F323784

General Info

Members Datasets Scaffolds Average Seq Length
213 164 426 794

Family's Representative Sequence

Representative Sequence 3300005467|Ga0070706_100002735|Ga0070706_1000027353
Length 826
Sequence MPEGTNGASGTALADAAEPVSAPSDRGPLDDAELSRIDAYWRAANYLSVGQIYLLDNPLLREPLRPEHVKPRLLGHWGTTPGLNFLYAHFDRVVAARDLDAMWVVGPGHGGPAAVANAWLEGTTTELYPNLTRDEAGMRRLFKQFSFPGGVGSHVTPETPGSIHEGGELGYALVHAYGAAFDNPDLIVFCVVGDGEAETGPLAASWHSNKFLDPVRDGAVLPILHLNGYKIANPTVLARIPETELVSLLEGYGYRPVFVSGHEPEAMHQQMAAALDDVLDDIGRIQAAARKRRGAGRSRWPMIVLRSPKGWTGPKTVDGLQTEGTFRSHQVPLSDVRSKPEHLALLEEWLRSYRPEELFDAGGSPRSEITAHVPQATRRISANPHANGGLLLRDLVLPDFRDYAVDVPRPAATTAEATRVLGTFLRDVIQANPDTFRVFGPDETTSNRLTPVFEVTNRAWDAEIIPGDDHLAPDGRVMEVLSEHLCEGWLEGYLLTGRHGLFNCYEAFIHVIDSMFNQHAKWLKMTREIPWRRPIASLNYLLTSHVWRQDHNGFSHQDPGFIDHVANKKAEVIRVYLPPDANCLLSVADHCLRSRHYVNVIVAGKQPALNYLSMDEAVRHCSRGIGIWDWASNDEGHPDVVMACAGDVPTLETLAAVDILRREVPSLRIRVVNVVDLMRLQPDSEHPHGLSDRDFDTLFTTDRPVIFAYHGYPWLIHRLAYRRANHANLHVRGYKEEGTVTTPFDMAVRNDIDRYHLVMDVIDRVPSLGATAALLRQDMIDARMDARAAAEANGEDPAEITGWTWPSPAGDAAGRDVAPASGAHGT

Samples

Sample ID Description Type Environment
1 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
8 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
9 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
10 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
11 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
12 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
13 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
14 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
15 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
16 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
17 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
18 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
19 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
20 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
21 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
22 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
23 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
24 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
25 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
26 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
27 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
28 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
29 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
30 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
31 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
32 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
33 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
34 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
35 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
36 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
37 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
39 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
40 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
41 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
42 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
43 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
44 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
45 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
46 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
70 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
72 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
73 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
74 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
75 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
76 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
77 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
78 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
79 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
80 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
81 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
82 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
83 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
84 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
85 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
86 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
87 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
88 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
89 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
90 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
91 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
92 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
93 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
94 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
95 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
96 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
97 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
98 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
99 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
100 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
101 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
102 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
103 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
104 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
105 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
106 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
107 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
108 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
109 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
110 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
111 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
112 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
113 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
114 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
115 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
116 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
117 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
118 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
119 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
120 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
121 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
122 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
123 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
124 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
125 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
126 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
127 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
128 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
129 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
130 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
131 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
132 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
133 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
134 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
135 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
136 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
137 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
138 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
139 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
140 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
141 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
142 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
143 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
144 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
145 2537561836 Rhodanobacter spathiphylli B39 Isolate Unclassified
146 2643221562 Rhodanobacter sp. Root561 Isolate Unclassified
147 2643221577 Rhodanobacter sp. Root627 Isolate Unclassified
148 2855670206 Micromonospora noduli Lupac 07 Isolate Nodule
149 2855676851 Micromonospora saelicesensis GAR05 Isolate Unclassified
150 2857288857 Micromonospora noduli ONO23 Isolate Unclassified
151 2858848962 Micromonospora saelicesensis GAR06 Isolate Unclassified
152 2858882152 Micromonospora noduli MED15 Isolate Nodule
153 2858888857 Micromonospora saelicesensis Lupac 06 Isolate Unclassified
154 2858895516 Micromonospora saelicesensis PSN13 Isolate Unclassified
155 2869048445 Micromonospora saelicesensis PSN01 Isolate Unclassified
156 2869061728 Micromonospora noduli ONO86 Isolate Unclassified
157 2869068681 Micromonospora noduli GUI43 Isolate Unclassified
158 2880495981 Micromonospora vinacea DSM 101695 Isolate Unclassified
159 2929226422 Micromonospora sp. R-74116 Hybrid assembly Isolate Unclassified
160 8002775197 Frankia nepalensis CN7 Isolate Nodule
161 8002784119 Frankia sp. AgB1.9 Isolate Nodule
162 8054704163 Micromonospora trifolii NIE79 Isolate Nodule
163 8054727385 Micromonospora alfalfae MED01 Isolate Nodule
164 8054734606 Micromonospora hortensis NIE111 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 89.2
Metatranscriptomes 1.41
Isolates 9.39

