F322875

General Info

Members Datasets Scaffolds Average Seq Length
212 145 424 99

Family's Representative Sequence

Representative Sequence 3300014497|Ga0182008_10131567|Ga0182008_101315671
Length 103
Sequence MCGATVGGLSLDGVNVAKESVIQGVVTRSSDTGQSVPVDNAYVRLLDRTGEFAAEVPTSATGHFRFFAAPGEWTLRTLAPKADPVERRVVAQQGVVAEVSVSI

Samples

Sample ID Description Type Environment
1 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
2 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
3 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
9 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
15 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
18 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
19 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
20 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
21 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
22 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
23 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
24 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
25 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
26 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
27 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
28 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
29 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
30 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
31 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
32 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
33 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
34 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
35 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
36 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
38 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
39 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
40 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
41 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
42 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
43 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
44 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
45 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
46 3300012481 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610 Metagenome Rhizosphere
47 3300012491 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.8.old.040610 Metagenome Rhizosphere
48 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
49 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
50 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
51 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
52 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
53 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
54 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
55 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
56 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
57 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
58 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
59 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
60 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
79 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
80 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
81 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
82 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
83 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
84 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
85 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
86 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
87 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
88 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
89 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
90 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
91 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
92 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
93 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
94 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
95 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
96 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
97 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
98 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
99 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
100 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
101 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
102 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
103 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
104 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
105 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
106 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
107 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
108 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
109 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
110 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
111 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
112 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
113 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
114 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
115 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
116 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
117 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
118 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
119 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
120 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
121 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
122 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
123 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
124 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
125 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
126 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
127 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
128 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
129 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
130 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
131 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
132 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
133 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
134 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
135 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
136 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
137 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
138 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
139 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
140 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
141 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
142 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
143 2643221561 Nocardioides sp. Root151 Isolate Unclassified
144 2643221696 Nocardioides sp. Root140 Isolate Unclassified
145 2837268691 Jiangella endophytica KE2-3 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.92
Metatranscriptomes 5.66
Isolates 1.42

