F323612

General Info

Members Datasets Scaffolds Average Seq Length
213 126 426 268

Family's Representative Sequence

Representative Sequence 3300005327|Ga0070658_10078084|Ga0070658_100780842
Length 286
Sequence MSVRGIPAPQLYTPTVYWEDRARRFAAEGHGLAAVCSYGMPESYNRAIQLEQRLALRPWLRVAPGCRVLDVGCGVGRWSRLLAGRGAMVTGIDLSPTMIEEAERRAAHAGVAQRCRFQVQDVSDLEVGGQFDLVLAVTVLQHILDPIGLRAAVTAMARRLAPGGRIVLLEAAPDTDVRRCDSTVFKARRRAIYLDLFRACGLCVQAVTGVDPAPFRSRLLPHIRELPRWSAAALLALATGLSLPVNALLGRWAAGRSWHAVFVLETAERHPRGAAASREGGDRWHA

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
16 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
21 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
22 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
23 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
26 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
27 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
28 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
29 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
30 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
31 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
32 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
33 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
34 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
35 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
37 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
38 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
39 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
40 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
41 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
43 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
44 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
45 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
46 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
47 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
48 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
49 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
50 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
51 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
52 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
53 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
54 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
55 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
56 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
57 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
58 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
59 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
60 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
86 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
87 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
88 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
89 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
90 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
91 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
92 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
93 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
94 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
95 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
96 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
97 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
98 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
99 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
100 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
101 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
102 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
103 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
104 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
105 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
106 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
107 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
108 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
109 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
110 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
111 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
112 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
113 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
114 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
115 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
116 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
117 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
118 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
119 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
120 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
121 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
122 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
123 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
124 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
125 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
126 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.06
Metatranscriptomes 0.94
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.88
Nodule 0
Rhizoplane 3.29
Rhizosphere 83.1
Stem 0
Stem Tuber 0
Unclassified 22.54

