F324219

General Info

Members Datasets Scaffolds Average Seq Length
213 170 426 125

Family's Representative Sequence

Representative Sequence 3300031824|Ga0307413_10079550|Ga0307413_100795502
Length 139
Sequence MSDEVRMPRILLVEDNEMNRDMLSRRLERRGYEVLIAVDGQAGIDMAKAQNPDLILMDMSLPVIDGWEATRTLKDGPDTSEIPIIALTAHAMSTDRDKALEAGCDDYDTKPIELPRLLAKMEALIPATTPKAIPAKKTL

Samples

Sample ID Description Type Environment
1 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
21 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
22 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
30 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
31 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
32 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
33 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
34 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
35 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
36 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
37 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
38 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
39 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
40 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
41 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
42 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
44 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
45 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
47 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
49 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
50 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
51 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
52 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
53 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
54 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
55 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
56 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
57 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
58 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
59 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
60 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
61 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
62 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
63 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
64 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
91 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
92 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
93 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
94 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
95 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
96 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
97 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
98 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
99 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
100 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
101 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
102 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
103 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
104 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
105 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
106 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
107 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
108 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
109 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
110 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
111 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
112 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
113 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
114 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
115 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
116 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
117 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
118 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
119 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
120 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
121 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
122 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
123 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
124 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
125 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
