F323172

General Info

Members Datasets Scaffolds Average Seq Length
212 87 422 231

Family's Representative Sequence

Representative Sequence 3300044712|Ga0453684_0000797|Ga0453684_0000797_61986_62642
Length 218
Sequence MVRKTFETEIQRLKDEVLLLGSMVEQATLDSVEALRTRNLEASKKIIEADKTINARRFAIENQVMIAIATQQPMAHDLRLLASILEVSGELERMGDYAKGISVINLRMVEPLKPISNLPPMARKSVDMLHRALTAFVNEDLELARAIPLEDDEVDAMYDQIYRLLMSYVIENAHNIEHANWLIWAAHNLERMADRVTNICERTLFVATGEYQELEQAD

Samples

Sample ID Description Type Environment
1 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
5 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
6 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
7 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
8 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
9 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
10 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
11 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
12 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
13 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
14 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
15 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
16 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
17 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
18 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
19 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
20 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
21 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
22 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
23 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
24 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
25 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
26 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
27 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
28 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
29 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
30 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
31 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
32 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
37 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
39 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
43 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
44 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
45 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
46 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
47 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
48 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
49 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
50 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
51 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
52 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
53 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
54 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
55 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
56 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
57 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
58 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
59 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
60 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
61 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
62 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
63 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
64 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
65 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
66 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
67 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
68 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
69 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
70 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
71 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
72 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
73 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
74 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
75 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
76 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
77 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
78 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
79 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
80 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
81 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
82 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
83 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
84 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
85 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
86 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
87 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.06
Metatranscriptomes 0.94
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 99.06
Stem 0
Stem Tuber 0
Unclassified 7.08

