0040428 3300037466 Bacteria 4611
121 Ga0395898_0114942 3300037466 Bacteria 2579
122 Ga0395905_0000065 3300037471 Bacteria 184928
123 Ga0395905_0009059 3300037471 Bacteria 9763
124 Ga0395905_0316239 3300037471 Bacteria 1450
125 Ga0395905_0363233 3300037471 Bacteria 1340
126 Ga0395905_0611643 3300037471 Bacteria 992
127 Ga0395901_0122492 3300038443 Bacteria 2733
128 Ga0395901_0266462 3300038443 Bacteria 1782
129 Ga0395901_0751553 3300038443 Bacteria 968
130 Ga0439439_0056116 3300041406 Bacteria 1040
131 Ga0439453_0031400 3300041408 Bacteria 1008
132 Ga0439466_0001330 3300041411 Bacteria 9632
133 Ga0439465_0001529 3300041413 Bacteria 7518
134 Ga0451853_3414805 3300041512 Bacteria 1134
135 Ga0439433_0004816 3300041999 Bacteria 2900
136 Ga0439433_0014769 3300041999 Bacteria 1722
137 Ga0439437_017934 3300042000 Bacteria 844
138 Ga0439445_0000796 3300042004 Bacteria 6628
139 Ga0439432_000358 3300042006 Bacteria 16718
140 Ga0439449_0001898 3300042007 Bacteria 8215
141 Ga0439449_0002278 3300042007 Bacteria 7532
142 Ga0439449_0033488 3300042007 Bacteria 1913
143 Ga0439449_0139894 3300042007 Bacteria 901
144 Ga0439452_010282 3300042010 Bacteria 2728
145 Ga0439457_025101 3300042014 Bacteria 1319
146 Ga0450898_004865 3300042134 Bacteria 2006
147 Ga0439446_0002091 3300042156 Bacteria 4742
148 Ga0439446_0029738 3300042156 Bacteria 1577
149 Ga0450908_003574 3300042184 Bacteria 3026
150 Ga0439434_0000586 3300042435 Bacteria 10519
151 Ga0439435_0069595 3300042436 Bacteria 1040
152 Ga0439459_0004993 3300042438 Bacteria 2161
153 Ga0439464_0175858 3300042439 Bacteria 676
154 Ga0439460_0181245 3300042461 Bacteria 712
155 Ga0450918_005626 3300042531 Bacteria 2249
156 Ga0466965_0035924 3300044683 Bacteria 2429
157 Ga0453684_0316353 3300044712 Bacteria 1769
158 Ga0466960_0252831 3300044901 Bacteria 979
159 Ga0451576_0075370 3300045051 Bacteria 3511
160 Ga0451576_0357048 3300045051 Bacteria 1530
161 Ga0495620_0083366 3300046515 Bacteria 1290
162 Ga0495621_0211598 3300046539 Bacteria 782
163 Ga0495625_0123574 3300046660 Bacteria 1759
164 Ga0495659_0096172 3300046664 Bacteria 1143
165 Ga0495661_0139929 3300046665 Bacteria 1318
166 Ga0495588_0008262 3300046674 Bacteria 4767
167 Ga0495671_0019861 3300046692 Bacteria 3546
168 Ga0496114_0297606 3300048917 Bacteria 1424
169 Ga0496122_0000274 3300048925 Bacteria 115100
170 Ga0496123_0000262 3300048926 Bacteria 106366
171 Ga0496124_0029439 3300048927 Bacteria 4893
172 Ga0496124_0199549 3300048927 Bacteria 1522
173 Ga0501249_005505 3300049679 Bacteria 2588
174 Ga0501225_0001811 3300049705 Bacteria 6692
175 Ga0501262_002527 3300049759 Bacteria 2067
176 nmdc:mga03683_4207_c1 3300050489 Bacteria 4744
177 nmdc:mga03n38_9578_c1 3300050490 Bacteria 3530
178 nmdc:mga0yw44_329473_c1 3300050492 Bacteria 1026
179 nmdc:mga0k408_267129_c1 3300050493 Bacteria 1021
180 nmdc:mga0k408_27030_c1 3300050493 Bacteria 3256
181 nmdc:mga0k408_6170_c1 3300050493 Bacteria 6391
182 nmdc:mga0k408_9243_c1 3300050493 Bacteria 5310
183 nmdc:mga06z11_155387_c1 3300050494 Bacteria 1304