126 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
127 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
128 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
129 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
130 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
131 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
132 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
133 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
134 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
135 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
136 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
137 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
138 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
139 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
140 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
141 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
142 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
143 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
144 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
145 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
146 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
147 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
148 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
149 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
150 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
153 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
154 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
155 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
156 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
157 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
158 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
159 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
160 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
161 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
162 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
163 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
164 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
165 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
166 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
167 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
168 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
169 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
170 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.41
Nodule 0
Rhizoplane 0.47
Rhizosphere 92.02
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307413_10079550 3300031824 Bacteria 2096
2 rootL2_10011617 3300003322 Bacteria 1206
3 Ga0065712_10445165 3300005290 Bacteria 691
4 Ga0070658_10391394 3300005327 Bacteria 1193
5 Ga0070670_100000104 3300005331 Bacteria 78787
6 Ga0070670_100013899 3300005331 Bacteria 6903
7 Ga0068869_100501991 3300005334 Bacteria 1013
8 Ga0068869_100771456 3300005334 Bacteria 825
9 Ga0070680_100033480 3300005336 Bacteria 4143
10 Ga0068868_100000071 3300005338 Bacteria 59034
11 Ga0070660_100540933 3300005339 Bacteria 971
12 Ga0070689_100690294 3300005340 Bacteria 891
13 Ga0070687_100678813 3300005343 Bacteria 717
14 Ga0070661_100045740 3300005344 Bacteria 3200
15 Ga0070692_10548680 3300005345 Bacteria 757
16 Ga0070671_100978178 3300005355 Bacteria 741
17 Ga0070671_101252179 3300005355 Bacteria 654
18 Ga0070659_100431237 3300005366 Bacteria 1116
19 Ga0070714_100019577 3300005435 Bacteria 5518
20 Ga0070713_100149233 3300005436 Bacteria 2078
21 Ga0070713_100270388 3300005436 Bacteria 1556
22 Ga0070708_100536222 3300005445 Bacteria 1104
23 Ga0070708_100772659 3300005445 Bacteria 903
24 Ga0070681_10034494 3300005458 Bacteria 5081
25 Ga0070681_10547603 3300005458 Bacteria 1071
26 Ga0070706_100198525 3300005467 Bacteria 1874
27 Ga0070707_100306582 3300005468 Bacteria 1543
28 Ga0070698_100055122 3300005471 Bacteria 4034
29 Ga0070679_100506492 3300005530 Bacteria 1151
30 Ga0070684_100179035 3300005535 Bacteria 1927
31 Ga0070686_100034213 3300005544 Bacteria 3129
32 Ga0070686_100655625 3300005544 Bacteria 833
33 Ga0068855_100103322 3300005563 Bacteria 3278
34 Ga0068855_100350341 3300005563 Bacteria 1627
35 Ga0070664_100608142 3300005564 Bacteria 1014
36 Ga0070664_101917156 3300005564 Bacteria 562
37 Ga0068856_100237610 3300005614 Bacteria 1837
38 Ga0070702_100013936 3300005615 Bacteria 4071