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0453684_0000797 3300044712 Bacteria 107625
2 Ga0065704_10000266 3300005289 Bacteria 46396
3 Ga0065704_10178098 3300005289 Bacteria 1252
4 Ga0065707_10000525 3300005295 Bacteria 38492
5 Ga0065707_10087798 3300005295 Bacteria 4885
6 Ga0065707_10093547 3300005295 Bacteria 3613
7 Ga0065707_10094680 3300005295 Bacteria 3462
8 Ga0070705_100139438 3300005440 Bacteria 1594
9 Ga0070705_100186406 3300005440 Bacteria 1410
10 Ga0070694_100340050 3300005444 Bacteria 1160
11 Ga0070707_100146077 3300005468 Bacteria 2302
12 Ga0070698_100675204 3300005471 Bacteria 975
13 Ga0070699_100000817 3300005518 Bacteria 28818
14 Ga0070699_100003338 3300005518 Bacteria 14204
15 Ga0070697_100186550 3300005536 Bacteria 1759
16 Ga0070696_100217344 3300005546 Bacteria 1433
17 Ga0070704_100170660 3300005549 Bacteria 1730
18 Ga0070704_100533778 3300005549 Bacteria 1023
19 Ga0068857_100820533 3300005577 Bacteria 889
20 Ga0070702_100302350 3300005615 Bacteria 1107
21 Ga0068859_100177371 3300005617 Bacteria 2213
22 Ga0068861_100543248 3300005719 Bacteria 1058
23 Ga0068861_100582576 3300005719 Bacteria 1024
24 Ga0068860_100819971 3300005843 Bacteria 944
25 Ga0068862_100036917 3300005844 Bacteria 4141
26 Ga0075427_10000327 3300006194 Bacteria 5203
27 Ga0075428_100010640 3300006844 Bacteria 10225
28 Ga0075428_100361992 3300006844 Bacteria 1556
29 Ga0075430_100057391 3300006846 Bacteria 3275
30 Ga0075430_100798774 3300006846 Unclassified 778
31 Ga0075431_100026568 3300006847 Bacteria 5939
32 Ga0075431_100363727 3300006847 Bacteria 1453
33 Ga0075433_10656446 3300006852 Bacteria 919
34 Ga0075433_10880933 3300006852 Archaea 781
35 Ga0075429_100000693 3300006880 Bacteria 26238
36 Ga0075429_100037782 3300006880 Bacteria 4203
37 Ga0075429_100082592 3300006880 Bacteria 2800
38 Ga0075429_100125654 3300006880 Bacteria 2243
39 Ga0075429_100169799 3300006880 Bacteria 1911
40 Ga0075429_100404188 3300006880 Bacteria 1196
41 Ga0097620_100177371 3300006931 Bacteria 2213
42 Ga0111539_10921303 3300009094 Unclassified 1016
43 Ga0114129_10032646 3300009147 Bacteria 7356
44 Ga0114129_10048273 3300009147 Bacteria 5982
45 Ga0114129_10081228 3300009147 Bacteria 4506
46 Ga0114129_10222464 3300009147 Bacteria 2546
47 Ga0105243_10021674 3300009148 Bacteria 4878
48 Ga0105243_10528973 3300009148 Bacteria 1122
49 Ga0105249_10115807 3300009553 Bacteria 2540
50 Ga0105239_10411108 3300010375 Bacteria 1532
51 Ga0105246_10005760 3300011119 Bacteria 7558
52 Ga0163163_11250233 3300014325 Bacteria 805
53 Ga0207660_10890613 3300025917 Unclassified 726
54 Ga0207646_10230872 3300025922 Bacteria 1672
55 Ga0207709_10247603 3300025935 Bacteria 1300
56 Ga0207670_10465679 3300025936 Bacteria 1021
57 Ga0207703_10333242 3300026035 Bacteria 1393
58 Ga0207708_10366832 3300026075 Bacteria 1185
59 Ga0207648_10633574 3300026089 Bacteria 987
60 Ga0207674_10099968 3300026116 Bacteria 2883
61 Ga0207675_100325599 3300026118 Bacteria 1501
62 Ga0268265_10025631 3300028380 Bacteria 4189
63 Ga0268265_10213936 3300028380 Bacteria 1682
64 Ga0265326_10037077 3300028558 Bacteria 1386
65 Ga0265334_10040045 3300028573 Bacteria 1837
66 Ga0265318_10005805 3300028577 Bacteria 5756
67 Ga0265323_10040395 3300028653 Bacteria 1697
68 Ga0265323_10080180 3300028653 Unclassified 1103
69 Ga0265320_10019010 3300031240 Bacteria 3767
70 Ga0265340_10009087 3300031247 Bacteria 5343
71 Ga0265331_10011762 3300031250 Bacteria 4778
72 Ga0265316_10203516 3300031344 Bacteria 1467
73 Ga0307408_100674476 3300031548 Bacteria 927
74 Ga0316579_10028815 3300031691 Bacteria 2530
75 Ga0316579_10036684 3300031691 Bacteria 2262
76 Ga0316579_10040061 3300031691 Bacteria 2172
77 Ga0316579_10115638 3300031691 Bacteria 1288
78 Ga0316576_10110926 3300031727 Bacteria 2056