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.08
Nodule 0
Rhizoplane 8.02
Rhizosphere 82.55
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0182008_10131567 3300014497 Bacteria 1247
2 Ga0006759J45824_1056103 3300003163 Bacteria 1217
3 Ga0007409J51694_1043939 3300003575 Bacteria 1282
4 Ga0070683_100337423 3300005329 Bacteria 1435
5 Ga0070683_100498316 3300005329 Bacteria 1163
6 Ga0070682_100171345 3300005337 Bacteria 1509
7 Ga0070682_100456951 3300005337 Bacteria 979
8 Ga0070682_101416350 3300005337 Bacteria 595
9 Ga0068868_100607629 3300005338 Bacteria 969
10 Ga0070689_101665215 3300005340 Bacteria 580
11 Ga0070687_100633511 3300005343 Bacteria 739
12 Ga0070692_10437513 3300005345 Bacteria 834
13 Ga0070692_10641627 3300005345 Bacteria 708
14 Ga0070675_101482559 3300005354 Bacteria 626
15 Ga0070674_100299846 3300005356 Bacteria 1281
16 Ga0070688_100705469 3300005365 Bacteria 782
17 Ga0070659_101071024 3300005366 Bacteria 710
18 Ga0070701_10266872 3300005438 Bacteria 1040
19 Ga0070700_100451113 3300005441 Bacteria 979
20 Ga0070700_101042060 3300005441 Bacteria 675
21 Ga0070678_102363255 3300005456 Bacteria 505
22 Ga0070662_101426110 3300005457 Bacteria 597
23 Ga0070684_100567669 3300005535 Bacteria 1054
24 Ga0070672_100545071 3300005543 Bacteria 1007
25 Ga0070664_100821149 3300005564 Bacteria 870
26 Ga0068856_100867262 3300005614 Bacteria 922
27 Ga0070702_100279914 3300005615 Bacteria 1145
28 Ga0068864_100699957 3300005618 Bacteria 990
29 Ga0068864_101114669 3300005618 Bacteria 786
30 Ga0068866_10967791 3300005718 Bacteria 603
31 Ga0068861_101869283 3300005719 Bacteria 597
32 Ga0068870_10332820 3300005840 Bacteria 969
33 Ga0068870_10558186 3300005840 Bacteria 772
34 Ga0068870_11101845 3300005840 Bacteria 571
35 Ga0081455_10281082 3300005937 Bacteria 1202
36 Ga0081538_10000459 3300005981 Bacteria 45654
37 Ga0075365_10044631 3300006038 Bacteria 2905
38 Ga0075365_10061056 3300006038 Bacteria 2516
39 Ga0075365_10063317 3300006038 Bacteria 2476
40 Ga0075365_10225429 3300006038 Bacteria 1315
41 Ga0075363_100899588 3300006048 Bacteria 542
42 Ga0075364_10058627 3300006051 Bacteria 2523
43 Ga0075434_100782361 3300006871 Bacteria 971
44 Ga0068865_100146809 3300006881 Bacteria 1785
45 Ga0068865_101004121 3300006881 Bacteria 731
46 Ga0075435_100881773 3300007076 Bacteria 780
47 Ga0105244_10247294 3300009036 Bacteria 832
48 Ga0111539_10705822 3300009094 Bacteria 1174
49 Ga0105245_11264231 3300009098 Bacteria 787
50 Ga0105245_12713924 3300009098 Bacteria 548
51 Ga0105243_10203015 3300009148 Bacteria 1740
52 Ga0105243_11119003 3300009148 Bacteria 797
53 Ga0105241_10571897 3300009174 Bacteria 1017
54 Ga0105241_11834527 3300009174 Bacteria 593
55 Ga0105248_12280926 3300009177 Bacteria 616
56 Ga0105237_12317685 3300009545 Bacteria 547
57 Ga0105238_11281181 3300009551 Bacteria 759
58 Ga0105249_10603846 3300009553 Bacteria 1152
59 Ga0105249_12949884 3300009553 Bacteria 546
60 Ga0105239_13644074 3300010375 Bacteria 500
61 Ga0105246_10592054 3300011119 Bacteria 957
62 Ga0157320_1012308 3300012481 Bacteria 687
63 Ga0157329_1024294 3300012491 Bacteria 590
64 Ga0157369_12175272 3300013105 Bacteria 562
65 Ga0157372_10156365 3300013307 Bacteria 2634
66 Ga0157372_11161559 3300013307 Bacteria 893
67 Ga0157372_12164434 3300013307 Bacteria 639
68 Ga0163163_10555435 3300014325 Bacteria 1211
69 Ga0163163_12107177 3300014325 Bacteria 623
70 Ga0157380_10915202 3300014326 Bacteria 904
71 Ga0157380_11148848 3300014326 Bacteria 818
72 Ga0157380_11424131 3300014326 Bacteria 744
73 Ga0182008_10142427 3300014497 Bacteria 1200
74 Ga0157377_10315796 3300014745 Bacteria 1036
75 Ga0157376_12276467 3300014969 Bacteria 581
76 Ga0197907_10062584 3300020069 Bacteria 683
77 Ga0206356_10193135 3300020070 Bacteria 536