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10078084 3300005327 Unclassified 2717
2 JGI25406J46586_10003462 3300003203 Bacteria 7418
3 rootH1_10150945 3300003323 Bacteria 1740
4 rootH1_10317648 3300003323 Bacteria 2196
5 Ga0065707_10177829 3300005295 Archaea 1438
6 Ga0070683_100006343 3300005329 Bacteria 9916
7 Ga0070683_100280397 3300005329 Bacteria 1585
8 Ga0070666_10026824 3300005335 Bacteria 3767
9 Ga0070666_10063913 3300005335 Archaea 2495
10 Ga0070680_100002811 3300005336 Bacteria 12926
11 Ga0070680_100004485 3300005336 Bacteria 10515
12 Ga0070680_100051704 3300005336 Bacteria 3353
13 Ga0070682_100071235 3300005337 Bacteria 2224
14 Ga0070660_100311949 3300005339 Bacteria 1291
15 Ga0070671_100000572 3300005355 Bacteria 26160
16 Ga0070667_100024807 3300005367 Unclassified 4982
17 Ga0070709_10081619 3300005434 Unclassified 2111
18 Ga0070709_10465564 3300005434 Unclassified 955
19 Ga0070714_100032586 3300005435 Bacteria 4351
20 Ga0070713_100077407 3300005436 Bacteria 2828
21 Ga0070700_100006798 3300005441 Bacteria 6132
22 Ga0070694_100021059 3300005444 Bacteria 4162
23 Ga0070681_10001631 3300005458 Bacteria 20007
24 Ga0070681_10034923 3300005458 Bacteria 5050
25 Ga0070681_10110090 3300005458 Unclassified 2694
26 Ga0070681_10345018 3300005458 Unclassified 1399
27 Ga0070679_100003610 3300005530 Bacteria 14140
28 Ga0070679_100168474 3300005530 Archaea 2163
29 Ga0070684_100045814 3300005535 Unclassified 3788
30 Ga0070684_100601094 3300005535 Unclassified 1023
31 Ga0070686_100229509 3300005544 Archaea 1346
32 Ga0070695_100014780 3300005545 Unclassified 4709
33 Ga0070665_100002171 3300005548 Bacteria 21860
34 Ga0070665_100030629 3300005548 Bacteria 5413
35 Ga0070665_100184860 3300005548 Archaea 2085
36 Ga0070704_100013047 3300005549 Bacteria 5145
37 Ga0068855_100009971 3300005563 Bacteria 11449
38 Ga0068855_100015508 3300005563 Bacteria 9174
39 Ga0068855_100043097 3300005563 Bacteria 5347
40 Ga0068855_100085902 3300005563 Bacteria 3639
41 Ga0068855_100366190 3300005563 Bacteria 1585
42 Ga0068855_100374180 3300005563 Archaea 1565
43 Ga0068854_100108717 3300005578 Bacteria 2089
44 Ga0068859_100004165 3300005617 Bacteria 14770
45 Ga0068859_100035509 3300005617 Archaea 5002
46 Ga0068859_100064613 3300005617 Bacteria 3692
47 Ga0068861_100035450 3300005719 Bacteria 3696
48 Ga0068861_100044565 3300005719 Bacteria 3336
49 Ga0068863_100000939 3300005841 Bacteria 29246
50 Ga0068863_100039254 3300005841 Bacteria 4506
51 Ga0068858_100000125 3300005842 Bacteria 79795
52 Ga0068858_100018038 3300005842 Bacteria 6609
53 Ga0068858_100190464 3300005842 Bacteria 1938
54 Ga0068860_100000274 3300005843 Bacteria 75310
55 Ga0068860_100096358 3300005843 Unclassified 2820
56 Ga0068862_100017073 3300005844 Bacteria 6039
57 Ga0068862_100031967 3300005844 Bacteria 4445
58 Ga0081455_10001215 3300005937 Bacteria 32285
59 Ga0081539_10000066 3300005985 Bacteria 246391
60 Ga0075431_100003855 3300006847 Bacteria 14583
61 Ga0097620_100004165 3300006931 Bacteria 14770
62 Ga0097620_100035510 3300006931 Archaea 5002
63 Ga0097620_100064612 3300006931 Bacteria 3692
64 Ga0099794_10248210 3300007265 Bacteria 917
65 Ga0099795_10000001 3300007788 Bacteria 179944
66 Ga0099795_10055584 3300007788 Bacteria 1454
67 Ga0105250_10004175 3300009092 Bacteria 6693
68 Ga0105240_10002783 3300009093 Bacteria 27637
69 Ga0105240_10006780 3300009093 Bacteria 16750
70 Ga0105240_10012776 3300009093 Bacteria 11571
71 Ga0105240_10012797 3300009093 Bacteria 11561
72 Ga0105240_10270300 3300009093 Bacteria 1957
73 Ga0105247_10000901 3300009101 Bacteria 22355
74 Ga0105247_10048343 3300009101 Unclassified 2612
75 Ga0114129_10005440 3300009147 Bacteria 17996
76 Ga0105241_10404667 3300009174 Unclassified 1198
77 Ga0105242_10130020 3300009176 Unclassified 2172
78 Ga0105248_10008686 3300009177 Bacteria 11164
