F322981

General Info

Members Datasets Scaffolds Average Seq Length
212 157 203 121

Family's Representative Sequence

Representative Sequence 3300029957|Ga0265324_10133273|Ga0265324_101332731
Length 134
Sequence LVAANKTVTPKHKPKSWVPDRQEIVWIDCNPQVSREMRDVHPFLVLSPRIFNEKTSLVIGLPMTTAEYNADNPFALAVDKAKGRKIGQTSYVLCHQPKSFDWRLRKAKAHPLGVLSSDLFAQVCERLNQIIQVG

Samples

Sample ID Description Type Environment
1 2513237150 Cupriavidus taiwanensis STM6018 Isolate Nodule
2 2515154123 Trinickia symbiotica JPY347 Isolate Nodule
3 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
4 2894510363 Methylomonas sp. Kb3 Isolate Unclassified
5 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300003544 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
9 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
10 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
11 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
12 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
13 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
14 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
24 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
25 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
26 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
27 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
28 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
29 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
30 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
31 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
32 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
33 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
34 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
35 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
36 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
37 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
38 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
39 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
40 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
41 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
42 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
43 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
44 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
45 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
46 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
47 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
48 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
49 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
50 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
51 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
52 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
53 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
54 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
55 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
56 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
57 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
58 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
59 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
60 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
80 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
81 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
82 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
83 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
84 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
85 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
86 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
87 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
88 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
89 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
90 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
91 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
92 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
93 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
94 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
95 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
96 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
97 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
98 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
99 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
100 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
101 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
102 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
103 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
104 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
105 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
106 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
107 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
108 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
109 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
110 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
111 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
112 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
113 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
114 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
115 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
116 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
117 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
118 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
119 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
120 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
121 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
122 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
123 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
124 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
125 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
126 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
127 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
128 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
129 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
130 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
131 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
132 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
133 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
134 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
135 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
136 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
137 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
138 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
139 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
140 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
141 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
142 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
143 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
144 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
145 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
146 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
147 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
148 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
149 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
150 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
151 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
152 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
153 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
154 644736347 Cupriavidus taiwanensis LMG 19424 Isolate Nodule
155 8003400568 Cupriavidus gilardii USM5 Isolate Rhizosphere
156 8020807995 Burkholderia sp. B10 Isolate Rhizosphere
157 8040173305 Burkholderia vietnamiensis BE10 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.87
Metatranscriptomes 2.36
Isolates 3.77

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.49
Nodule 1.42
Rhizoplane 0.94
Rhizosphere 86.32
Stem 0
Stem Tuber 0
Unclassified 2.83