78 Ga0206356_10978226 3300020070 Bacteria 500
79 Ga0206349_1746127 3300020075 Bacteria 693
80 Ga0206355_1502234 3300020076 Bacteria 547
81 Ga0206354_10853029 3300020081 Bacteria 670
82 Ga0224712_10087468 3300022467 Bacteria 1299
83 Ga0224712_10227983 3300022467 Bacteria 855
84 Ga0224712_10319423 3300022467 Bacteria 729
85 Ga0207643_10162256 3300025908 Bacteria 1345
86 Ga0207643_10746715 3300025908 Bacteria 633
87 Ga0207705_10020193 3300025909 Bacteria 4766
88 Ga0207662_10685047 3300025918 Bacteria 718
89 Ga0207646_10716701 3300025922 Bacteria 894
90 Ga0207687_10600342 3300025927 Bacteria 928
91 Ga0207690_10324632 3300025932 Bacteria 1211
92 Ga0207706_10864516 3300025933 Bacteria 765
93 Ga0207709_10443904 3300025935 Bacteria 1001
94 Ga0207670_11575645 3300025936 Bacteria 559
95 Ga0207669_11801102 3300025937 Bacteria 523
96 Ga0207704_10541680 3300025938 Bacteria 944
97 Ga0207704_10760376 3300025938 Bacteria 807
98 Ga0207691_10261533 3300025940 Bacteria 1492
99 Ga0207661_10935672 3300025944 Bacteria 798
100 Ga0207640_10396557 3300025981 Bacteria 1123
101 Ga0207677_11805141 3300026023 Bacteria 568
102 Ga0207708_10036936 3300026075 Bacteria 3720
103 Ga0207708_10382092 3300026075 Bacteria 1161
104 Ga0207708_12045629 3300026075 Bacteria 501
105 Ga0207648_10022010 3300026089 Bacteria 5726
106 Ga0207683_10397974 3300026121 Bacteria 1267
107 Ga0207683_11413937 3300026121 Bacteria 643
108 Ga0265318_10254532 3300028577 Bacteria 641
109 Ga0307410_10074886 3300031852 Bacteria 2359
110 Ga0307410_11541772 3300031852 Bacteria 586
111 Ga0307410_11990663 3300031852 Bacteria 518
112 Ga0307410_12109048 3300031852 Bacteria 504
113 Ga0307407_10261957 3300031903 Bacteria 1190
114 Ga0307412_11404543 3300031911 Bacteria 632
115 Ga0307409_101764129 3300031995 Bacteria 648
116 Ga0307409_102177169 3300031995 Bacteria 584
117 Ga0307409_102206411 3300031995 Bacteria 580
118 Ga0307414_12101969 3300032004 Bacteria 527
119 Ga0373960_0190979 3300035121 Bacteria 720
120 Ga0373925_1332144 3300037068 Bacteria 589
121 Ga0395900_0008227 3300037418 Bacteria 10742
122 Ga0395898_0044533 3300037466 Bacteria 4367
123 Ga0395898_1009934 3300037466 Bacteria 767
124 Ga0395901_0042276 3300038443 Bacteria 4725
125 Ga0395901_0049391 3300038443 Bacteria 4371
126 Ga0436365_1469888 3300039437 Bacteria 914
127 Ga0451833_0386958 3300041491 Bacteria 31148
128 Ga0439445_0109437 3300042004 Bacteria 788
129 Ga0466972_0416823 3300044658 Bacteria 630
130 Ga0466961_0710174 3300044693 Bacteria 602
131 Ga0466957_0754909 3300044842 Bacteria 689
132 Ga0466957_0764210 3300044842 Bacteria 685
133 Ga0466960_0064751 3300044901 Bacteria 1803
134 Ga0466960_0274259 3300044901 Bacteria 943
135 Ga0466960_0982352 3300044901 Bacteria 518
136 Ga0466960_0996164 3300044901 Bacteria 515
137 Ga0466967_0070634 3300045976 Bacteria 3124
138 Ga0466967_0760489 3300045976 Bacteria 961
139 Ga0495664_0080739 3300046477 Bacteria 1949
140 Ga0495658_0289324 3300046683 Bacteria 1035
141 Ga0495624_0670761 3300046690 Bacteria 616
142 Ga0495600_0673295 3300046809 Bacteria 624
143 Ga0495674_1280129 3300047319 Bacteria 551
144 Ga0496100_0298270 3300048903 Bacteria 1206
145 Ga0496101_0209657 3300048904 Bacteria 1509
146 Ga0496101_1264305 3300048904 Bacteria 578
147 Ga0496101_1395722 3300048904 Bacteria 546
148 Ga0496102_1299642 3300048905 Bacteria 646
149 Ga0496104_0838328 3300048907 Bacteria 825
150 Ga0496105_0368452 3300048908 Bacteria 1145
151 Ga0496106_0016036 3300048909 Bacteria 5540
152 Ga0496106_1306809 3300048909 Bacteria 563
153 Ga0496108_0154165 3300048911 Bacteria 1983
154 Ga0496108_1489441 3300048911 Bacteria 563
155 Ga0496109_0100480 3300048912 Bacteria 2684
156 Ga0496109_0415204 3300048912 Bacteria 1271
157 Ga0496109_0450155 3300048912 Bacteria 1216