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.41
Nodule 3.29
Rhizoplane 7.04
Rhizosphere 78.4
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070706_100002735 3300005467 Bacteria 17626
2 JGI24740J21852_10005804 3300001979 Bacteria 5182
3 Ga0058863_10144333 3300004799 Bacteria 3931
4 Ga0058862_10098022 3300004803 Bacteria 4617
5 Ga0070683_100007636 3300005329 Bacteria 9151
6 Ga0070682_100005136 3300005337 Bacteria 7282
7 Ga0070692_10000020 3300005345 Bacteria 32120
8 Ga0070675_100013933 3300005354 Bacteria 6328
9 Ga0070705_100004738 3300005440 Bacteria 6621
10 Ga0070681_10000086 3300005458 Bacteria 70488
11 Ga0070681_10010943 3300005458 Bacteria 8973
12 Ga0070707_100002604 3300005468 Bacteria 17139
13 Ga0070698_100006055 3300005471 Bacteria 13174
14 Ga0070698_100007008 3300005471 Bacteria 12208
15 Ga0070699_100000100 3300005518 Bacteria 81674
16 Ga0070699_100008048 3300005518 Bacteria 9151
17 Ga0070699_100013137 3300005518 Bacteria 7140
18 Ga0070679_100034707 3300005530 Bacteria 5000
19 Ga0070684_100005751 3300005535 Bacteria 9531
20 Ga0070697_100044692 3300005536 Bacteria 3588
21 Ga0070695_100012461 3300005545 Bacteria 5104
22 Ga0070696_100000757 3300005546 Bacteria 20721
23 Ga0068854_100010873 3300005578 Bacteria 5906
24 Ga0068856_100044816 3300005614 Bacteria 4353
25 Ga0068859_100000810 3300005617 Bacteria 31795
26 Ga0068864_100046237 3300005618 Bacteria 3734
27 Ga0068861_100066286 3300005719 Bacteria 2783
28 Ga0068862_100000110 3300005844 Bacteria 97889
29 Ga0081538_10001159 3300005981 Bacteria 27863
30 Ga0081538_10008026 3300005981 Bacteria 9024
31 Ga0081538_10022300 3300005981 Bacteria 4591
32 Ga0081539_10017379 3300005985 Bacteria 5054
33 Ga0070717_10002350 3300006028 Bacteria 13326
34 Ga0075364_10026757 3300006051 Bacteria 3682
35 Ga0075428_100005345 3300006844 Bacteria 14278
36 Ga0075434_100022287 3300006871 Bacteria 6169
37 Ga0075434_100037048 3300006871 Bacteria 4827
38 Ga0075436_100009072 3300006914 Bacteria 6805
39 Ga0097620_100000810 3300006931 Bacteria 31795
40 Ga0075435_100005761 3300007076 Bacteria 8699
41 Ga0075435_100041634 3300007076 Bacteria 3673
42 Ga0105240_10003691 3300009093 Bacteria 23677
43 Ga0111539_10022118 3300009094 Bacteria 7815
44 Ga0105245_10000043 3300009098 Bacteria 136604
45 Ga0105245_10018025 3300009098 Bacteria 6167
46 Ga0114129_10023115 3300009147 Bacteria 8818
47 Ga0105238_10020212 3300009551 Bacteria 6778
48 Ga0105249_10005025 3300009553 Bacteria 11405
49 Ga0105249_10072051 3300009553 Bacteria 3194
50 Ga0105239_10012416 3300010375 Bacteria 9486
51 Ga0105246_10001978 3300011119 Bacteria 12358
52 Ga0157375_10048141 3300013308 Bacteria 4168
53 Ga0163163_10010438 3300014325 Bacteria 8356
54 Ga0157377_10021698 3300014745 Bacteria 3381
55 Ga0224712_10013124 3300022467 Bacteria 2628
56 Ga0207656_10003291 3300025321 Bacteria 5540
57 Ga0207705_10000128 3300025909 Bacteria 83519
58 Ga0207705_10013902 3300025909 Bacteria 5804
59 Ga0207684_10009927 3300025910 Bacteria 8393