184 nmdc:mga07m45_227820_c1 3300050496 Bacteria 1084
185 nmdc:mga07m45_372706_c1 3300050496 Bacteria 829
186 nmdc:mga0sz30_11105_c1 3300050516 Bacteria 3467
187 Ga0500610_0000575 3300053079 Bacteria 11291
188 Ga0500610_0048391 3300053079 Bacteria 2210
189 Ga0500644_0068793 3300053088 Bacteria 1270
190 Ga0500562_005686 3300053108 Bacteria 3139
191 Ga0500569_036452 3300053109 Bacteria 1416
192 Ga0500593_000242 3300053117 Bacteria 22487
193 Ga0500607_000025 3300053121 Bacteria 95473
194 Ga0500577_0230010 3300053142 Bacteria 804
195 Ga0500627_0019768 3300053158 Bacteria 2689
196 Ga0500634_0058675 3300053161 Bacteria 2050
197 2548498610 2547132374 Bacteria 5530232
198 2644061237 2643221609 Bacteria 6756331
199 2644074405 2643221611 Bacteria 6820941
200 2644075379 2643221611 Bacteria 6820941
201 2644159669 2643221628 Bacteria 5745828
202 2644649345 2643221717 Bacteria 5676132
203 2739243566 2738543012 Bacteria 7115078
204 2739244919 2738543012 Bacteria 7115078
205 2842679990 2842677519 Bacteria 5615038
206 2842735531 2842733646 Bacteria 5716726
207 2881101247 2881101125 Bacteria 4590519
208 2885194928 2885192300 Bacteria 5882526
209 2904454319 2904449895 Bacteria 6927402
210 2904462685 2904456579 Bacteria 6819253
211 2919707820 2919704043 Bacteria 5560311
212 2945977281 2945972063 Bacteria 6086495
213 2954772229 2954767861 Bacteria 5535784
214 Ga0395905_0082373
215 Ga0006562J51391_1205898
216 Ga0006562J51391_1205899
217 Ga0055537_1000068
218 Ga0055534_1000080
219 Ga0055534_1015664
220 Ga0055528_1000159
221 Ga0055540_1000446
222 Ga0065714_10068956
223 Ga0065715_10235697
224 Ga0070658_10441279
225 Ga0070676_10004809
226 Ga0070670_100310226
227 Ga0070677_10053365
228 Ga0068869_100121422
229 Ga0068869_100578149
230 Ga0070680_100149004
231 Ga0070669_100558751
232 Ga0070671_100399477
233 Ga0070674_100856278
234 Ga0068867_100006868
235 Ga0068867_100103455
236 Ga0068867_100808107
237 Ga0070679_100015358
238 Ga0070679_100096880
239 Ga0068853_100212662
240 Ga0070665_100111594
241 Ga0068856_100421766
242 Ga0068859_100050598
243 Ga0068859_100933396
244 Ga0068864_100029457
245 Ga0068861_100695227
246 Ga0068863_100501549
247 Ga0068858_100209256
248 Ga0068860_100015561
249 Ga0068862_100240490
250 Ga0075365_10006671
251 Ga0075365_10098211
252 Ga0075363_100031256
253 Ga0075432_10080803
254 Ga0075362_10016748
255 Ga0075362_10077212
256 Ga0075367_10019976
257 Ga0075367_10058937
258 Ga0075369_10030946
259 Ga0075366_10000418
260 Ga0075366_10036220
261 Ga0075366_10061954
262 Ga0075366_10375526
263 Ga0075366_10471183
264 Ga0075370_10004420
265 Ga0075370_10131983
266 Ga0075370_10282876
267 Ga0097620_100050599
268 Ga0097620_100933283
269 Ga0099826_10000121
270 Ga0099826_10074340
271 Ga0105240_10014846
272 Ga0105243_11107963
273 Ga0105248_10039077
274 Ga0105248_10287624
275 Ga0105238_10731316
276 Ga0105249_10331240
277 Ga0157374_10048575
278 Ga0163162_10287223
279 Ga0182008_10000904
280 Ga0183362_10005
281 Ga0163161_10019554
282 Ga0209565_1000073
283 Ga0209673_1000127
284 Ga0209673_1005202
285 Ga0209675_1000029
286 Ga0209675_1047351