79 Ga0316576_10296916 3300031727 Unclassified 1208
80 Ga0316578_10012400 3300031728 Bacteria 4496
81 Ga0316578_10077641 3300031728 Bacteria 1972
82 Ga0316578_10317593 3300031728 Bacteria 930
83 Ga0307405_10162851 3300031731 Bacteria 1582
84 Ga0316577_10021422 3300031733 Bacteria 3586
85 Ga0316577_10037943 3300031733 Unclassified 2694
86 Ga0316577_10047979 3300031733 Bacteria 2385
87 Ga0307413_10118407 3300031824 Bacteria 1788
88 Ga0307416_100201016 3300032002 Bacteria 1891
89 Ga0307416_100394537 3300032002 Bacteria 1419
90 Ga0307415_100099695 3300032126 Bacteria 2127
91 Ga0316585_10028924 3300032137 Bacteria 1735
92 Ga0316580_10046573 3300032139 Bacteria 1337
93 Ga0316593_10021412 3300032168 Bacteria 2021
94 Ga0316593_10071862 3300032168 Bacteria 1198
95 Ga0316574_0006131 3300035398 Bacteria 6471
96 Ga0316574_0040734 3300035398 Bacteria 2861
97 Ga0316574_0054029 3300035398 Bacteria 2508
98 Ga0316574_0183979 3300035398 Bacteria 1344
99 Ga0316582_0011745 3300036647 Bacteria 4857
100 Ga0316582_0160325 3300036647 Bacteria 1524
101 Ga0316582_0430350 3300036647 Bacteria 909
102 Ga0316584_0015151 3300036712 Bacteria 5510
103 Ga0316584_0039080 3300036712 Bacteria 3532
104 Ga0316584_0053455 3300036712 Bacteria 3023
105 Ga0316584_0111167 3300036712 Bacteria 2050
106 Ga0316584_0153262 3300036712 Bacteria 1715
107 Ga0316584_0492897 3300036712 Bacteria 862
108 Ga0316581_0041797 3300037588 Bacteria 1398
109 Ga0400488_55273 3300038741 Bacteria 1375
110 Ga0400487_13094 3300039110 Bacteria 1954
111 Ga0451577_0003663 3300042876 Bacteria 16833
112 Ga0451577_0007185 3300042876 Bacteria 10977
113 Ga0451577_0027740 3300042876 Bacteria 5125
114 Ga0451577_0079179 3300042876 Bacteria 2929
115 Ga0451577_0095007 3300042876 Bacteria 2662
116 Ga0451577_0111660 3300042876 Bacteria 2446
117 Ga0451577_0127181 3300042876 Bacteria 2284
118 Ga0451577_0130439 3300042876 Bacteria 2254
119 Ga0451577_0188795 3300042876 Bacteria 1859
120 Ga0451577_0287818 3300042876 Bacteria 1489
121 Ga0451577_0344065 3300042876 Bacteria 1353
122 Ga0451577_0352130 3300042876 Unclassified 1336
123 Ga0451577_0362449 3300042876 Bacteria 1315
124 Ga0451577_0610695 3300042876 Bacteria 990
125 Ga0453683_0000331 3300044673 Bacteria 58273
126 Ga0453683_0019454 3300044673 Bacteria 4348
127 Ga0453683_0027750 3300044673 Bacteria 3587
128 Ga0453683_0037204 3300044673 Bacteria 3062
129 Ga0453683_0075432 3300044673 Bacteria 2111
130 Ga0453683_0238070 3300044673 Bacteria 1159
131 Ga0453683_0320936 3300044673 Unclassified 992
132 Ga0453683_0407176 3300044673 Unclassified 877
133 Ga0453684_0000021 3300044712 Bacteria 873490
134 Ga0453684_0000023 3300044712 Bacteria 857153
135 Ga0453684_0000095 3300044712 Bacteria 378681
136 Ga0453684_0000162 3300044712 Bacteria 298154
137 Ga0453684_0000269 3300044712 Bacteria 223826
138 Ga0453684_0000726 3300044712 Bacteria 116252
139 Ga0453684_0007295 3300044712 Bacteria 20455
140 Ga0453684_0008814 3300044712 Bacteria 17894
141 Ga0453684_0012844 3300044712 Bacteria 13724
142 Ga0453684_0018483 3300044712 Bacteria 10695
143 Ga0453684_0019598 3300044712 Bacteria 10281
144 Ga0453684_0034746 3300044712 Bacteria 6986
145 Ga0453684_0053481 3300044712 Bacteria 5270
146 Ga0453684_0063870 3300044712 Bacteria 4706
147 Ga0453684_0077535 3300044712 Bacteria 4164
148 Ga0453684_0088119 3300044712 Bacteria 3844
149 Ga0453684_0094156 3300044712 Bacteria 3686
150 Ga0453684_0104232 3300044712 Bacteria 3463
151 Ga0453684_0105473 3300044712 Bacteria 3437
152 Ga0453684_0125868 3300044712 Bacteria 3084
153 Ga0453684_0140240 3300044712 Bacteria 2888
154 Ga0453684_0166641 3300044712 Bacteria 2600
155 Ga0453684_0202110 3300044712 Bacteria 2316
156 Ga0453684_0211570 3300044712 Bacteria 2253
157 Ga0453684_0218109 3300044712 Bacteria 2212