39 Ga0070702_100142532 3300005615 Bacteria 1528
40 Ga0068852_100254180 3300005616 Bacteria 1685
41 Ga0068859_101738227 3300005617 Bacteria 689
42 Ga0068864_100882260 3300005618 Bacteria 883
43 Ga0068870_10007814 3300005840 Bacteria 4783
44 Ga0081540_1034642 3300005983 Bacteria 2718
45 Ga0070717_10002062 3300006028 Bacteria 14064
46 Ga0070712_100204809 3300006175 Bacteria 1552
47 Ga0070712_100522576 3300006175 Bacteria 997
48 Ga0075367_10190428 3300006178 Bacteria 1280
49 Ga0068871_100205995 3300006358 Bacteria 1700
50 Ga0075430_100089192 3300006846 Bacteria 2580
51 Ga0075431_100004524 3300006847 Bacteria 13655
52 Ga0075429_100087603 3300006880 Bacteria 2713
53 Ga0097620_101738591 3300006931 Bacteria 689
54 Ga0099795_10023629 3300007788 Bacteria 2041
55 Ga0105240_10043574 3300009093 Bacteria 5709
56 Ga0105240_11530981 3300009093 Bacteria 699
57 Ga0111539_11530611 3300009094 Bacteria 774
58 Ga0105245_10000004 3300009098 Bacteria 470684
59 Ga0114129_10566663 3300009147 Bacteria 1475
60 Ga0114129_10738334 3300009147 Bacteria 1261
61 Ga0114129_12389097 3300009147 Bacteria 633
62 Ga0105237_11756586 3300009545 Bacteria 628
63 Ga0105238_11363089 3300009551 Bacteria 736
64 Ga0105249_13495789 3300009553 Bacteria 506
65 Ga0099796_10000743 3300010159 Bacteria 5809
66 Ga0105239_10116959 3300010375 Bacteria 2959
67 Ga0105246_10711922 3300011119 Bacteria 881
68 Ga0157371_11088138 3300013102 Bacteria 613
69 Ga0157369_11708883 3300013105 Bacteria 639
70 Ga0157374_11882916 3300013296 Bacteria 624
71 Ga0157372_10274806 3300013307 Bacteria 1958
72 Ga0182008_10029073 3300014497 Bacteria 2793
73 Ga0157379_12652949 3300014968 Bacteria 502
74 Ga0157376_10000042 3300014969 Bacteria 120435
75 Ga0157376_11178034 3300014969 Bacteria 794
76 Ga0213872_10135096 3300021361 Bacteria 1085
77 Ga0213876_10102168 3300021384 Bacteria 1520
78 Ga0209758_1002468 3300025297 Bacteria 18823
79 Ga0207699_10057718 3300025906 Bacteria 2319
80 Ga0207643_10075613 3300025908 Bacteria 1944
81 Ga0207684_10348060 3300025910 Bacteria 1276
82 Ga0207707_10004854 3300025912 Bacteria 11798
83 Ga0207695_10118483 3300025913 Bacteria 2618
84 Ga0207693_10544636 3300025915 Bacteria 905
85 Ga0207693_11109338 3300025915 Bacteria 601
86 Ga0207660_10056355 3300025917 Bacteria 2812
87 Ga0207660_10067380 3300025917 Bacteria 2593
88 Ga0207662_10008203 3300025918 Bacteria 5714
89 Ga0207662_10955508 3300025918 Bacteria 608
90 Ga0207657_10243084 3300025919 Bacteria 1437
91 Ga0207652_10578050 3300025921 Bacteria 1009
92 Ga0207652_11165604 3300025921 Bacteria 672
93 Ga0207646_10653356 3300025922 Bacteria 942
94 Ga0207694_11673551 3300025924 Bacteria 536
95 Ga0207650_10000048 3300025925 Bacteria 174054
96 Ga0207650_10008153 3300025925 Bacteria 7142
97 Ga0207687_10000003 3300025927 Bacteria 875159
98 Ga0207700_10047082 3300025928 Bacteria 3194
99 Ga0207700_10093212 3300025928 Bacteria 2383
100 Ga0207700_10112557 3300025928 Bacteria 2193
101 Ga0207664_10351379 3300025929 Bacteria 1305
102 Ga0207661_10171777 3300025944 Bacteria 1887
103 Ga0207679_10352964 3300025945 Bacteria 1282
104 Ga0207667_10112699 3300025949 Bacteria 2805
105 Ga0207667_10196828 3300025949 Bacteria 2067
106 Ga0207651_11563499 3300025960 Bacteria 594
107 Ga0207640_11438682 3300025981 Bacteria 618
108 Ga0207640_12027567 3300025981 Bacteria 521
109 Ga0207658_11781655 3300025986 Bacteria 562
110 Ga0207677_10000037 3300026023 Bacteria 113152
111 Ga0207676_10213867 3300026095 Bacteria 1712
112 Ga0207698_10005809 3300026142 Bacteria 7661
113 Ga0209179_1004672 3300027512 Bacteria 2087
114 Ga0207428_10040262 3300027907 Bacteria 3792
115 Ga0265337_1039251 3300028556 Bacteria 1369
116 Ga0265319_1007219 3300028563 Bacteria 5028
117 Ga0265338_10024642 3300028800 Bacteria 6139
118 Ga0265330_10010274 3300031235 Bacteria 4419
119 Ga0265332_10124943 3300031238 Bacteria 1080
120 Ga0265332_10493537 3300031238 Bacteria 507
121 Ga0265328_10093003 3300031239 Bacteria 1114
122 Ga0265320_10166902 3300031240 Bacteria 990
123 Ga0265325_10008426 3300031241 Bacteria 6085
124 Ga0265325_10040635 3300031241 Bacteria 2442
125 Ga0265340_10001297 3300031247 Bacteria 14335
126 Ga0265340_10073741 3300031247 Bacteria 1615
127 Ga0265331_10058657 3300031250 Bacteria 1822
128 Ga0265331_10225007 3300031250 Bacteria 843
129 Ga0265331_10459202 3300031250 Bacteria 572
130 Ga0265313_10041693 3300031595 Bacteria 2259
131 Ga0265314_10122565 3300031711 Bacteria 1634