79 Ga0105248_10070013 3300009177 Unclassified 3940
80 Ga0105237_10031879 3300009545 Bacteria 5338
81 Ga0105237_10057452 3300009545 Unclassified 3894
82 Ga0105237_10415755 3300009545 Bacteria 1350
83 Ga0105237_10550961 3300009545 Bacteria 1160
84 Ga0105238_10001414 3300009551 Bacteria 24035
85 Ga0105238_10208877 3300009551 Bacteria 1928
86 Ga0105238_10279508 3300009551 Unclassified 1650
87 Ga0105249_10001662 3300009553 Bacteria 19496
88 Ga0105249_10058501 3300009553 Bacteria 3532
89 Ga0099796_10000039 3300010159 Bacteria 26433
90 Ga0099796_10000917 3300010159 Bacteria 5478
91 Ga0099796_10100057 3300010159 Bacteria 1089
92 Ga0105239_10083207 3300010375 Bacteria 3524
93 Ga0157370_10002103 3300013104 Bacteria 24332
94 Ga0157370_10108788 3300013104 Unclassified 2592
95 Ga0157369_10004022 3300013105 Bacteria 17430
96 Ga0157369_10012032 3300013105 Bacteria 9825
97 Ga0157369_10215691 3300013105 Bacteria 2010
98 Ga0157374_10574702 3300013296 Archaea 1136
99 Ga0157374_10776349 3300013296 Unclassified 973
100 Ga0163162_10016055 3300013306 Bacteria 7318
101 Ga0163162_10032656 3300013306 Bacteria 5171
102 Ga0163163_10016025 3300014325 Bacteria 6950
103 Ga0163163_10212553 3300014325 Unclassified 1983
104 Ga0163163_10622325 3300014325 Bacteria 1143
105 Ga0157379_10006189 3300014968 Bacteria 10308
106 Ga0157379_10105856 3300014968 Bacteria 2525
107 Ga0157379_10182414 3300014968 Bacteria 1896
108 Ga0157379_10683098 3300014968 Unclassified 963
109 Ga0157376_10159463 3300014969 Unclassified 2043
110 Ga0206356_10393703 3300020070 Bacteria 2544
111 Ga0206353_11465195 3300020082 Bacteria 1652
112 Ga0213876_10045599 3300021384 Bacteria 2318
113 Ga0207710_10002008 3300025900 Bacteria 9694
114 Ga0207710_10015709 3300025900 Unclassified 3202
115 Ga0207647_10173567 3300025904 Bacteria 1254
116 Ga0207654_10162231 3300025911 Bacteria 1445
117 Ga0207707_10000052 3300025912 Bacteria 117200
118 Ga0207707_10079818 3300025912 Unclassified 2857
119 Ga0207695_10004229 3300025913 Bacteria 19736
120 Ga0207695_10109074 3300025913 Bacteria 2751
121 Ga0207695_10230602 3300025913 Unclassified 1756
122 Ga0207671_10040904 3300025914 Unclassified 3430
123 Ga0207671_10086523 3300025914 Unclassified 2356
124 Ga0207671_10102679 3300025914 Bacteria 2167
125 Ga0207660_10003303 3300025917 Bacteria 10550
126 Ga0207652_10003085 3300025921 Bacteria 13899
127 Ga0207652_10017628 3300025921 Bacteria 5845
128 Ga0207652_10053292 3300025921 Unclassified 3475
129 Ga0207694_10005660 3300025924 Bacteria 9589
130 Ga0207694_10194219 3300025924 Unclassified 1650
131 Ga0207694_10469088 3300025924 Bacteria 1052
132 Ga0207700_10214112 3300025928 Unclassified 1630
133 Ga0207644_10004771 3300025931 Bacteria 8817
134 Ga0207711_10063218 3300025941 Unclassified 3195
135 Ga0207667_10002424 3300025949 Bacteria 23372
136 Ga0207667_10052604 3300025949 Bacteria 4288
137 Ga0207667_10120005 3300025949 Bacteria 2709
138 Ga0207667_10468644 3300025949 Bacteria 1279
139 Ga0207712_10048545 3300025961 Bacteria 2953
140 Ga0207712_10092207 3300025961 Bacteria 2233
141 Ga0207640_10361193 3300025981 Unclassified 1170
142 Ga0207658_10137481 3300025986 Unclassified 1972
143 Ga0207703_10001048 3300026035 Bacteria 26350
144 Ga0207703_10001570 3300026035 Bacteria 20718
145 Ga0207708_10005000 3300026075 Bacteria 9767
146 Ga0207641_10000290 3300026088 Bacteria 62711
147 Ga0207641_10008504 3300026088 Bacteria 8482
148 Ga0207675_100005462 3300026118 Bacteria 12181
149 Ga0207675_100102936 3300026118 Bacteria 2691
150 Ga0209179_1000006 3300027512 Bacteria 101289
151 Ga0209179_1000792 3300027512 Unclassified 3450
152 Ga0209588_1020607 3300027671 Unclassified 2065
153 Ga0268266_10000932 3300028379 Bacteria 37313
154 Ga0268266_10005039 3300028379 Bacteria 12469
155 Ga0268266_10022581 3300028379 Archaea 5359
156 Ga0268266_10071679 3300028379 Bacteria 3003
157 Ga0268265_10013225 3300028380 Bacteria 5608