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1018566 3300001904 Bacteria 1100
2 JGI24735J21928_10000552 3300002067 Bacteria 13146
3 rootH1_10133781 3300003323 Bacteria 2642
4 Ga0007417J51691_1081301 3300003544 Unclassified 965
5 Ga0007409J51694_1066874 3300003575 Unclassified 1787
6 Ga0007416J51690_1048587 3300003577 Unclassified 1915
7 Ga0055527_1005737 3300003760 Bacteria 1594
8 Ga0055526_1000018 3300003771 Bacteria 198838
9 Ga0070658_10069993 3300005327 Bacteria 2871
10 Ga0070658_10413076 3300005327 Bacteria 1160
11 Ga0070683_100334481 3300005329 Bacteria 1442
12 Ga0070660_100665405 3300005339 Bacteria 872
13 Ga0070661_100028678 3300005344 Bacteria 4016
14 Ga0070671_100217862 3300005355 Bacteria 1619
15 Ga0070674_100299538 3300005356 Bacteria 1281
16 Ga0070667_100020754 3300005367 Bacteria 5456
17 Ga0070678_100077837 3300005456 Bacteria 2503
18 Ga0070665_100374542 3300005548 Bacteria 1431
19 Ga0068855_100078975 3300005563 Bacteria 3817
20 Ga0068856_100000167 3300005614 Bacteria 68389
21 Ga0068856_100716202 3300005614 Bacteria 1021
22 Ga0068864_100382209 3300005618 Bacteria 1334
23 Ga0068864_100992029 3300005618 Unclassified 833
24 Ga0068860_100132157 3300005843 Bacteria 2396
25 Ga0075363_100089085 3300006048 Bacteria 1697
26 Ga0075363_100369208 3300006048 Bacteria 840
27 Ga0068871_100695894 3300006358 Bacteria 931
28 Ga0068865_100273775 3300006881 Bacteria 1341
29 Ga0105251_10430839 3300009011 Bacteria 609
30 Ga0105244_10002156 3300009036 Bacteria 15091
31 Ga0105240_10053913 3300009093 Bacteria 5043
32 Ga0105240_10128305 3300009093 Bacteria 3045
33 Ga0105240_10156038 3300009093 Bacteria 2714
34 Ga0105245_11181829 3300009098 Bacteria 813
35 Ga0105241_10501651 3300009174 Bacteria 1082
36 Ga0105248_10046815 3300009177 Bacteria 4849
37 Ga0105237_10022910 3300009545 Bacteria 6405
38 Ga0105237_10440295 3300009545 Bacteria 1309
39 Ga0105238_10143487 3300009551 Bacteria 2364
40 Ga0105249_12804040 3300009553 Unclassified 559
41 Ga0105239_10005613 3300010375 Bacteria 14671
42 Ga0105239_12169222 3300010375 Bacteria 646
43 Ga0105246_10562541 3300011119 Unclassified 979
44 Ga0157373_10219967 3300013100 Bacteria 1340
45 Ga0157371_10005833 3300013102 Bacteria 10303
46 Ga0157370_10008320 3300013104 Bacteria 11188
47 Ga0157370_10080142 3300013104 Bacteria 3074
48 Ga0157369_10003047 3300013105 Bacteria 20002
49 Ga0157369_10395944 3300013105 Bacteria 1433
50 Ga0157374_10000169 3300013296 Bacteria 60624
51 Ga0157378_10499353 3300013297 Unclassified 1215
52 Ga0163162_10001755 3300013306 Bacteria 20325
53 Ga0157372_10000944 3300013307 Bacteria 31734
54 Ga0157372_11635744 3300013307 Bacteria 741
55 Ga0157375_10116350 3300013308 Bacteria 2778
56 Ga0163163_10063629 3300014325 Unclassified 3658
57 Ga0182008_10004381 3300014497 Bacteria 8260
58 Ga0182008_10482899 3300014497 Bacteria 679
59 Ga0182006_1013519 3300015261 Bacteria 3540
60 Ga0182006_1022479 3300015261 Bacteria 2621
61 Ga0182007_10038115 3300015262 Bacteria 1613
62 Ga0182007_10076906 3300015262 Unclassified 1094
63 Ga0182005_1030078 3300015265 Bacteria 1481
64 Ga0163161_10353947 3300017792 Bacteria 1168
65 Ga0206350_10616689 3300020080 Bacteria 696
66 Ga0213872_10002145 3300021361 Bacteria 11831
67 Ga0224712_10336979 3300022467 Unclassified 711