132 Ga0265314_10407117 3300031711 Bacteria 734
133 Ga0265342_10076146 3300031712 Bacteria 1945
134 Ga0265342_10210487 3300031712 Bacteria 1052
135 Ga0307410_10043965 3300031852 Bacteria 2964
136 Ga0307407_10341861 3300031903 Bacteria 1057
137 Ga0307416_101868121 3300032002 Bacteria 704
138 Ga0307416_102207515 3300032002 Bacteria 652
139 Ga0307415_100234276 3300032126 Bacteria 1481
140 Ga0307415_101982778 3300032126 Bacteria 567
141 Ga0373941_0144168 3300035115 Bacteria 868
142 Ga0373954_0029124 3300035118 Bacteria 2542
143 Ga0316574_0177379 3300035398 Bacteria 1371
144 Ga0373931_0079764 3300035691 Bacteria 1804
145 Ga0373935_1224929 3300035692 Bacteria 560
146 Ga0373935_1302363 3300035692 Bacteria 542
147 Ga0373937_1038666 3300036401 Bacteria 768
148 Ga0436365_0510712 3300039437 Bacteria 2386
149 Ga0436360_0105387 3300039438 Bacteria 551
150 Ga0436361_0258796 3300039447 Bacteria 1325
151 Ga0436363_1390853 3300039450 Bacteria 625
152 Ga0436362_0041219 3300039453 Bacteria 959
153 Ga0439465_0191857 3300041413 Bacteria 742
154 Ga0451577_0252679 3300042876 Bacteria 1596
155 Ga0466972_0003899 3300044658 Bacteria 7436
156 Ga0453683_0184324 3300044673 Bacteria 1324
157 Ga0466965_0005679 3300044683 Bacteria 5629
158 Ga0466965_0525571 3300044683 Bacteria 666
159 Ga0453684_2032509 3300044712 Bacteria 578
160 Ga0466968_0002122 3300044735 Bacteria 7224
161 Ga0466960_0001676 3300044901 Bacteria 8118
162 Ga0495651_0522560 3300046462 Bacteria 757
163 Ga0495620_0014540 3300046515 Bacteria 3998
164 Ga0495628_1044794 3300046516 Bacteria 560
165 Ga0495631_0083482 3300046518 Bacteria 1377
166 Ga0495666_0443613 3300046526 Bacteria 582
167 Ga0495652_0154743 3300046529 Bacteria 1787
168 Ga0495657_0066973 3300046675 Bacteria 2359
169 Ga0495657_0502655 3300046675 Bacteria 707
170 Ga0495623_0190538 3300046679 Bacteria 1185
171 Ga0495623_0199624 3300046679 Bacteria 1151
172 Ga0495604_0362542 3300047317 Bacteria 961
173 Ga0495636_0455051 3300047318 Bacteria 615
174 Ga0495680_0288856 3300047322 Bacteria 1154
175 Ga0495675_0285126 3300047444 Bacteria 984
176 Ga0495602_0087939 3300048088 Bacteria 2588
177 Ga0495602_0859976 3300048088 Bacteria 606
178 Ga0496113_0990273 3300048916 Bacteria 662
179 Ga0496116_0008744 3300048919 Bacteria 8736
180 Ga0496117_0217699 3300048920 Bacteria 1065
181 Ga0496118_0101457 3300048921 Bacteria 1943
182 Ga0496119_0183570 3300048922 Bacteria 1095
183 Ga0496119_0443753 3300048922 Bacteria 612
184 Ga0496121_0017987 3300048924 Bacteria 7162
185 Ga0496124_0044401 3300048927 Bacteria 3814
186 Ga0496124_0899734 3300048927 Bacteria 537
187 Ga0496126_0032441 3300048929 Bacteria 4920
188 Ga0501036_0305822 3300049572 Bacteria 1330
189 Ga0501040_0011556 3300049576 Bacteria 5779
190 Ga0501043_0964705 3300049579 Bacteria 608
191 Ga0501046_0662869 3300049580 Bacteria 737
192 Ga0501048_0180965 3300049582 Bacteria 1494
193 Ga0501071_0076784 3300049587 Bacteria 2440
194 Ga0501072_0013859 3300049588 Bacteria 6177
195 Ga0501074_0630706 3300049590 Bacteria 757
196 Ga0501075_0219770 3300049591 Bacteria 1449
197 Ga0501076_0381529 3300049592 Bacteria 1158
198 Ga0501077_0027170 3300049593 Bacteria 3634
199 Ga0501079_0083302 3300049741 Bacteria 2474
200 Ga0501079_0669799 3300049741 Bacteria 817
201 Ga0501044_0088309 3300049823 Bacteria 3130
202 Ga0501045_0102131 3300049824 Bacteria 2123
203 nmdc:mga05p37_500305_c1 3300050507 Bacteria 1395
204 nmdc:mga09592_15692_c1 3300050508 Bacteria 6189
205 nmdc:mga09592_235248_c1 3300050508 Bacteria 1587
206 nmdc:mga0qj67_150206_c1 3300050509 Bacteria 1890
207 nmdc:mga06r32_172551_c1 3300050510 Bacteria 2147
208 nmdc:mga06r32_7908_c1 3300050510 Bacteria 9559
209 Ga0495595_0051842 3300053084 Bacteria 1902
210 Ga0495619_0249220 3300053085 Bacteria 1230
211 Ga0500642_0002407 3300053130 Bacteria 5488
212 Ga0501084_0146932 3300054114 Bacteria 1986
213 Ga0501082_0332801 3300060353 Bacteria 1323
214 Ga0307413_10079550
215 rootL2_10011617
216 Ga0065712_10445165
217 Ga0070658_10391394
218 Ga0070670_100000104
219 Ga0070670_100013899
220 Ga0068869_100501991
221 Ga0068869_100771456
222 Ga0070680_100033480
223 Ga0068868_100000071
224 Ga0070660_100540933
225 Ga0070689_100690294
226 Ga0070687_100678813
227 Ga0070661_100045740
228 Ga0070692_10548680
229 Ga0070671_100978178
230 Ga0070671_101252179
231 Ga0070659_100431237
232 Ga0070714_100019577
233 Ga0070713_100149233
234 Ga0070713_100270388