287 Ga0209676_1046738
288 Ga0209025_1044223
289 Ga0209051_1000298
290 Ga0207682_10029505
291 Ga0207695_10086300
292 Ga0207657_10024844
293 Ga0207652_10093027
294 Ga0207681_10543449
295 Ga0207709_10382662
296 Ga0207669_10916259
297 Ga0207711_10348556
298 Ga0207667_10334676
299 Ga0207639_10224015
300 Ga0207639_11042587
301 Ga0207702_10393745
302 Ga0207641_10365762
303 Ga0207641_10406208
304 Ga0209282_1000488
305 Ga0268266_10082805
306 Ga0314311_1104870
307 Ga0316180_1192479
308 Ga0316183_1026033
309 Ga0316181_1161636
310 Ga0316182_1032218
311 Ga0316182_1446246
312 Ga0307513_10000017
313 Ga0307513_10496523
314 Ga0307514_10003203
315 Ga0307516_10005084
316 Ga0307516_10018427
317 Ga0307516_10064470
318 Ga0307412_10057752
319 Ga0307412_10328242
320 Ga0307412_10366691
321 Ga0307412_10473897
322 Ga0307412_10500013
323 Ga0307412_10624776
324 Ga0307416_100745533
325 Ga0307416_101175700
326 Ga0307416_102030905
327 Ga0307414_10201706
328 Ga0307411_10091228
329 Ga0307411_10201587
330 Ga0395899_0003428
331 Ga0395900_0432174
332 Ga0395900_0619859
333 Ga0395898_0040428
334 Ga0395898_0114942
335 Ga0395905_0000065
336 Ga0395905_0009059
337 Ga0395905_0316239
338 Ga0395905_0363233
339 Ga0395905_0611643
340 Ga0395901_0122492
341 Ga0395901_0266462
342 Ga0395901_0751553
343 Ga0439439_0056116
344 Ga0439453_0031400
345 Ga0439466_0001330
346 Ga0439465_0001529
347 Ga0451853_3414805
348 Ga0439433_0004816
349 Ga0439433_0014769
350 Ga0439437_017934
351 Ga0439445_0000796
352 Ga0439432_000358
353 Ga0439449_0001898
354 Ga0439449_0002278
355 Ga0439449_0033488
356 Ga0439449_0139894
357 Ga0439452_010282
358 Ga0439457_025101
359 Ga0450898_004865
360 Ga0439446_0002091
361 Ga0439446_0029738
362 Ga0450908_003574
363 Ga0439434_0000586
364 Ga0439435_0069595
365 Ga0439459_0004993
366 Ga0439464_0175858
367 Ga0439460_0181245
368 Ga0450918_005626
369 Ga0466965_0035924
370 Ga0453684_0316353
371 Ga0466960_0252831
372 Ga0451576_0075370
373 Ga0451576_0357048
374 Ga0495620_0083366
375 Ga0495621_0211598
376 Ga0495625_0123574
377 Ga0495659_0096172
378 Ga0495661_0139929
379 Ga0495588_0008262
380 Ga0495671_0019861
381 Ga0496114_0297606
382 Ga0496122_0000274
383 Ga0496123_0000262
384 Ga0496124_0029439
385 Ga0496124_0199549
386 Ga0501249_005505
387 Ga0501225_0001811
388 Ga0501262_002527
389 nmdc:mga03683_4207_c1
390 nmdc:mga03n38_9578_c1
391 nmdc:mga0yw44_329473_c1
392 nmdc:mga0k408_267129_c1
393 nmdc:mga0k408_27030_c1
394 nmdc:mga0k408_6170_c1
395 nmdc:mga0k408_9243_c1
396 nmdc:mga06z11_155387_c1
397 nmdc:mga07m45_227820_c1
398 nmdc:mga07m45_372706_c1
399 nmdc:mga0sz30_11105_c1
400 Ga0500610_0000575
401 Ga0500610_0048391
402 Ga0500644_0068793
403 Ga0500562_005686
404 Ga0500569_036452
405 Ga0500593_000242
406 Ga0500607_000025
407 Ga0500577_0230010
408 Ga0500627_0019768
409 Ga0500634_0058675
410 2548498610
411 2644061237
412 2644074405
413 2644075379
414 2644159669
415 2644649345
416 2739243566
417 2739244919
418 2842679990
419 2842735531
420 2881101247
421 2885194928
422 2904454319
423 2904462685
424 2919707820
425 2945977281
426 2954772229