68 Ga0209672_100556 3300025228 Bacteria 20023
69 Ga0209564_1000068 3300025295 Bacteria 311171
70 Ga0207655_1069067 3300025728 Bacteria 1322
71 Ga0207647_10000272 3300025904 Bacteria 42247
72 Ga0207705_10254981 3300025909 Bacteria 1338
73 Ga0207705_10402182 3300025909 Bacteria 1059
74 Ga0207695_10047838 3300025913 Bacteria 4522
75 Ga0207695_10190827 3300025913 Bacteria 1966
76 Ga0207695_11470924 3300025913 Unclassified 562
77 Ga0207671_10167185 3300025914 Bacteria 1706
78 Ga0207657_10001435 3300025919 Bacteria 25476
79 Ga0207649_10175299 3300025920 Unclassified 1497
80 Ga0207644_10034881 3300025931 Bacteria 3522
81 Ga0207669_11276467 3300025937 Bacteria 623
82 Ga0207704_10264048 3300025938 Bacteria 1299
83 Ga0207711_10099828 3300025941 Unclassified 2567
84 Ga0207667_10119000 3300025949 Bacteria 2722
85 Ga0207658_10213627 3300025986 Unclassified 1618
86 Ga0207658_11374272 3300025986 Bacteria 646
87 Ga0207702_10000130 3300026078 Bacteria 89196
88 Ga0207641_10815223 3300026088 Unclassified 924
89 Ga0207676_10251778 3300026095 Unclassified 1590
90 Ga0207683_10325341 3300026121 Bacteria 1409
91 Ga0268266_10650718 3300028379 Bacteria 1014
92 Ga0268264_10139267 3300028381 Bacteria 2162
93 Ga0265318_10041878 3300028577 Bacteria 1739
94 Ga0265338_10000802 3300028800 Bacteria 53087
95 Ga0265324_10133273 3300029957 Unclassified 844
96 Ga0265331_10010925 3300031250 Bacteria 4992
97 Ga0265331_10038008 3300031250 Bacteria 2355
98 Ga0265327_10000236 3300031251 Bacteria 110434
99 Ga0265327_10020711 3300031251 Bacteria 3996
100 Ga0265327_10075257 3300031251 Bacteria 1680
101 Ga0265327_10085898 3300031251 Bacteria 1544
102 Ga0307513_10047301 3300031456 Bacteria 4681
103 Ga0307509_10596302 3300031507 Unclassified 778
104 Ga0307516_10368221 3300031730 Bacteria 1100
105 Ga0373961_0043080 3300035241 Bacteria 1311
106 Ga0373935_0791097 3300035692 Unclassified 700
107 Ga0395899_0016370 3300037312 Bacteria 5651
108 Ga0395899_0026157 3300037312 Bacteria 4404
109 Ga0395899_0283975 3300037312 Unclassified 1125
110 Ga0395900_0386220 3300037418 Bacteria 1367
111 Ga0395898_0001998 3300037466 Bacteria 25606
112 Ga0395898_0070852 3300037466 Bacteria 3369
113 Ga0395898_0365655 3300037466 Bacteria 1375
114 Ga0436364_0445350 3300037853 Bacteria 7163
115 Ga0395901_0000104 3300038443 Bacteria 114939
116 Ga0395901_0076702 3300038443 Bacteria 3488
117 Ga0395901_1120354 3300038443 Bacteria 756
118 Ga0436361_0296898 3300039447 Bacteria 13913
119 Ga0439448_0000045 3300042005 Bacteria 20425
120 Ga0451577_0000303 3300042876 Bacteria 95840
121 Ga0451577_0000944 3300042876 Bacteria 42644
122 Ga0451577_0002178 3300042876 Bacteria 23906
123 Ga0451577_0002336 3300042876 Bacteria 22840
124 Ga0451577_0079832 3300042876 Bacteria 2917
125 Ga0451577_0713476 3300042876 Bacteria 908
126 Ga0453683_0001948 3300044673 Bacteria 16766
127 Ga0453683_0002473 3300044673 Bacteria 14290
128 Ga0453684_0000947 3300044712 Bacteria 95768
129 Ga0453684_0002073 3300044712 Bacteria 50911
130 Ga0453684_0033346 3300044712 Bacteria 7183
131 Ga0453684_0061140 3300044712 Bacteria 4838
132 Ga0453684_0289693 3300044712 Unclassified 1865
133 Ga0451576_0017087 3300045051 Bacteria 7983
134 Ga0451576_0068929 3300045051 Bacteria 3681
135 Ga0451576_0406330 3300045051 Bacteria 1428