158 Ga0453684_0275751 3300044712 Bacteria 1920
159 Ga0453684_0293077 3300044712 Bacteria 1852
160 Ga0453684_0394359 3300044712 Unclassified 1551
161 Ga0453684_0470784 3300044712 Bacteria 1395
162 Ga0453684_0681806 3300044712 Bacteria 1118
163 Ga0453684_0775827 3300044712 Bacteria 1036
164 Ga0453684_1000837 3300044712 Unclassified 889
165 Ga0453684_1126109 3300044712 Unclassified 828
166 Ga0451576_0000242 3300045051 Bacteria 133680
167 Ga0451576_0002905 3300045051 Bacteria 24465
168 Ga0451576_0003147 3300045051 Bacteria 23118
169 Ga0451576_0008594 3300045051 Bacteria 11964
170 Ga0451576_0016950 3300045051 Bacteria 8024
171 Ga0451576_0017222 3300045051 Bacteria 7948
172 Ga0451576_0018264 3300045051 Bacteria 7691
173 Ga0451576_0033034 3300045051 Bacteria 5501
174 Ga0451576_0152010 3300045051 Bacteria 2414
175 Ga0451576_0287146 3300045051 Bacteria 1720
176 Ga0451576_0441940 3300045051 Bacteria 1365
177 Ga0451576_0497579 3300045051 Bacteria 1280
178 Ga0451576_0536231 3300045051 Unclassified 1229
179 Ga0451576_0538270 3300045051 Bacteria 1227
180 Ga0501039_0500898 3300049575 Bacteria 954
181 Ga0501048_0342009 3300049582 Bacteria 1067
182 Ga0501071_0362287 3300049587 Bacteria 1104
183 Ga0501071_0567969 3300049587 Bacteria 872
184 Ga0501073_0102716 3300049589 Bacteria 1985
185 Ga0501073_0174741 3300049589 Bacteria 1487
186 Ga0501075_0369050 3300049591 Bacteria 1094
187 Ga0501076_0089844 3300049592 Unclassified 2470
188 Ga0501076_0603730 3300049592 Bacteria 905
189 Ga0501227_004759 3300049665 Bacteria 2911
190 Ga0501079_0316372 3300049741 Bacteria 1222
191 Ga0501080_0281038 3300049742 Bacteria 1513
192 Ga0501080_0464125 3300049742 Bacteria 1134
193 Ga0501083_0282481 3300049744 Bacteria 1080
194 nmdc:mga05p37_104953_c1 3300050507 Bacteria 3477
195 nmdc:mga05p37_2187_c1 3300050507 Bacteria 22801
196 nmdc:mga05p37_330822_c1 3300050507 Bacteria 1800
197 nmdc:mga05p37_39818_c1 3300050507 Bacteria 5771
198 nmdc:mga05p37_73514_c1 3300050507 Bacteria 4207
199 nmdc:mga09592_13355_c1 3300050508 Bacteria 6707
200 nmdc:mga09592_16119_c1 3300050508 Bacteria 6107
201 nmdc:mga09592_17020_c1 3300050508 Bacteria 5950
202 nmdc:mga09592_4443_c1 3300050508 Bacteria 11351
203 nmdc:mga09592_492499_c1 3300050508 Bacteria 1056
204 nmdc:mga0qj67_19445_c1 3300050509 Bacteria 5188
205 nmdc:mga0qj67_398010_c1 3300050509 Bacteria 1111
206 nmdc:mga0n895_521695_c1 3300050512 Bacteria 1195
207 nmdc:mga0a205_298131_c1 3300050515 Bacteria 1485
208 nmdc:mga0a205_575837_c1 3300050515 Unclassified 980
209 Ga0501084_0332370 3300054114 Bacteria 1283
210 Ga0501084_0389086 3300054114 Bacteria 1178
211 Ga0501082_0129238 3300060353 Bacteria 2192
212 Ga0453684_0000797
213 Ga0065704_10000266
214 Ga0065704_10178098
215 Ga0065707_10000525
216 Ga0065707_10087798
217 Ga0065707_10093547
218 Ga0065707_10094680
219 Ga0070705_100139438
220 Ga0070705_100186406
221 Ga0070694_100340050
222 Ga0070707_100146077
223 Ga0070698_100675204
224 Ga0070699_100000817
225 Ga0070699_100003338
226 Ga0070697_100186550
227 Ga0070696_100217344
228 Ga0070704_100170660
229 Ga0070704_100533778
230 Ga0068857_100820533
231 Ga0070702_100302350
232 Ga0068859_100177371
233 Ga0068861_100543248
234 Ga0068861_100582576
235 Ga0068860_100819971
236 Ga0068862_100036917
237 Ga0075427_10000327
238 Ga0075428_100010640
239 Ga0075428_100361992
240 Ga0075430_100057391
241 Ga0075430_100798774
242 Ga0075431_100026568
243 Ga0075431_100363727
244 Ga0075433_10656446
245 Ga0075433_10880933
246 Ga0075429_100000693
247 Ga0075429_100037782
248 Ga0075429_100082592
249 Ga0075429_100125654
250 Ga0075429_100169799
251 Ga0075429_100404188
252 Ga0097620_100177371
253 Ga0111539_10921303
254 Ga0114129_10032646
255 Ga0114129_10048273
256 Ga0114129_10081228
257 Ga0114129_10222464
258 Ga0105243_10021674