158 Ga0268265_10031327 3300028380 Bacteria 3840
159 Ga0268265_10431633 3300028380 Unclassified 1226
160 Ga0268264_10000060 3300028381 Bacteria 305056
161 Ga0268264_10076966 3300028381 Unclassified 2840
162 Ga0265334_10022321 3300028573 Bacteria 2580
163 Ga0307515_10293220 3300028794 Bacteria 1320
164 Ga0307511_10001052 3300030521 Bacteria 29394
165 Ga0307511_10036447 3300030521 Bacteria 4270
166 Ga0307513_10039884 3300031456 Bacteria 5199
167 Ga0307509_10000074 3300031507 Bacteria 140111
168 Ga0307510_10000006 3300033180 Bacteria 566474
169 Ga0307510_10228894 3300033180 Bacteria 1363
170 Ga0395905_0436939 3300037471 Bacteria 1206
171 Ga0436365_0937986 3300039437 Bacteria 6571
172 Ga0436365_1832483 3300039437 Unclassified 1190
173 Ga0436360_1080609 3300039438 Bacteria 8347
174 Ga0436361_0133358 3300039447 Unclassified 1298
175 Ga0436361_0512859 3300039447 Bacteria 3411
176 Ga0436363_0910402 3300039450 Bacteria 10840
177 Ga0436363_1395983 3300039450 Bacteria 1013
178 Ga0451577_0353559 3300042876 Bacteria 1333
179 Ga0466969_0042151 3300044656 Bacteria 2280
180 Ga0466959_0046255 3300045049 Bacteria 3203
181 Ga0466959_0126394 3300045049 Bacteria 1814
182 Ga0466958_0062726 3300045836 Bacteria 2266
183 Ga0495583_0065861 3300046506 Bacteria 1604
184 Ga0495632_0019446 3300046519 Unclassified 3699
185 Ga0495668_0044166 3300046616 Bacteria 2477
186 Ga0495687_116360 3300047443 Bacteria 973
187 Ga0496101_0578932 3300048904 Unclassified 888
188 Ga0496102_0002246 3300048905 Bacteria 16561
189 Ga0496106_0131306 3300048909 Unclassified 1964
190 Ga0496106_0423464 3300048909 Unclassified 1070
191 Ga0496112_0383869 3300048915 Unclassified 1346
192 Ga0496114_0110788 3300048917 Bacteria 2352
193 Ga0496115_0229559 3300048918 Bacteria 1531
194 Ga0496117_0000090 3300048920 Bacteria 206388
195 Ga0496118_0000032 3300048921 Bacteria 330072
196 Ga0496119_0000436 3300048922 Bacteria 57111
197 Ga0496119_0138428 3300048922 Unclassified 1317
198 Ga0496120_0000490 3300048923 Bacteria 62027
199 Ga0496121_0002941 3300048924 Bacteria 24909
200 Ga0496124_0011494 3300048927 Bacteria 8842
201 Ga0496125_0000592 3300048928 Bacteria 61806
202 Ga0496125_0027390 3300048928 Bacteria 5166
203 Ga0496126_0021724 3300048929 Bacteria 6262
204 Ga0496126_0270904 3300048929 Unclassified 1409
205 Ga0495682_0124590 3300049460 Unclassified 922
206 Ga0501042_0482563 3300049578 Unclassified 900
207 nmdc:mga06z11_7539_c1 3300050494 Bacteria 4485
208 nmdc:mga05p37_37252_c1 3300050507 Bacteria 5963
209 nmdc:mga06r32_39559_c1 3300050510 Bacteria 4475
210 nmdc:mga08x19_300319_c1 3300050514 Bacteria 1115
211 Ga0500642_0067903 3300053130 Bacteria 1617
212 Ga0500588_0000132 3300053146 Bacteria 10024
213 Ga0500637_0048747 3300053178 Unclassified 2409
214 Ga0070658_10078084
215 JGI25406J46586_10003462
216 rootH1_10150945
217 rootH1_10317648
218 Ga0065707_10177829
219 Ga0070683_100006343
220 Ga0070683_100280397
221 Ga0070666_10026824
222 Ga0070666_10063913
223 Ga0070680_100002811
224 Ga0070680_100004485
225 Ga0070680_100051704
226 Ga0070682_100071235
227 Ga0070660_100311949
228 Ga0070671_100000572
229 Ga0070667_100024807
230 Ga0070709_10081619
231 Ga0070709_10465564
232 Ga0070714_100032586
233 Ga0070713_100077407
234 Ga0070700_100006798
235 Ga0070694_100021059
236 Ga0070681_10001631
237 Ga0070681_10034923
238 Ga0070681_10110090
239 Ga0070681_10345018
240 Ga0070679_100003610
241 Ga0070679_100168474
242 Ga0070684_100045814
243 Ga0070684_100601094
244 Ga0070686_100229509
245 Ga0070695_100014780
246 Ga0070665_100002171
247 Ga0070665_100030629
248 Ga0070665_100184860
249 Ga0070704_100013047
250 Ga0068855_100009971
251 Ga0068855_100015508
252 Ga0068855_100043097
253 Ga0068855_100085902
254 Ga0068855_100366190
255 Ga0068855_100374180
256 Ga0068854_100108717
257 Ga0068859_100004165
258 Ga0068859_100035509
259 Ga0068859_100064613