136 Ga0451576_0514587 3300045051 Bacteria 1257
137 Ga0466967_2348885 3300045976 Bacteria 529
138 Ga0495580_0012495 3300046472 Bacteria 6510
139 Ga0495594_0079350 3300046499 Bacteria 1832
140 Ga0495610_0000575 3300046512 Bacteria 36492
141 Ga0495630_1365713 3300046517 Bacteria 533
142 Ga0495666_0024112 3300046526 Bacteria 3007
143 Ga0495665_0021592 3300046531 Bacteria 3460
144 Ga0495625_0376385 3300046660 Bacteria 892
145 Ga0495624_0780606 3300046690 Bacteria 565
146 Ga0495671_0379677 3300046692 Bacteria 677
147 Ga0495660_0002620 3300046810 Bacteria 11425
148 Ga0495604_0109129 3300047317 Bacteria 2020
149 Ga0495676_0566916 3300047321 Unclassified 741
150 Ga0495673_0000188 3300047469 Bacteria 99425
151 Ga0495602_0236413 3300048088 Bacteria 1369
152 Ga0496105_0951201 3300048908 Bacteria 645
153 Ga0496110_0964585 3300048913 Bacteria 760
154 Ga0501032_0070251 3300049569 Unclassified 2335
155 Ga0501033_0304761 3300049570 Bacteria 1121
156 Ga0501034_0001693 3300049571 Bacteria 28418
157 Ga0501034_0036410 3300049571 Bacteria 4985
158 Ga0501034_0071402 3300049571 Bacteria 3481
159 Ga0501036_0602166 3300049572 Bacteria 911
160 Ga0501037_0429380 3300049573 Bacteria 904
161 Ga0501037_0768057 3300049573 Bacteria 638
162 Ga0501038_0017549 3300049574 Bacteria 6470
163 Ga0501041_0620974 3300049577 Bacteria 690
164 Ga0501042_0826626 3300049578 Bacteria 674
165 Ga0501043_0073595 3300049579 Bacteria 2684
166 Ga0501043_0486397 3300049579 Unclassified 923
167 Ga0501043_1028986 3300049579 Bacteria 585
168 Ga0501046_0700821 3300049580 Bacteria 713
169 Ga0501047_0000492 3300049581 Bacteria 42926
170 Ga0501068_0283909 3300049584 Bacteria 1058
171 Ga0501070_0005393 3300049586 Bacteria 10905
172 Ga0501070_0602075 3300049586 Bacteria 876
173 Ga0501071_1361073 3300049587 Bacteria 548
174 Ga0501071_1486756 3300049587 Bacteria 523
175 Ga0501072_0204767 3300049588 Bacteria 1573
176 Ga0501073_0074042 3300049589 Bacteria 2371
177 Ga0501074_0088450 3300049590 Bacteria 2218
178 Ga0501075_0403229 3300049591 Bacteria 1042
179 Ga0501076_0364346 3300049592 Bacteria 1187
180 Ga0501077_0327494 3300049593 Bacteria 977
181 Ga0501240_034320 3300049673 Unclassified 823
182 Ga0501079_0340052 3300049741 Bacteria 1176
183 Ga0501079_0532665 3300049741 Bacteria 923
184 Ga0501080_0000381 3300049742 Bacteria 34167
185 Ga0501080_0140136 3300049742 Bacteria 2236
186 Ga0501081_0041583 3300049743 Bacteria 3148
187 Ga0501035_0420058 3300049822 Unclassified 1110
188 Ga0501035_0810301 3300049822 Bacteria 747
189 Ga0501044_0097727 3300049823 Bacteria 2957
190 nmdc:mga03683_126099_c1 3300050489 Bacteria 1142
191 nmdc:mga03683_421781_c1 3300050489 Unclassified 639
192 nmdc:mga03n38_160189_c1 3300050490 Bacteria 1139
193 nmdc:mga03n38_359135_c1 3300050490 Bacteria 794
194 nmdc:mga06z11_360325_c1 3300050494 Bacteria 871
195 Ga0500578_0000086 3300053086 Bacteria 103107
196 Ga0500557_198409 3300053105 Bacteria 646
197 Ga0500559_0433682 3300053136 Bacteria 609
198 Ga0500586_045563 3300053145 Bacteria 1501
199 Ga0500604_0066260 3300053151 Bacteria 1143
200 Ga0500604_0087963 3300053151 Bacteria 1011
201 Ga0500645_115863 3300053730 Unclassified 750
202 Ga0501082_0715373 3300060353 Bacteria 876
203 Ga0530510_0144004 3300061734 Bacteria 1757