259 Ga0105243_10528973
260 Ga0105249_10115807
261 Ga0105239_10411108
262 Ga0105246_10005760
263 Ga0163163_11250233
264 Ga0207660_10890613
265 Ga0207646_10230872
266 Ga0207709_10247603
267 Ga0207670_10465679
268 Ga0207703_10333242
269 Ga0207708_10366832
270 Ga0207648_10633574
271 Ga0207674_10099968
272 Ga0207675_100325599
273 Ga0268265_10025631
274 Ga0268265_10213936
275 Ga0265326_10037077
276 Ga0265334_10040045
277 Ga0265318_10005805
278 Ga0265323_10040395
279 Ga0265323_10080180
280 Ga0265320_10019010
281 Ga0265340_10009087
282 Ga0265331_10011762
283 Ga0265316_10203516
284 Ga0307408_100674476
285 Ga0316579_10028815
286 Ga0316579_10036684
287 Ga0316579_10040061
288 Ga0316579_10115638
289 Ga0316576_10110926
290 Ga0316576_10296916
291 Ga0316578_10012400
292 Ga0316578_10077641
293 Ga0316578_10317593
294 Ga0307405_10162851
295 Ga0316577_10021422
296 Ga0316577_10037943
297 Ga0316577_10047979
298 Ga0307413_10118407
299 Ga0307416_100201016
300 Ga0307416_100394537
301 Ga0307415_100099695
302 Ga0316585_10028924
303 Ga0316580_10046573
304 Ga0316593_10021412
305 Ga0316593_10071862
306 Ga0316574_0006131
307 Ga0316574_0040734
308 Ga0316574_0054029
309 Ga0316574_0183979
310 Ga0316582_0011745
311 Ga0316582_0160325
312 Ga0316582_0430350
313 Ga0316584_0015151
314 Ga0316584_0039080
315 Ga0316584_0053455
316 Ga0316584_0111167
317 Ga0316584_0153262
318 Ga0316584_0492897
319 Ga0316581_0041797
320 Ga0400488_55273
321 Ga0400487_13094
322 Ga0451577_0003663
323 Ga0451577_0007185
324 Ga0451577_0027740
325 Ga0451577_0079179
326 Ga0451577_0095007
327 Ga0451577_0111660
328 Ga0451577_0127181
329 Ga0451577_0130439
330 Ga0451577_0188795
331 Ga0451577_0287818
332 Ga0451577_0344065
333 Ga0451577_0352130
334 Ga0451577_0362449
335 Ga0451577_0610695
336 Ga0453683_0000331
337 Ga0453683_0019454
338 Ga0453683_0027750
339 Ga0453683_0037204
340 Ga0453683_0075432
341 Ga0453683_0238070
342 Ga0453683_0320936
343 Ga0453683_0407176
344 Ga0453684_0000021
345 Ga0453684_0000023
346 Ga0453684_0000095
347 Ga0453684_0000162
348 Ga0453684_0000269
349 Ga0453684_0000726
350 Ga0453684_0007295
351 Ga0453684_0008814
352 Ga0453684_0012844
353 Ga0453684_0018483
354 Ga0453684_0019598
355 Ga0453684_0034746
356 Ga0453684_0053481
357 Ga0453684_0063870
358 Ga0453684_0077535
359 Ga0453684_0088119
360 Ga0453684_0094156
361 Ga0453684_0104232
362 Ga0453684_0105473
363 Ga0453684_0125868
364 Ga0453684_0140240
365 Ga0453684_0166641
366 Ga0453684_0202110
367 Ga0453684_0211570
368 Ga0453684_0218109
369 Ga0453684_0275751
370 Ga0453684_0293077
371 Ga0453684_0394359
372 Ga0453684_0470784
373 Ga0453684_0681806
374 Ga0453684_0775827
375 Ga0453684_1000837
376 Ga0453684_1126109
377 Ga0451576_0000242
378 Ga0451576_0002905
379 Ga0451576_0003147
380 Ga0451576_0008594
381 Ga0451576_0016950
382 Ga0451576_0017222
383 Ga0451576_0018264
384 Ga0451576_0033034
385 Ga0451576_0152010
386 Ga0451576_0287146
387 Ga0451576_0441940
388 Ga0451576_0497579
389 Ga0451576_0536231
390 Ga0451576_0538270
391 Ga0501039_0500898
392 Ga0501048_0342009
393 Ga0501071_0362287
394 Ga0501071_0567969
395 Ga0501073_0102716
396 Ga0501073_0174741
397 Ga0501075_0369050
398 Ga0501076_0089844
399 Ga0501076_0603730
400 Ga0501227_004759
401 Ga0501079_0316372
402 Ga0501080_0281038
403 Ga0501080_0464125
404 Ga0501083_0282481
405 nmdc:mga05p37_104953_c1
406 nmdc:mga05p37_2187_c1
407 nmdc:mga05p37_330822_c1
408 nmdc:mga05p37_39818_c1
409 nmdc:mga05p37_73514_c1
410 nmdc:mga09592_13355_c1
411 nmdc:mga09592_16119_c1
412 nmdc:mga09592_17020_c1
413 nmdc:mga09592_4443_c1
414 nmdc:mga09592_492499_c1
415 nmdc:mga0qj67_19445_c1
416 nmdc:mga0qj67_398010_c1
417 nmdc:mga0n895_521695_c1
418 nmdc:mga0a205_298131_c1
419 nmdc:mga0a205_575837_c1
420 Ga0501084_0332370
421 Ga0501084_0389086
422 Ga0501082_0129238