60 Ga0207707_10000364 3300025912 Bacteria 47458
61 Ga0207707_10018447 3300025912 Bacteria 6084
62 Ga0207695_10011436 3300025913 Bacteria 10753
63 Ga0207671_10036673 3300025914 Bacteria 3637
64 Ga0207660_10001965 3300025917 Bacteria 13710
65 Ga0207660_10014113 3300025917 Bacteria 5246
66 Ga0207649_10000373 3300025920 Bacteria 33449
67 Ga0207652_10006181 3300025921 Bacteria 9679
68 Ga0207646_10022145 3300025922 Bacteria 5860
69 Ga0207694_10001249 3300025924 Bacteria 21960
70 Ga0207687_10000024 3300025927 Bacteria 187490
71 Ga0207687_10010746 3300025927 Bacteria 5981
72 Ga0207700_10000001 3300025928 Bacteria 1122509
73 Ga0207690_10000337 3300025932 Bacteria 31360
74 Ga0207690_10001280 3300025932 Bacteria 15894
75 Ga0207690_10014443 3300025932 Bacteria 4770
76 Ga0207706_10006022 3300025933 Bacteria 11279
77 Ga0207706_10022304 3300025933 Bacteria 5681
78 Ga0207665_10009868 3300025939 Bacteria 6265
79 Ga0207661_10005322 3300025944 Bacteria 9061
80 Ga0207661_10021476 3300025944 Bacteria 4836
81 Ga0207661_10078615 3300025944 Bacteria 2716
82 Ga0207667_10001451 3300025949 Bacteria 29742
83 Ga0207667_10001568 3300025949 Bacteria 28793
84 Ga0207667_10072431 3300025949 Bacteria 3582
85 Ga0207712_10037686 3300025961 Bacteria 3300
86 Ga0207640_10001607 3300025981 Bacteria 12138
87 Ga0207674_10023404 3300026116 Bacteria 6617
88 Ga0207674_10063170 3300026116 Bacteria 3738
89 Ga0207675_100028450 3300026118 Bacteria 5204
90 Ga0207698_10000113 3300026142 Bacteria 50452
91 Ga0207428_10000347 3300027907 Bacteria 60088
92 Ga0268265_10000019 3300028380 Bacteria 285487
93 Ga0265322_10004558 3300028654 Bacteria 4121
94 Ga0307513_10006576 3300031456 Bacteria 15180
95 Ga0307509_10046152 3300031507 Bacteria 4692
96 Ga0307406_10023651 3300031901 Bacteria 3659
97 Ga0307406_10026347 3300031901 Bacteria 3490
98 Ga0307414_10010062 3300032004 Bacteria 5465
99 Ga0307415_100000304 3300032126 Bacteria 21263
100 Ga0395898_0017155 3300037466 Bacteria 7396
101 Ga0395905_0041594 3300037471 Bacteria 4313
102 Ga0436364_1459050 3300037853 Bacteria 5554
103 Ga0395901_0002027 3300038443 Bacteria 20829
104 Ga0395901_0011963 3300038443 Bacteria 8799
105 Ga0436365_1920113 3300039437 Bacteria 20212
106 Ga0466961_0007662 3300044693 Bacteria 6873
107 Ga0466970_0007180 3300044765 Bacteria 5578
108 Ga0466957_0012388 3300044842 Bacteria 4936
109 Ga0466959_0001885 3300045049 Bacteria 13189
110 Ga0466967_0005300 3300045976 Bacteria 8902
111 Ga0495650_0024893 3300046471 Bacteria 2819
112 Ga0495628_0044765 3300046516 Bacteria 3519
113 Ga0495652_0002224 3300046529 Bacteria 20340
114 Ga0495633_0000283 3300046558 Bacteria 58257
115 Ga0496101_0027682 3300048904 Bacteria 3951
116 Ga0496102_0103659 3300048905 Bacteria 2646
117 Ga0496103_0002039 3300048906 Bacteria 12963
118 Ga0496106_0006576 3300048909 Bacteria 8607
119 Ga0496106_0009162 3300048909 Bacteria 7310
120 Ga0496107_0010422 3300048910 Bacteria 6456
121 Ga0496108_0037300 3300048911 Bacteria 4047
122 Ga0496108_0070403 3300048911 Bacteria 2952