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300015265 Ga0182005_1030078 Ga0182005_10300781 98
2 3300005614 Ga0068856_100000167 Ga0068856_10000016761 107
3 3300025913 Ga0207695_10190827 Ga0207695_101908274 107
4 3300026078 Ga0207702_10000130 Ga0207702_100001309 107
5 3300053086 Ga0500578_0000086 Ga0500578_0000086_56444_56767 107
6 3300053151 Ga0500604_0087963 Ga0500604_0087963_321_644 107
7 3300003575 Ga0007409J51694_1066874 Ga0007409J51694_10668742 108
8 3300005618 Ga0068864_100382209 Ga0068864_1003822093 108
9 3300006358 Ga0068871_100695894 Ga0068871_1006958942 108
10 3300031456 Ga0307513_10047301 Ga0307513_100473013 108
11 3300035692 Ga0373935_0791097 Ga0373935_0791097_191_517 108
12 3300010375 Ga0105239_12169222 Ga0105239_121692222 110
13 3300013296 Ga0157374_10000169 Ga0157374_1000016917 110
14 3300009553 Ga0105249_12804040 Ga0105249_128040401 111
15 3300042876 Ga0451577_0000303 Ga0451577_0000303_18955_19308 113
16 3300042876 Ga0451577_0000944 Ga0451577_0000944_38694_39047 113
17 3300044712 Ga0453684_0000947 Ga0453684_0000947_76533_76886 113
18 3300044712 Ga0453684_0002073 Ga0453684_0002073_13930_14283 113
19 3300045051 Ga0451576_0068929 Ga0451576_0068929_809_1162 113
20 3300047321 Ga0495676_0566916 Ga0495676_0566916_350_703 113
21 3300049571 Ga0501034_0001693 Ga0501034_0001693_7605_7958 113
22 3300049572 Ga0501036_0602166 Ga0501036_0602166_259_612 113
23 3300049573 Ga0501037_0429380 Ga0501037_0429380_34_387 113
24 3300049577 Ga0501041_0620974 Ga0501041_0620974_132_485 113
25 3300049578 Ga0501042_0826626 Ga0501042_0826626_218_571 113
26 3300049579 Ga0501043_0073595 Ga0501043_0073595_424_777 113
27 3300049579 Ga0501043_1028986 Ga0501043_1028986_47_400 113
28 3300049580 Ga0501046_0700821 Ga0501046_0700821_254_607 113
29 3300049581 Ga0501047_0000492 Ga0501047_0000492_27489_27842 113
30 3300049584 Ga0501068_0283909 Ga0501068_0283909_529_882 113
31 3300049586 Ga0501070_0005393 Ga0501070_0005393_9274_9627 113
32 3300049587 Ga0501071_1361073 Ga0501071_1361073_21_374 113
33 3300049587 Ga0501071_1486756 Ga0501071_1486756_27_380 113
34 3300049588 Ga0501072_0204767 Ga0501072_0204767_502_855 113
35 3300049589 Ga0501073_0074042 Ga0501073_0074042_78_431 113
36 3300049590 Ga0501074_0088450 Ga0501074_0088450_442_795 113
37 3300049591 Ga0501075_0403229 Ga0501075_0403229_424_777 113
38 3300049592 Ga0501076_0364346 Ga0501076_0364346_124_477 113
39 3300049741 Ga0501079_0532665 Ga0501079_0532665_358_711 113
40 3300049742 Ga0501080_0000381 Ga0501080_0000381_31735_32088 113
41 3300049743 Ga0501081_0041583 Ga0501081_0041583_1534_1887 113
42 3300049822 Ga0501035_0810301 Ga0501035_0810301_23_376 113
43 3300049823 Ga0501044_0097727 Ga0501044_0097727_1553_1906 113
44 3300060353 Ga0501082_0715373 Ga0501082_0715373_162_515 113
45 3300009093 Ga0105240_10156038 Ga0105240_101560382 114
46 3300009545 Ga0105237_10440295 Ga0105237_104402953 114
47 3300049573 Ga0501037_0768057 Ga0501037_0768057_19_375 114
48 3300049741 Ga0501079_0340052 Ga0501079_0340052_793_1149 114
49 3300005843 Ga0068860_100132157 Ga0068860_1001321573 115
50 3300009177 Ga0105248_10046815 Ga0105248_100468154 115
51 3300013297 Ga0157378_10499353 Ga0157378_104993533 115
52 3300013308 Ga0157375_10116350 Ga0157375_101163504 115
53 3300014325 Ga0163163_10063629 Ga0163163_100636292 115
54 3300025941 Ga0207711_10099828 Ga0207711_100998282 115
55 3300028381 Ga0268264_10139267 Ga0268264_101392673 115
56 iso_pu_bacteria 2588253510 2588293038 115
57 iso_pu_bacteria 2513237150 2513956103 116
58 iso_pu_bacteria 2515154123 2515690246 116
59 iso_pu_bacteria 2894510363 2894512362 116
60 iso_pu_bacteria 644736347 644751862 116
61 iso_pu_bacteria 8003400568 8003402876 116
62 iso_pu_bacteria 8020807995 8020811366 116
63 iso_pu_bacteria 8040173305 8040177164 116
64 3300022467 Ga0224712_10336979 Ga0224712_103369791 117
65 3300031250 Ga0265331_10010925 Ga0265331_100109257 117
66 3300042876 Ga0451577_0079832 Ga0451577_0079832_1476_1871 117
67 3300049571 Ga0501034_0071402 Ga0501034_0071402_2177_2566 117
68 3300049586 Ga0501070_0602075 Ga0501070_0602075_181_570 117
69 3300049742 Ga0501080_0140136 Ga0501080_0140136_569_958 117
70 3300005327 Ga0070658_10069993 Ga0070658_100699933 118
71 3300005329 Ga0070683_100334481 Ga0070683_1003344812 118
72 3300005339 Ga0070660_100665405 Ga0070660_1006654052 118