158 Ga0496110_0168037 3300048913 Bacteria 1989
159 Ga0496110_0782353 3300048913 Bacteria 858
160 Ga0496112_0744012 3300048915 Bacteria 907
161 Ga0496124_0121198 3300048927 Bacteria 2090
162 Ga0501310_052831 3300049130 Bacteria 591
163 Ga0501031_0332883 3300049568 Bacteria 983
164 Ga0501032_0372262 3300049569 Bacteria 919
165 Ga0501036_1258730 3300049572 Bacteria 602
166 Ga0501037_0233259 3300049573 Bacteria 1292
167 Ga0501037_0832338 3300049573 Bacteria 608
168 Ga0501038_0279467 3300049574 Bacteria 1315
169 Ga0501038_1068110 3300049574 Bacteria 590
170 Ga0501039_0278217 3300049575 Bacteria 1316
171 Ga0501039_0507775 3300049575 Bacteria 947
172 Ga0501039_1421792 3300049575 Bacteria 534
173 Ga0501040_0411039 3300049576 Bacteria 972
174 Ga0501040_0660280 3300049576 Bacteria 756
175 Ga0501041_0131970 3300049577 Bacteria 1556
176 Ga0501041_0496645 3300049577 Bacteria 776
177 Ga0501042_0355668 3300049578 Bacteria 1060
178 Ga0501042_0522389 3300049578 Bacteria 862
179 Ga0501042_0588863 3300049578 Bacteria 809
180 Ga0501043_0924908 3300049579 Bacteria 624
181 Ga0501068_1027088 3300049584 Bacteria 544
182 Ga0501069_0020934 3300049585 Bacteria 3547
183 Ga0501070_1093748 3300049586 Bacteria 615
184 Ga0501071_0833963 3300049587 Bacteria 711
185 Ga0501071_1467067 3300049587 Bacteria 527
186 Ga0501076_0558864 3300049592 Bacteria 944
187 Ga0501076_1139446 3300049592 Bacteria 642
188 Ga0501079_0813098 3300049741 Bacteria 736
189 Ga0501081_0334557 3300049743 Bacteria 1114
190 Ga0501081_0641134 3300049743 Bacteria 796
191 Ga0501081_1298586 3300049743 Bacteria 552
192 Ga0501044_1574076 3300049823 Bacteria 522
193 Ga0501045_1151722 3300049824 Bacteria 567
194 nmdc:mga00v17_11314_c1 3300050491 Bacteria 4904
195 nmdc:mga0yw44_118851_c1 3300050492 Bacteria 1701
196 nmdc:mga0yw44_23389_c1 3300050492 Bacteria 3481
197 nmdc:mga0yw44_269306_c1 3300050492 Bacteria 1137
198 nmdc:mga0yw44_354074_c1 3300050492 Bacteria 989
199 nmdc:mga0yw44_419_c1 3300050492 Bacteria 14011
200 nmdc:mga0yw44_623289_c1 3300050492 Bacteria 733
201 nmdc:mga05p37_1037594_c1 3300050507 Bacteria 866
202 nmdc:mga0n895_196295_c1 3300050512 Bacteria 2049
203 Ga0495601_0182841 3300053077 Bacteria 1370
204 Ga0495595_0330007 3300053084 Bacteria 769
205 Ga0500568_0002469 3300053139 Bacteria 10866
206 Ga0500620_107205 3300053155 Bacteria 978
207 Ga0501082_0437138 3300060353 Bacteria 1143
208 Ga0501082_0881377 3300060353 Bacteria 783
209 Ga0530510_0137251 3300061734 Bacteria 1801
210 2643824684 2643221561 Bacteria 4984412
211 2644535936 2643221696 Bacteria 5431823
212 2837268832 2837268691 Bacteria 7850704
213 Ga0182008_10131567
214 Ga0006759J45824_1056103
215 Ga0007409J51694_1043939
216 Ga0070683_100337423
217 Ga0070683_100498316
218 Ga0070682_100171345
219 Ga0070682_100456951
220 Ga0070682_101416350
221 Ga0068868_100607629
222 Ga0070689_101665215
223 Ga0070687_100633511
224 Ga0070692_10437513
225 Ga0070692_10641627
226 Ga0070675_101482559
227 Ga0070674_100299846
228 Ga0070688_100705469
229 Ga0070659_101071024
230 Ga0070701_10266872
231 Ga0070700_100451113
232 Ga0070700_101042060
233 Ga0070678_102363255
234 Ga0070662_101426110
235 Ga0070684_100567669
236 Ga0070672_100545071
237 Ga0070664_100821149
238 Ga0068856_100867262
239 Ga0070702_100279914
240 Ga0068864_100699957
241 Ga0068864_101114669
242 Ga0068866_10967791
243 Ga0068861_101869283
244 Ga0068870_10332820
245 Ga0068870_10558186
246 Ga0068870_11101845
247 Ga0081455_10281082
248 Ga0081538_10000459
249 Ga0075365_10044631
250 Ga0075365_10061056
251 Ga0075365_10063317
252 Ga0075365_10225429
253 Ga0075363_100899588
254 Ga0075364_10058627
255 Ga0075434_100782361
256 Ga0068865_100146809
257 Ga0068865_101004121
258 Ga0075435_100881773
259 Ga0105244_10247294