123 Ga0496109_0001130 3300048912 Bacteria 22209
124 Ga0496110_0034122 3300048913 Bacteria 4406
125 Ga0496111_0025418 3300048914 Bacteria 4179
126 Ga0496111_0030657 3300048914 Bacteria 3825
127 Ga0496114_0000113 3300048917 Bacteria 58485
128 Ga0496114_0016078 3300048917 Bacteria 6021
129 Ga0496115_0010348 3300048918 Bacteria 6965
130 Ga0496116_0000353 3300048919 Bacteria 72146
131 Ga0496117_0005234 3300048920 Bacteria 13769
132 Ga0496118_0003399 3300048921 Bacteria 20108
133 Ga0496119_0005679 3300048922 Bacteria 11837
134 Ga0501031_0001160 3300049568 Bacteria 16021
135 Ga0501031_0021902 3300049568 Bacteria 4164
136 Ga0501033_0000862 3300049570 Bacteria 27744
137 Ga0501033_0016235 3300049570 Bacteria 5639
138 Ga0501034_0022953 3300049571 Bacteria 6358
139 Ga0501036_0000938 3300049572 Bacteria 21916
140 Ga0501037_0003579 3300049573 Bacteria 11273
141 Ga0501040_0026398 3300049576 Bacteria 3906
142 Ga0501042_0000761 3300049578 Bacteria 17537
143 Ga0501043_0002346 3300049579 Bacteria 16049
144 Ga0501046_0006655 3300049580 Bacteria 10205
145 Ga0501046_0083816 3300049580 Bacteria 2460
146 Ga0501047_0000244 3300049581 Bacteria 64596
147 Ga0501068_0000806 3300049584 Bacteria 16281
148 Ga0501068_0008339 3300049584 Bacteria 5763
149 Ga0501070_0000053 3300049586 Bacteria 100509
150 Ga0501070_0009678 3300049586 Bacteria 8149
151 Ga0501070_0022002 3300049586 Bacteria 5341
152 Ga0501071_0000001 3300049587 Bacteria 123952
153 Ga0501071_0011549 3300049587 Bacteria 5959
154 Ga0501071_0019539 3300049587 Bacteria 4702
155 Ga0501071_0058367 3300049587 Bacteria 2790
156 Ga0501072_0058407 3300049588 Bacteria 3041
157 Ga0501073_0001710 3300049589 Bacteria 16284
158 Ga0501073_0010150 3300049589 Bacteria 6919
159 Ga0501074_0000031 3300049590 Bacteria 66130
160 Ga0501074_0000357 3300049590 Bacteria 26763
161 Ga0501074_0001353 3300049590 Bacteria 16256
162 Ga0501074_0013625 3300049590 Bacteria 5910
163 Ga0501075_0000462 3300049591 Bacteria 24174
164 Ga0501075_0006958 3300049591 Bacteria 7816
165 Ga0501076_0057718 3300049592 Bacteria 3083
166 Ga0501077_0000028 3300049593 Bacteria 74757
167 Ga0501077_0007246 3300049593 Bacteria 6841
168 Ga0501079_0000387 3300049741 Bacteria 28343
169 Ga0501080_0000986 3300049742 Bacteria 23324
170 Ga0501080_0001311 3300049742 Bacteria 20737
171 Ga0501080_0008416 3300049742 Bacteria 9343
172 Ga0501081_0000043 3300049743 Bacteria 47758
173 Ga0501083_0000412 3300049744 Bacteria 27299
174 Ga0501083_0027918 3300049744 Bacteria 3892
175 Ga0501035_0004608 3300049822 Bacteria 13075
176 Ga0501035_0009924 3300049822 Bacteria 8842
177 Ga0501035_0016563 3300049822 Bacteria 6796
178 Ga0501044_0019895 3300049823 Bacteria 7170
179 Ga0501045_0009989 3300049824 Bacteria 6637
180 Ga0501045_0012460 3300049824 Bacteria 5988
181 nmdc:mga05p37_32579_c1 3300050507 Bacteria 6374
182 nmdc:mga08y16_15252_c1 3300050511 Bacteria 8084
183 nmdc:mga0n895_100332_c1 3300050512 Bacteria 2904
184 nmdc:mga0rr50_66042_c1 3300050513 Bacteria 2743
185 nmdc:mga0a205_22178_c1 3300050515 Bacteria 6010