73 3300005456 Ga0070678_100077837 Ga0070678_1000778371 118
74 3300009093 Ga0105240_10128305 Ga0105240_101283052 118
75 3300013105 Ga0157369_10395944 Ga0157369_103959442 118
76 3300013307 Ga0157372_11635744 Ga0157372_116357441 118
77 3300014497 Ga0182008_10004381 Ga0182008_100043816 118
78 3300015261 Ga0182006_1022479 Ga0182006_10224793 118
79 3300015262 Ga0182007_10038115 Ga0182007_100381152 118
80 3300025909 Ga0207705_10402182 Ga0207705_104021822 118
81 3300025986 Ga0207658_11374272 Ga0207658_113742722 118
82 3300026121 Ga0207683_10325341 Ga0207683_103253413 118
83 3300031251 Ga0265327_10000236 Ga0265327_1000023663 118
84 3300045051 Ga0451576_0514587 Ga0451576_0514587_90_473 118
85 3300046517 Ga0495630_1365713 Ga0495630_1365713_26_391 118
86 3300046660 Ga0495625_0376385 Ga0495625_0376385_21_404 118
87 3300046692 Ga0495671_0379677 Ga0495671_0379677_43_426 118
88 3300049570 Ga0501033_0304761 Ga0501033_0304761_33_413 118
89 3300003323 rootH1_10133781 rootH1_101337813 119
90 3300003771 Ga0055526_1000018 Ga0055526_100001829 119
91 3300005355 Ga0070671_100217862 Ga0070671_1002178623 119
92 3300005356 Ga0070674_100299538 Ga0070674_1002995382 119
93 3300005367 Ga0070667_100020754 Ga0070667_1000207541 119
94 3300005548 Ga0070665_100374542 Ga0070665_1003745422 119
95 3300005618 Ga0068864_100992029 Ga0068864_1009920291 119
96 3300006881 Ga0068865_100273775 Ga0068865_1002737752 119
97 3300017792 Ga0163161_10353947 Ga0163161_103539472 119
98 3300025295 Ga0209564_1000068 Ga0209564_1000068134 119
99 3300025931 Ga0207644_10034881 Ga0207644_100348812 119
100 3300025937 Ga0207669_11276467 Ga0207669_112764672 119
101 3300025938 Ga0207704_10264048 Ga0207704_102640483 119
102 3300025986 Ga0207658_10213627 Ga0207658_102136273 119
103 3300026095 Ga0207676_10251778 Ga0207676_102517783 119
104 3300028379 Ga0268266_10650718 Ga0268266_106507182 119
105 3300028577 Ga0265318_10041878 Ga0265318_100418782 119
106 3300029957 Ga0265324_10133273 Ga0265324_101332731 119
107 3300031250 Ga0265331_10038008 Ga0265331_100380084 119
108 3300031251 Ga0265327_10020711 Ga0265327_100207114 119
109 3300031251 Ga0265327_10075257 Ga0265327_100752573 119
110 3300031251 Ga0265327_10085898 Ga0265327_100858982 119
111 3300031507 Ga0307509_10596302 Ga0307509_105963022 119
112 3300031730 Ga0307516_10368221 Ga0307516_103682212 119
113 3300035241 Ga0373961_0043080 Ga0373961_0043080_480_866 119
114 3300037853 Ga0436364_0445350 Ga0436364_0445350_335_694 119
115 3300042876 Ga0451577_0002178 Ga0451577_0002178_5292_5672 119
116 3300042876 Ga0451577_0002336 Ga0451577_0002336_10357_10737 119
117 3300042876 Ga0451577_0713476 Ga0451577_0713476_127_507 119
118 3300044673 Ga0453683_0001948 Ga0453683_0001948_4731_5129 119
119 3300044712 Ga0453684_0061140 Ga0453684_0061140_3465_3851 119
120 3300044712 Ga0453684_0289693 Ga0453684_0289693_688_1068 119
121 3300045051 Ga0451576_0017087 Ga0451576_0017087_5566_5946 119
122 3300045051 Ga0451576_0406330 Ga0451576_0406330_253_630 119
123 3300049569 Ga0501032_0070251 Ga0501032_0070251_1171_1545 119
124 3300049571 Ga0501034_0036410 Ga0501034_0036410_1296_1670 119
125 3300049574 Ga0501038_0017549 Ga0501038_0017549_2982_3356 119
126 3300049579 Ga0501043_0486397 Ga0501043_0486397_18_392 119
127 3300049593 Ga0501077_0327494 Ga0501077_0327494_442_840 119
128 3300049822 Ga0501035_0420058 Ga0501035_0420058_193_567 119
129 3300053105 Ga0500557_198409 Ga0500557_198409_274_636 119
130 3300053136 Ga0500559_0433682 Ga0500559_0433682_166_564 119
131 3300053151 Ga0500604_0066260 Ga0500604_0066260_455_817 119
132 3300061734 Ga0530510_0144004 Ga0530510_0144004_519_917 119
133 3300001904 JGI24736J21556_1018566 JGI24736J21556_10185661 120
134 3300002067 JGI24735J21928_10000552 JGI24735J21928_1000055215 120
135 3300003544 Ga0007417J51691_1081301 Ga0007417J51691_10813012 120
136 3300003577 Ga0007416J51690_1048587 Ga0007416J51690_10485872 120
137 3300003760 Ga0055527_1005737 Ga0055527_10057374 120
138 3300005327 Ga0070658_10413076 Ga0070658_104130762 120
139 3300005344 Ga0070661_100028678 Ga0070661_1000286787 120
140 3300005563 Ga0068855_100078975 Ga0068855_1000789752 120
141 3300005614 Ga0068856_100716202 Ga0068856_1007162023 120
142 3300006048 Ga0075363_100089085 Ga0075363_1000890852 120
143 3300006048 Ga0075363_100369208 Ga0075363_1003692081 120