235 Ga0070708_100536222
236 Ga0070708_100772659
237 Ga0070681_10034494
238 Ga0070681_10547603
239 Ga0070706_100198525
240 Ga0070707_100306582
241 Ga0070698_100055122
242 Ga0070679_100506492
243 Ga0070684_100179035
244 Ga0070686_100034213
245 Ga0070686_100655625
246 Ga0068855_100103322
247 Ga0068855_100350341
248 Ga0070664_100608142
249 Ga0070664_101917156
250 Ga0068856_100237610
251 Ga0070702_100013936
252 Ga0070702_100142532
253 Ga0068852_100254180
254 Ga0068859_101738227
255 Ga0068864_100882260
256 Ga0068870_10007814
257 Ga0081540_1034642
258 Ga0070717_10002062
259 Ga0070712_100204809
260 Ga0070712_100522576
261 Ga0075367_10190428
262 Ga0068871_100205995
263 Ga0075430_100089192
264 Ga0075431_100004524
265 Ga0075429_100087603
266 Ga0097620_101738591
267 Ga0099795_10023629
268 Ga0105240_10043574
269 Ga0105240_11530981
270 Ga0111539_11530611
271 Ga0105245_10000004
272 Ga0114129_10566663
273 Ga0114129_10738334
274 Ga0114129_12389097
275 Ga0105237_11756586
276 Ga0105238_11363089
277 Ga0105249_13495789
278 Ga0099796_10000743
279 Ga0105239_10116959
280 Ga0105246_10711922
281 Ga0157371_11088138
282 Ga0157369_11708883
283 Ga0157374_11882916
284 Ga0157372_10274806
285 Ga0182008_10029073
286 Ga0157379_12652949
287 Ga0157376_10000042
288 Ga0157376_11178034
289 Ga0213872_10135096
290 Ga0213876_10102168
291 Ga0209758_1002468
292 Ga0207699_10057718
293 Ga0207643_10075613
294 Ga0207684_10348060
295 Ga0207707_10004854
296 Ga0207695_10118483
297 Ga0207693_10544636
298 Ga0207693_11109338
299 Ga0207660_10056355
300 Ga0207660_10067380
301 Ga0207662_10008203
302 Ga0207662_10955508
303 Ga0207657_10243084
304 Ga0207652_10578050
305 Ga0207652_11165604
306 Ga0207646_10653356
307 Ga0207694_11673551
308 Ga0207650_10000048
309 Ga0207650_10008153
310 Ga0207687_10000003
311 Ga0207700_10047082
312 Ga0207700_10093212
313 Ga0207700_10112557
314 Ga0207664_10351379
315 Ga0207661_10171777
316 Ga0207679_10352964
317 Ga0207667_10112699
318 Ga0207667_10196828
319 Ga0207651_11563499
320 Ga0207640_11438682
321 Ga0207640_12027567
322 Ga0207658_11781655
323 Ga0207677_10000037
324 Ga0207676_10213867
325 Ga0207698_10005809
326 Ga0209179_1004672
327 Ga0207428_10040262
328 Ga0265337_1039251
329 Ga0265319_1007219
330 Ga0265338_10024642
331 Ga0265330_10010274
332 Ga0265332_10124943
333 Ga0265332_10493537
334 Ga0265328_10093003
335 Ga0265320_10166902
336 Ga0265325_10008426
337 Ga0265325_10040635
338 Ga0265340_10001297
339 Ga0265340_10073741
340 Ga0265331_10058657
341 Ga0265331_10225007
342 Ga0265331_10459202
343 Ga0265313_10041693
344 Ga0265314_10122565
345 Ga0265314_10407117
346 Ga0265342_10076146
347 Ga0265342_10210487
348 Ga0307410_10043965
349 Ga0307407_10341861
350 Ga0307416_101868121
351 Ga0307416_102207515
352 Ga0307415_100234276
353 Ga0307415_101982778
354 Ga0373941_0144168
355 Ga0373954_0029124
356 Ga0316574_0177379
357 Ga0373931_0079764
358 Ga0373935_1224929
359 Ga0373935_1302363
360 Ga0373937_1038666
361 Ga0436365_0510712
362 Ga0436360_0105387
363 Ga0436361_0258796
364 Ga0436363_1390853
365 Ga0436362_0041219
366 Ga0439465_0191857
367 Ga0451577_0252679
368 Ga0466972_0003899
369 Ga0453683_0184324
370 Ga0466965_0005679
371 Ga0466965_0525571
372 Ga0453684_2032509
373 Ga0466968_0002122
374 Ga0466960_0001676
375 Ga0495651_0522560
376 Ga0495620_0014540
377 Ga0495628_1044794
378 Ga0495631_0083482
379 Ga0495666_0443613
380 Ga0495652_0154743
381 Ga0495657_0066973
382 Ga0495657_0502655
383 Ga0495623_0190538
384 Ga0495623_0199624
385 Ga0495604_0362542
386 Ga0495636_0455051
387 Ga0495680_0288856
388 Ga0495675_0285126
389 Ga0495602_0087939
390 Ga0495602_0859976
391 Ga0496113_0990273
392 Ga0496116_0008744
393 Ga0496117_0217699
394 Ga0496118_0101457
395 Ga0496119_0183570
396 Ga0496119_0443753
397 Ga0496121_0017987
398 Ga0496124_0044401
399 Ga0496124_0899734
400 Ga0496126_0032441
401 Ga0501036_0305822
402 Ga0501040_0011556
403 Ga0501043_0964705
404 Ga0501046_0662869
405 Ga0501048_0180965
406 Ga0501071_0076784
407 Ga0501072_0013859
408 Ga0501074_0630706
409 Ga0501075_0219770
410 Ga0501076_0381529
411 Ga0501077_0027170
412 Ga0501079_0083302
413 Ga0501079_0669799
414 Ga0501044_0088309
415 Ga0501045_0102131
416 nmdc:mga05p37_500305_c1
417 nmdc:mga09592_15692_c1
418 nmdc:mga09592_235248_c1
419 nmdc:mga0qj67_150206_c1
420 nmdc:mga06r32_172551_c1
421 nmdc:mga06r32_7908_c1
422 Ga0495595_0051842
423 Ga0495619_0249220
424 Ga0500642_0002407
425 Ga0501084_0146932
426 Ga0501082_0332801