260 Ga0068861_100035450
261 Ga0068861_100044565
262 Ga0068863_100000939
263 Ga0068863_100039254
264 Ga0068858_100000125
265 Ga0068858_100018038
266 Ga0068858_100190464
267 Ga0068860_100000274
268 Ga0068860_100096358
269 Ga0068862_100017073
270 Ga0068862_100031967
271 Ga0081455_10001215
272 Ga0081539_10000066
273 Ga0075431_100003855
274 Ga0097620_100004165
275 Ga0097620_100035510
276 Ga0097620_100064612
277 Ga0099794_10248210
278 Ga0099795_10000001
279 Ga0099795_10055584
280 Ga0105250_10004175
281 Ga0105240_10002783
282 Ga0105240_10006780
283 Ga0105240_10012776
284 Ga0105240_10012797
285 Ga0105240_10270300
286 Ga0105247_10000901
287 Ga0105247_10048343
288 Ga0114129_10005440
289 Ga0105241_10404667
290 Ga0105242_10130020
291 Ga0105248_10008686
292 Ga0105248_10070013
293 Ga0105237_10031879
294 Ga0105237_10057452
295 Ga0105237_10415755
296 Ga0105237_10550961
297 Ga0105238_10001414
298 Ga0105238_10208877
299 Ga0105238_10279508
300 Ga0105249_10001662
301 Ga0105249_10058501
302 Ga0099796_10000039
303 Ga0099796_10000917
304 Ga0099796_10100057
305 Ga0105239_10083207
306 Ga0157370_10002103
307 Ga0157370_10108788
308 Ga0157369_10004022
309 Ga0157369_10012032
310 Ga0157369_10215691
311 Ga0157374_10574702
312 Ga0157374_10776349
313 Ga0163162_10016055
314 Ga0163162_10032656
315 Ga0163163_10016025
316 Ga0163163_10212553
317 Ga0163163_10622325
318 Ga0157379_10006189
319 Ga0157379_10105856
320 Ga0157379_10182414
321 Ga0157379_10683098
322 Ga0157376_10159463
323 Ga0206356_10393703
324 Ga0206353_11465195
325 Ga0213876_10045599
326 Ga0207710_10002008
327 Ga0207710_10015709
328 Ga0207647_10173567
329 Ga0207654_10162231
330 Ga0207707_10000052
331 Ga0207707_10079818
332 Ga0207695_10004229
333 Ga0207695_10109074
334 Ga0207695_10230602
335 Ga0207671_10040904
336 Ga0207671_10086523
337 Ga0207671_10102679
338 Ga0207660_10003303
339 Ga0207652_10003085
340 Ga0207652_10017628
341 Ga0207652_10053292
342 Ga0207694_10005660
343 Ga0207694_10194219
344 Ga0207694_10469088
345 Ga0207700_10214112
346 Ga0207644_10004771
347 Ga0207711_10063218
348 Ga0207667_10002424
349 Ga0207667_10052604
350 Ga0207667_10120005
351 Ga0207667_10468644
352 Ga0207712_10048545
353 Ga0207712_10092207
354 Ga0207640_10361193
355 Ga0207658_10137481
356 Ga0207703_10001048
357 Ga0207703_10001570
358 Ga0207708_10005000
359 Ga0207641_10000290
360 Ga0207641_10008504
361 Ga0207675_100005462
362 Ga0207675_100102936
363 Ga0209179_1000006
364 Ga0209179_1000792
365 Ga0209588_1020607
366 Ga0268266_10000932
367 Ga0268266_10005039
368 Ga0268266_10022581
369 Ga0268266_10071679
370 Ga0268265_10013225
371 Ga0268265_10031327
372 Ga0268265_10431633
373 Ga0268264_10000060
374 Ga0268264_10076966
375 Ga0265334_10022321
376 Ga0307515_10293220
377 Ga0307511_10001052
378 Ga0307511_10036447
379 Ga0307513_10039884
380 Ga0307509_10000074
381 Ga0307510_10000006
382 Ga0307510_10228894
383 Ga0395905_0436939
384 Ga0436365_0937986
385 Ga0436365_1832483
386 Ga0436360_1080609
387 Ga0436361_0133358
388 Ga0436361_0512859
389 Ga0436363_0910402
390 Ga0436363_1395983
391 Ga0451577_0353559
392 Ga0466969_0042151
393 Ga0466959_0046255
394 Ga0466959_0126394
395 Ga0466958_0062726
396 Ga0495583_0065861
397 Ga0495632_0019446
398 Ga0495668_0044166
399 Ga0495687_116360
400 Ga0496101_0578932
401 Ga0496102_0002246
402 Ga0496106_0131306
403 Ga0496106_0423464
404 Ga0496112_0383869
405 Ga0496114_0110788
406 Ga0496115_0229559
407 Ga0496117_0000090
408 Ga0496118_0000032
409 Ga0496119_0000436
410 Ga0496119_0138428
411 Ga0496120_0000490
412 Ga0496121_0002941
413 Ga0496124_0011494
414 Ga0496125_0000592
415 Ga0496125_0027390
416 Ga0496126_0021724
417 Ga0496126_0270904
418 Ga0495682_0124590
419 Ga0501042_0482563
420 nmdc:mga06z11_7539_c1
421 nmdc:mga05p37_37252_c1
422 nmdc:mga06r32_39559_c1
423 nmdc:mga08x19_300319_c1
424 Ga0500642_0067903
425 Ga0500588_0000132
426 Ga0500637_0048747