186 Ga0495601_0004834 3300053077 Bacteria 7814
187 Ga0495612_0000726 3300053078 Bacteria 13388
188 Ga0500618_009536 3300053125 Bacteria 2645
189 Ga0500568_0000350 3300053139 Bacteria 35769
190 Ga0501084_0000118 3300054114 Bacteria 60290
191 Ga0501082_0000720 3300060353 Bacteria 29137
192 Ga0466962_0000936 3300061719 Bacteria 13224
193 Ga0530510_0001764 3300061734 Bacteria 14735
194 2538833909 2537561836 Bacteria 3910579
195 2643831756 2643221562 Bacteria 4048635
196 2643895473 2643221577 Bacteria 3710843
197 2855672784 2855670206 Bacteria 7120389
198 2855682999 2855676851 Bacteria 7063653
199 2857294882 2857288857 Bacteria 7189066
200 2858855423 2858848962 Bacteria 6963058
201 2858885491 2858882152 Bacteria 7230291
202 2858889612 2858888857 Bacteria 7060307
203 2858902026 2858895516 Bacteria 7378898
204 2869054649 2869048445 Bacteria 6875584
205 2869062720 2869061728 Bacteria 7112407
206 2869072558 2869068681 Bacteria 7205615
207 2880499596 2880495981 Bacteria 7340502
208 2929228185 2929226422 Bacteria 7248583
209 8002782533 8002775197 Bacteria 10728764
210 8002790604 8002784119 Bacteria 9788632
211 8054705944 8054704163 Bacteria 7247792
212 8054732237 8054727385 Bacteria 7558670
213 8054740895 8054734606 Bacteria 6947278
214 Ga0070706_100002735
215 JGI24740J21852_10005804
216 Ga0058863_10144333
217 Ga0058862_10098022
218 Ga0070683_100007636
219 Ga0070682_100005136
220 Ga0070692_10000020
221 Ga0070675_100013933
222 Ga0070705_100004738
223 Ga0070681_10000086
224 Ga0070681_10010943
225 Ga0070707_100002604
226 Ga0070698_100006055
227 Ga0070698_100007008
228 Ga0070699_100000100
229 Ga0070699_100008048
230 Ga0070699_100013137
231 Ga0070679_100034707
232 Ga0070684_100005751
233 Ga0070697_100044692
234 Ga0070695_100012461
235 Ga0070696_100000757
236 Ga0068854_100010873
237 Ga0068856_100044816
238 Ga0068859_100000810
239 Ga0068864_100046237
240 Ga0068861_100066286
241 Ga0068862_100000110
242 Ga0081538_10001159
243 Ga0081538_10008026
244 Ga0081538_10022300
245 Ga0081539_10017379
246 Ga0070717_10002350
247 Ga0075364_10026757
248 Ga0075428_100005345
249 Ga0075434_100022287
250 Ga0075434_100037048
251 Ga0075436_100009072
252 Ga0097620_100000810
253 Ga0075435_100005761
254 Ga0075435_100041634
255 Ga0105240_10003691
256 Ga0111539_10022118
257 Ga0105245_10000043
258 Ga0105245_10018025
259 Ga0114129_10023115
260 Ga0105238_10020212
261 Ga0105249_10005025
262 Ga0105249_10072051
263 Ga0105239_10012416
264 Ga0105246_10001978
265 Ga0157375_10048141
266 Ga0163163_10010438
267 Ga0157377_10021698
268 Ga0224712_10013124
269 Ga0207656_10003291
270 Ga0207705_10000128
271 Ga0207705_10013902
272 Ga0207684_10009927
273 Ga0207707_10000364
274 Ga0207707_10018447
275 Ga0207695_10011436
276 Ga0207671_10036673
277 Ga0207660_10001965
278 Ga0207660_10014113
279 Ga0207649_10000373
280 Ga0207652_10006181
281 Ga0207646_10022145
282 Ga0207694_10001249
283 Ga0207687_10000024
284 Ga0207687_10010746
285 Ga0207700_10000001
286 Ga0207690_10000337