260 Ga0111539_10705822
261 Ga0105245_11264231
262 Ga0105245_12713924
263 Ga0105243_10203015
264 Ga0105243_11119003
265 Ga0105241_10571897
266 Ga0105241_11834527
267 Ga0105248_12280926
268 Ga0105237_12317685
269 Ga0105238_11281181
270 Ga0105249_10603846
271 Ga0105249_12949884
272 Ga0105239_13644074
273 Ga0105246_10592054
274 Ga0157320_1012308
275 Ga0157329_1024294
276 Ga0157369_12175272
277 Ga0157372_10156365
278 Ga0157372_11161559
279 Ga0157372_12164434
280 Ga0163163_10555435
281 Ga0163163_12107177
282 Ga0157380_10915202
283 Ga0157380_11148848
284 Ga0157380_11424131
285 Ga0182008_10142427
286 Ga0157377_10315796
287 Ga0157376_12276467
288 Ga0197907_10062584
289 Ga0206356_10193135
290 Ga0206356_10978226
291 Ga0206349_1746127
292 Ga0206355_1502234
293 Ga0206354_10853029
294 Ga0224712_10087468
295 Ga0224712_10227983
296 Ga0224712_10319423
297 Ga0207643_10162256
298 Ga0207643_10746715
299 Ga0207705_10020193
300 Ga0207662_10685047
301 Ga0207646_10716701
302 Ga0207687_10600342
303 Ga0207690_10324632
304 Ga0207706_10864516
305 Ga0207709_10443904
306 Ga0207670_11575645
307 Ga0207669_11801102
308 Ga0207704_10541680
309 Ga0207704_10760376
310 Ga0207691_10261533
311 Ga0207661_10935672
312 Ga0207640_10396557
313 Ga0207677_11805141
314 Ga0207708_10036936
315 Ga0207708_10382092
316 Ga0207708_12045629
317 Ga0207648_10022010
318 Ga0207683_10397974
319 Ga0207683_11413937
320 Ga0265318_10254532
321 Ga0307410_10074886
322 Ga0307410_11541772
323 Ga0307410_11990663
324 Ga0307410_12109048
325 Ga0307407_10261957
326 Ga0307412_11404543
327 Ga0307409_101764129
328 Ga0307409_102177169
329 Ga0307409_102206411
330 Ga0307414_12101969
331 Ga0373960_0190979
332 Ga0373925_1332144
333 Ga0395900_0008227
334 Ga0395898_0044533
335 Ga0395898_1009934
336 Ga0395901_0042276
337 Ga0395901_0049391
338 Ga0436365_1469888
339 Ga0451833_0386958
340 Ga0439445_0109437
341 Ga0466972_0416823
342 Ga0466961_0710174
343 Ga0466957_0754909
344 Ga0466957_0764210
345 Ga0466960_0064751
346 Ga0466960_0274259
347 Ga0466960_0982352
348 Ga0466960_0996164
349 Ga0466967_0070634
350 Ga0466967_0760489
351 Ga0495664_0080739
352 Ga0495658_0289324
353 Ga0495624_0670761
354 Ga0495600_0673295
355 Ga0495674_1280129
356 Ga0496100_0298270
357 Ga0496101_0209657
358 Ga0496101_1264305
359 Ga0496101_1395722
360 Ga0496102_1299642
361 Ga0496104_0838328
362 Ga0496105_0368452
363 Ga0496106_0016036
364 Ga0496106_1306809
365 Ga0496108_0154165
366 Ga0496108_1489441
367 Ga0496109_0100480
368 Ga0496109_0415204
369 Ga0496109_0450155
370 Ga0496110_0168037
371 Ga0496110_0782353
372 Ga0496112_0744012
373 Ga0496124_0121198
374 Ga0501310_052831
375 Ga0501031_0332883
376 Ga0501032_0372262
377 Ga0501036_1258730
378 Ga0501037_0233259
379 Ga0501037_0832338
380 Ga0501038_0279467
381 Ga0501038_1068110
382 Ga0501039_0278217
383 Ga0501039_0507775
384 Ga0501039_1421792
385 Ga0501040_0411039
386 Ga0501040_0660280
387 Ga0501041_0131970
388 Ga0501041_0496645
389 Ga0501042_0355668
390 Ga0501042_0522389
391 Ga0501042_0588863
392 Ga0501043_0924908
393 Ga0501068_1027088
394 Ga0501069_0020934
395 Ga0501070_1093748
396 Ga0501071_0833963
397 Ga0501071_1467067
398 Ga0501076_0558864
399 Ga0501076_1139446
400 Ga0501079_0813098
401 Ga0501081_0334557
402 Ga0501081_0641134
403 Ga0501081_1298586
404 Ga0501044_1574076
405 Ga0501045_1151722
406 nmdc:mga00v17_11314_c1
407 nmdc:mga0yw44_118851_c1
408 nmdc:mga0yw44_23389_c1
409 nmdc:mga0yw44_269306_c1
410 nmdc:mga0yw44_354074_c1
411 nmdc:mga0yw44_419_c1
412 nmdc:mga0yw44_623289_c1
413 nmdc:mga05p37_1037594_c1
414 nmdc:mga0n895_196295_c1
415 Ga0495601_0182841
416 Ga0495595_0330007
417 Ga0500568_0002469
418 Ga0500620_107205
419 Ga0501082_0437138
420 Ga0501082_0881377
421 Ga0530510_0137251
422 2643824684
423 2644535936
424 2837268832