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01895

PhoU

PhoU domain

17

104

0.96

PF01895

PhoU

PhoU domain

118

203

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
1t72-assembly1.cif.gz_A crystal structure of phosphate transport system protein phou from aquifex aeolicus 0.9685 14 222
1sum-assembly1.cif.gz_B crystal structure of a hypothetical protein at 2.0 a resolution 0.9469 14 227
2i0m-assembly1.cif.gz_A crystal structure of the phosphate transport system regulatory protein phou from streptococcus pneumoniae 0.946 16 224
1xwm-assembly1.cif.gz_A-2 the crystal structure of phou (phosphate uptake regulator), structural genomics 0.944 16 223
4q25-assembly1.cif.gz_B crystal structure of phou from pseudomonas aeruginosa 0.939 16 222
ID Description Score Start End Superfamily
af_P0A9K7_1_117_1.20.58.220 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Phosphate transport system protein phou homolog 2; domain 2 0.983 7 116 1.20.58.220
af_Q58415_1_113_1.20.58.220 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Phosphate transport system protein phou homolog 2; domain 2 0.9741 14 122 1.20.58.220
1t8bA01 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Phosphate transport system protein phou homolog 2; domain 2 0.9713 15 124 1.20.58.220
1t8bB01 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Phosphate transport system protein phou homolog 2; domain 2 0.9697 15 124 1.20.58.220
2i0mA01 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Phosphate transport system protein phou homolog 2; domain 2 0.964 16 120 1.20.58.220
ID Description Score Start End GO Terms
AF-A0A7C3J801-F1-model_v4 Phosphate-specific transport system accessory protein PhoU 0.9972 13 227 GO:0005737
GO:0006817
GO:0030643
GO:0045936
AF-A0A3N5G7S4-F1-model_v4 Phosphate signaling complex protein PhoU 0.9963 12 203 GO:0030643
GO:0045936
AF-A0A6J4UKY8-F1-model_v4 Phosphate transport system regulatory protein PhoU 0.9949 13 218 GO:0030643
GO:0045936
AF-A0A8B5XEY0-F1-model_v4 Phosphate-specific transport system accessory protein PhoU 0.9939 7 222 GO:0005737
GO:0006817
GO:0030643
GO:0045936
AF-X1TQL9-F1-model_v4 PhoU domain-containing protein 0.9938 35 227 GO:0030643
GO:0045936

Map