144 3300009011 Ga0105251_10430839 Ga0105251_104308392 120
145 3300009036 Ga0105244_10002156 Ga0105244_100021566 120
146 3300009093 Ga0105240_10053913 Ga0105240_100539132 120
147 3300009098 Ga0105245_11181829 Ga0105245_111818292 120
148 3300009174 Ga0105241_10501651 Ga0105241_105016512 120
149 3300009545 Ga0105237_10022910 Ga0105237_100229103 120
150 3300009551 Ga0105238_10143487 Ga0105238_101434874 120
151 3300010375 Ga0105239_10005613 Ga0105239_100056133 120
152 3300011119 Ga0105246_10562541 Ga0105246_105625411 120
153 3300013100 Ga0157373_10219967 Ga0157373_102199672 120
154 3300013102 Ga0157371_10005833 Ga0157371_100058338 120
155 3300013104 Ga0157370_10008320 Ga0157370_1000832012 120
156 3300013104 Ga0157370_10080142 Ga0157370_100801425 120
157 3300013105 Ga0157369_10003047 Ga0157369_1000304716 120
158 3300013296 Ga0157374_10000169 Ga0157374_1000016935 120
159 3300013306 Ga0163162_10001755 Ga0163162_1000175519 120
160 3300013307 Ga0157372_10000944 Ga0157372_1000094422 120
161 3300014497 Ga0182008_10482899 Ga0182008_104828991 120
162 3300015261 Ga0182006_1013519 Ga0182006_10135191 120
163 3300015262 Ga0182007_10076906 Ga0182007_100769062 120
164 3300020080 Ga0206350_10616689 Ga0206350_106166892 120
165 3300021361 Ga0213872_10002145 Ga0213872_100021459 120
166 3300025228 Ga0209672_100556 Ga0209672_10055613 120
167 3300025728 Ga0207655_1069067 Ga0207655_10690673 120
168 3300025904 Ga0207647_10000272 Ga0207647_1000027222 120
169 3300025909 Ga0207705_10254981 Ga0207705_102549812 120
170 3300025913 Ga0207695_10047838 Ga0207695_100478383 120
171 3300025913 Ga0207695_11470924 Ga0207695_114709241 120
172 3300025914 Ga0207671_10167185 Ga0207671_101671851 120
173 3300025919 Ga0207657_10001435 Ga0207657_1000143511 120
174 3300025920 Ga0207649_10175299 Ga0207649_101752993 120
175 3300025949 Ga0207667_10119000 Ga0207667_101190003 120
176 3300026088 Ga0207641_10815223 Ga0207641_108152232 120
177 3300028800 Ga0265338_10000802 Ga0265338_1000080220 120
178 3300037312 Ga0395899_0016370 Ga0395899_0016370_1988_2350 120
179 3300037312 Ga0395899_0026157 Ga0395899_0026157_540_902 120
180 3300037312 Ga0395899_0283975 Ga0395899_0283975_258_620 120
181 3300037418 Ga0395900_0386220 Ga0395900_0386220_196_558 120
182 3300037466 Ga0395898_0001998 Ga0395898_0001998_1140_1502 120
183 3300037466 Ga0395898_0070852 Ga0395898_0070852_873_1235 120
184 3300037466 Ga0395898_0365655 Ga0395898_0365655_237_599 120
185 3300038443 Ga0395901_0000104 Ga0395901_0000104_114124_114486 120
186 3300038443 Ga0395901_0076702 Ga0395901_0076702_2643_3005 120
187 3300038443 Ga0395901_1120354 Ga0395901_1120354_158_520 120
188 3300039447 Ga0436361_0296898 Ga0436361_0296898_2423_2788 120
189 3300042005 Ga0439448_0000045 Ga0439448_0000045_968_1330 120
190 3300044673 Ga0453683_0002473 Ga0453683_0002473_9351_9752 120
191 3300044712 Ga0453684_0033346 Ga0453684_0033346_869_1270 120
192 3300045976 Ga0466967_2348885 Ga0466967_2348885_70_435 120
193 3300046472 Ga0495580_0012495 Ga0495580_0012495_4989_5351 120
194 3300046499 Ga0495594_0079350 Ga0495594_0079350_367_729 120
195 3300046512 Ga0495610_0000575 Ga0495610_0000575_5380_5745 120
196 3300046526 Ga0495666_0024112 Ga0495666_0024112_1363_1725 120
197 3300046531 Ga0495665_0021592 Ga0495665_0021592_2427_2789 120
198 3300046690 Ga0495624_0780606 Ga0495624_0780606_156_518 120
199 3300046810 Ga0495660_0002620 Ga0495660_0002620_2511_2876 120
200 3300047317 Ga0495604_0109129 Ga0495604_0109129_618_980 120
201 3300047469 Ga0495673_0000188 Ga0495673_0000188_88820_89185 120
202 3300048088 Ga0495602_0236413 Ga0495602_0236413_400_762 120
203 3300048908 Ga0496105_0951201 Ga0496105_0951201_117_479 120
204 3300048913 Ga0496110_0964585 Ga0496110_0964585_232_594 120
205 3300049673 Ga0501240_034320 Ga0501240_034320_26_391 120
206 3300050489 nmdc:mga03683_126099_c1 nmdc:mga03683_126099_c1_497_862 120
207 3300050489 nmdc:mga03683_421781_c1 nmdc:mga03683_421781_c1_145_510 120
208 3300050490 nmdc:mga03n38_160189_c1 nmdc:mga03n38_160189_c1_130_495 120
209 3300050490 nmdc:mga03n38_359135_c1 nmdc:mga03n38_359135_c1_39_404 120
210 3300050494 nmdc:mga06z11_360325_c1 nmdc:mga06z11_360325_c1_95_460 120
211 3300053145 Ga0500586_045563 Ga0500586_045563_261_623 120
212 3300053730 Ga0500645_115863 Ga0500645_115863_88_450 120