287 Ga0207690_10001280
288 Ga0207690_10014443
289 Ga0207706_10006022
290 Ga0207706_10022304
291 Ga0207665_10009868
292 Ga0207661_10005322
293 Ga0207661_10021476
294 Ga0207661_10078615
295 Ga0207667_10001451
296 Ga0207667_10001568
297 Ga0207667_10072431
298 Ga0207712_10037686
299 Ga0207640_10001607
300 Ga0207674_10023404
301 Ga0207674_10063170
302 Ga0207675_100028450
303 Ga0207698_10000113
304 Ga0207428_10000347
305 Ga0268265_10000019
306 Ga0265322_10004558
307 Ga0307513_10006576
308 Ga0307509_10046152
309 Ga0307406_10023651
310 Ga0307406_10026347
311 Ga0307414_10010062
312 Ga0307415_100000304
313 Ga0395898_0017155
314 Ga0395905_0041594
315 Ga0436364_1459050
316 Ga0395901_0002027
317 Ga0395901_0011963
318 Ga0436365_1920113
319 Ga0466961_0007662
320 Ga0466970_0007180
321 Ga0466957_0012388
322 Ga0466959_0001885
323 Ga0466967_0005300
324 Ga0495650_0024893
325 Ga0495628_0044765
326 Ga0495652_0002224
327 Ga0495633_0000283
328 Ga0496101_0027682
329 Ga0496102_0103659
330 Ga0496103_0002039
331 Ga0496106_0006576
332 Ga0496106_0009162
333 Ga0496107_0010422
334 Ga0496108_0037300
335 Ga0496108_0070403
336 Ga0496109_0001130
337 Ga0496110_0034122
338 Ga0496111_0025418
339 Ga0496111_0030657
340 Ga0496114_0000113
341 Ga0496114_0016078
342 Ga0496115_0010348
343 Ga0496116_0000353
344 Ga0496117_0005234
345 Ga0496118_0003399
346 Ga0496119_0005679
347 Ga0501031_0001160
348 Ga0501031_0021902
349 Ga0501033_0000862
350 Ga0501033_0016235
351 Ga0501034_0022953
352 Ga0501036_0000938
353 Ga0501037_0003579
354 Ga0501040_0026398
355 Ga0501042_0000761
356 Ga0501043_0002346
357 Ga0501046_0006655
358 Ga0501046_0083816
359 Ga0501047_0000244
360 Ga0501068_0000806
361 Ga0501068_0008339
362 Ga0501070_0000053
363 Ga0501070_0009678
364 Ga0501070_0022002
365 Ga0501071_0000001
366 Ga0501071_0011549
367 Ga0501071_0019539
368 Ga0501071_0058367
369 Ga0501072_0058407
370 Ga0501073_0001710
371 Ga0501073_0010150
372 Ga0501074_0000031
373 Ga0501074_0000357
374 Ga0501074_0001353
375 Ga0501074_0013625
376 Ga0501075_0000462
377 Ga0501075_0006958
378 Ga0501076_0057718
379 Ga0501077_0000028
380 Ga0501077_0007246
381 Ga0501079_0000387
382 Ga0501080_0000986
383 Ga0501080_0001311
384 Ga0501080_0008416
385 Ga0501081_0000043
386 Ga0501083_0000412
387 Ga0501083_0027918
388 Ga0501035_0004608
389 Ga0501035_0009924
390 Ga0501035_0016563
391 Ga0501044_0019895
392 Ga0501045_0009989
393 Ga0501045_0012460
394 nmdc:mga05p37_32579_c1
395 nmdc:mga08y16_15252_c1
396 nmdc:mga0n895_100332_c1
397 nmdc:mga0rr50_66042_c1
398 nmdc:mga0a205_22178_c1
399 Ga0495601_0004834
400 Ga0495612_0000726
401 Ga0500618_009536
402 Ga0500568_0000350
403 Ga0501084_0000118
404 Ga0501082_0000720
405 Ga0466962_0000936
406 Ga0530510_0001764
407 2538833909
408 2643831756
409 2643895473
410 2855672784
411 2855682999
412 2857294882
413 2858855423
414 2858885491
415 2858889612
416 2858902026
417 2869054649
418 2869062720
419 2869072558
420 2880499596
421 2929228185
422 8002782533
423 8002790604
424 8054705944
425 8054732237
426 8054740895