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00072

Response_reg

Response regulator receiver domain

10

122

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
2a9r-assembly1.cif.gz_A-2 rr02-rec phosphate in the active site 0.9678 2 106
1nxt-assembly1.cif.gz_A-2 micarec ph 4.0 0.9669 2 106
1nxx-assembly1.cif.gz_A-2 micarec ph 5.5 0.9665 2 106
8fk2-assembly1.cif.gz_B the n-terminal vicr from streptococcus mutans 0.9589 2 109
6is2-assembly1.cif.gz_A crystal structure of staphylococcus aureus response regulator arlr receiver domain in complex with mg 0.9532 2 106
ID Description Score Start End Superfamily
af_Q06065_2_134_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9662 1 108 3.40.50.2300
4qpjC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9521 2 106 3.40.50.2300
5hm6B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9514 2 106 3.40.50.2300
3t6kB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9509 2 106 3.40.50.2300
af_Q2FXN6_3_86_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9507 2 70 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A529KWF0-F1-model_v4 Response regulator 0.9947 11 104 GO:0000160
AF-A0A382NZP6-F1-model_v4 Response regulatory domain-containing protein 0.994 1 105 GO:0000160
AF-A0A2N9YDV0-F1-model_v4 histidine kinase (EC 2.7.13.3) 0.9931 2 108 GO:0000155
GO:0005524
GO:0005886
GO:0006355
GO:0009927
AF-A0A382SU67-F1-model_v4 Response regulatory domain-containing protein 0.993 1 104 GO:0000160
AF-A0A6N2JX17-F1-model_v4 histidine kinase (EC 2.7.13.3) 0.9925 2 105 GO:0000155
GO:0005524
GO:0005886
GO:0009927

Map