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02452

PemK_toxin

PemK-like, MazF-like toxin of type II toxin-antitoxin system

20

131

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
5co7-assembly2.cif.gz_D e. coli mazf form iii 0.9336 6 116
5co7-assembly3.cif.gz_F e. coli mazf form iii 0.9243 6 117
5ck9-assembly1.cif.gz_A e. coli mazf form i 0.9142 4 117
5ckh-assembly1.cif.gz_A e. coli mazf e24a form iib 0.9133 6 117
3nfc-assembly4.cif.gz_F crystal structure of e.coli mazf toxin 0.9129 5 117
ID Description Score Start End Superfamily
5cqyB00 Mainly Beta;Roll;SH3 type barrels.; 0.9166 4 119 2.30.30.110
5cqyB00 Mainly Beta;Roll;SH3 type barrels.; 0.8998 4 119 2.30.30.110
1m1fB00 Mainly Beta;Roll;SH3 type barrels.; 0.8283 8 117 2.30.30.110
1m1fB00 Mainly Beta;Roll;SH3 type barrels.; 0.821 8 117 2.30.30.110
af_V5QRX7_1_106_2.30.30.110 Mainly Beta;Roll;SH3 type barrels.; 0.7999 10 118 2.30.30.110
ID Description Score Start End GO Terms
AF-A0A8B6LL02-F1-model_v4 Toxin MazF 0.9803 32 118 GO:0003677
AF-A0A8B6LL02-F1-model_v4 Toxin MazF 0.9693 32 118 GO:0003677
AF-A0A2N2MRZ5-F1-model_v4 mRNA-degrading endonuclease 0.9225 2 116 GO:0003677
GO:0004521
GO:0006402
GO:0016075
AF-A0A2M7MRG9-F1-model_v4 Growth inhibitor PemK 0.8971 2 119 GO:0003677
AF-A0A2D8Q4U3-F1-model_v4 Toxin MazF 0.8959 4 116 GO:0003677
GO:0004521
GO:0006402
GO:0016075

Feature Viewer

pLDDT pTM Quality
87.36 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map