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00775

Dioxygenase_C

Dioxygenase

72

240

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ilt-assembly2.cif.gz_B structure of the dioxygenase domain of sacte_2871, a novel dioxygenase carbohydrate-binding protein fusion from the cellulolytic bacterium streptomyces sp. sirexaa-e 0.8575 37 207
4ilt-assembly2.cif.gz_B structure of the dioxygenase domain of sacte_2871, a novel dioxygenase carbohydrate-binding protein fusion from the cellulolytic bacterium streptomyces sp. sirexaa-e 0.8314 37 207
6bdj-assembly1.cif.gz_A crystal structure of dioxygenase tetur07g02040 0.7903 36 208
5vg2-assembly4.cif.gz_C intradiol ring-cleavage dioxygenase from tetranychus urticae 0.7799 36 208
5vg2-assembly1.cif.gz_U intradiol ring-cleavage dioxygenase from tetranychus urticae 0.7716 36 208
ID Description Score Start End Superfamily
4iltA00 Mainly Beta;Sandwich;Protocatechuate 3,4-Dioxygenase, subunit A;Aromatic compound dioxygenase 0.8617 37 210 2.60.130.10
4iltA00 Mainly Beta;Sandwich;Protocatechuate 3,4-Dioxygenase, subunit A;Aromatic compound dioxygenase 0.8513 37 210 2.60.130.10
3is0X03 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.7582 70 154 2.60.40.10
af_P86029_1_299_2.60.130.10 Mainly Beta;Sandwich;Protocatechuate 3,4-Dioxygenase, subunit A;Aromatic compound dioxygenase 0.7456 34 210 2.60.130.10
af_Q9JHW1_1212_1304_2.60.40.1120 Mainly Beta;Sandwich;Immunoglobulin-like;Carboxypeptidase-like, regulatory domain 0.7426 76 208 2.60.40.1120
ID Description Score Start End GO Terms
AF-A0A258Q4P9-F1-model_v4 deleted 0.9845 71 210
AF-A0A519M0I9-F1-model_v4 Intradiol ring-cleavage dioxygenase 0.9775 121 210 GO:0008199
GO:0016702
AF-A0A1F4IDS2-F1-model_v4 Intradiol ring-cleavage dioxygenase 0.9768 32 210 GO:0008199
GO:0018578
AF-A0A127K010-F1-model_v4 Intradiol ring-cleavage dioxygenase 0.9727 29 210 GO:0008199
GO:0018578
AF-A0A562ZXZ3-F1-model_v4 Intradiol ring-cleavage dioxygenase 0.9691 29 210 GO:0008199
GO:0018578

Map