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07210

DUF1416

Protein of unknown function (DUF1416)

2

103

0.93

PF13620

CarboxypepD_reg

Carboxypeptidase regulatory-like domain

21

103

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
2nsm-assembly1.cif.gz_A crystal structure of the human carboxypeptidase n (kininase i) catalytic domain 0.9086 22 97
8bdw-assembly1.cif.gz_H-2 crystal structure of cnab2 domain from lactobacillus plantarum 0.8875 18 97
1qmu-assembly1.cif.gz_A duck carboxypeptidase d domain ii 0.8817 22 97
4p0d-assembly1.cif.gz_A the t6 backbone pilin of serotype m6 streptococcus pyogenes has a modular three-domain structure decorated with variable loops and extensions 0.8783 19 86
6fwv-assembly2.cif.gz_B the bacillus anthracis tie protein 0.8689 18 97
ID Description Score Start End Superfamily
af_P0CG96_23_100_2.60.40.1120 Mainly Beta;Sandwich;Immunoglobulin-like;Carboxypeptidase-like, regulatory domain 0.9321 23 98 2.60.40.1120
af_Q9JHW1_1212_1304_2.60.40.1120 Mainly Beta;Sandwich;Immunoglobulin-like;Carboxypeptidase-like, regulatory domain 0.9294 22 97 2.60.40.1120
af_O17754_362_461_2.60.40.1120 Mainly Beta;Sandwich;Immunoglobulin-like;Carboxypeptidase-like, regulatory domain 0.9273 22 97 2.60.40.1120
af_B7Z0Z5_381_464_2.60.40.1120 Mainly Beta;Sandwich;Immunoglobulin-like;Carboxypeptidase-like, regulatory domain 0.9171 22 97 2.60.40.1120
af_P91359_377_465_2.60.40.1120 Mainly Beta;Sandwich;Immunoglobulin-like;Carboxypeptidase-like, regulatory domain 0.9066 22 97 2.60.40.1120
ID Description Score Start End GO Terms
AF-A0A358SMB6-F1-model_v4 DUF1416 domain-containing protein 0.9727 18 98 GO:0030246
AF-E3J5V1-F1-model_v4 DUF1416 domain-containing protein 0.9684 17 97
AF-A0A7K2NCG2-F1-model_v4 DUF1416 domain-containing protein 0.9635 23 98 GO:0006749
GO:0050313
GO:0070813
AF-A0A1Q7X2D1-F1-model_v4 Carboxypeptidase regulatory-like domain-containing protein 0.963 24 97
AF-A0A644XGC9-F1-model_v4 Uncharacterized protein 0.9608 20 97 GO:0030246

Map