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09363

XFP_C

XFP C-terminal domain

605

805

1

PF03894

XFP

D-xylulose 5-phosphate/D-fructose 6-phosphate phosphoketolase

419

594

0.99

PF09364

XFP_N

XFP N-terminal domain

28

391

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
8io9-assembly1.cif.gz_A cryo-em structure of cyanobacteria phosphoketolase complexed with amppnp in dodecameric assembly 0.9751 15 789
8ioe-assembly1.cif.gz_A cryo-em structure of cyanobacteria phosphoketolase in dodecameric assembly 0.9729 12 789
8ioe-assembly1.cif.gz_G cryo-em structure of cyanobacteria phosphoketolase in dodecameric assembly 0.9729 12 789
3ahi-assembly1.cif.gz_A h320a mutant of phosphoketolase from bifidobacterium breve complexed with acetyl thiamine diphosphate 0.9642 12 787
3ai7-assembly1.cif.gz_B crystal structure of bifidobacterium longum phosphoketolase 0.9634 14 788
ID Description Score Start End Superfamily
af_O74770_38_422_3.40.50.970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.9672 14 385 3.40.50.970
3aheA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.9608 12 381 3.40.50.970
3ai7B02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.9312 390 605 3.40.50.970
af_O74770_38_422_3.40.50.970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.9206 14 385 3.40.50.970
af_O74770_635_816_3.40.50.920 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9197 607 782 3.40.50.920
ID Description Score Start End GO Terms
AF-A0A530GFA3-F1-model_v4 Phosphoketolase 1.001 591 686 GO:0005975
GO:0016832
AF-A0A5R2N3A7-F1-model_v4 Phosphoketolase 1 559 695 GO:0005975
GO:0016832
AF-T1CW58-F1-model_v4 Xylulose 5-phosphate/Fructose 6-phosphate phosphoketolase (EC 4.1.2.-) 0.9996 551 713 GO:0005975
GO:0016832
AF-A0A527W3V3-F1-model_v4 Phosphoketolase 0.9976 619 704 GO:0005975
GO:0016832
AF-A0A4V1SJS8-F1-model_v4 deleted 0.9971 12 101

Map