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13649

Methyltransf_25

Methyltransferase domain

68

164

0.96

PF08241

Methyltransf_11

Methyltransferase domain

69

168

0.94

PF08242

Methyltransf_12

Methyltransferase domain

69

166

0.93

PF13847

Methyltransf_31

Methyltransferase domain

63

189

0.89

PF05401

NodS

Nodulation protein S (NodS)

47

197

0.87

PF03848

TehB

Tellurite resistance protein TehB

57

191

0.84

PF02353

CMAS

Mycolic acid cyclopropane synthetase

36

185

0.84

PF01209

Ubie_methyltran

ubiE/COQ5 methyltransferase family

47

180

0.84

PF08003

Methyltransf_9

Protein of unknown function (DUF1698)

48

185

0.8

PF13489

Methyltransf_23

Methyltransferase domain

17

195

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
7bgg-assembly1.cif.gz_A crystal structure of the heterocyclic toxin methyltransferase from mycobacterium tuberculosis 0.874 52 210
3hm2-assembly1.cif.gz_A crystal structure of putative precorrin-6y c5,15-methyltransferase targeted domain from corynebacterium diphtheriae 0.8382 46 172
2i6g-assembly1.cif.gz_A crystal structure of a putative methyltransferase (tehb, stm1608) from salmonella typhimurium lt2 at 1.90 a resolution 0.8342 52 209
7noy-assembly1.cif.gz_A crystal structure of the heterocyclic toxin methyltransferase from mycobacterium tuberculosis in complex with substrate 1-hydroxyquinolin-4(1h)-one 0.8307 15 210
7nmk-assembly1.cif.gz_A crystal structure of the heterocyclic toxin methyltransferase from mycobacterium tuberculosis with bound methylation product 1-methoxyquinolin-4(1h)-one 0.8283 15 210
ID Description Score Start End Superfamily
af_A0A1D6EFY7_537_616_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9063 62 120 3.40.50.150
af_Q8I3G1_737_866_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8738 64 137 3.40.50.150
5himA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8636 66 211 3.40.50.150
af_Q9GZF8_8_143_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8631 49 168 3.40.50.150
3d2lA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8523 44 266 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A2V8CIK8-F1-model_v4 Methyltransferase domain-containing protein 0.9504 10 266 GO:0008168
GO:0016020
AF-A0A534ATX6-F1-model_v4 Class I SAM-dependent methyltransferase 0.9415 40 252 GO:0008168
GO:0032259
AF-A0A534ATX6-F1-model_v4 Class I SAM-dependent methyltransferase 0.9249 40 252 GO:0008168
GO:0032259
AF-A0A2V8CIK8-F1-model_v4 Methyltransferase domain-containing protein 0.8901 10 266 GO:0008168
GO:0016020
AF-A0A6P0J1C4-F1-model_v4 Class I SAM-dependent methyltransferase 0.8898 66 168 GO:0008168
GO:0032259

Map