F322307

General Info

Members Datasets Scaffolds Average Seq Length
212 150 424 177

Family's Representative Sequence

Representative Sequence 3300003203|JGI25406J46586_10019260|JGI25406J46586_100192604
Length 184
Sequence MSFARVRALVVVGVLAVAAIVFVVVALVRDTQGGVSADDGCPDGAPLAVVSLPDDPDQVKIKILNGTSTAGLAEKVTTDFKNRGFVMQKPGQSKTKFDRIAIITYGPKAVGDAQLIXAYFLGKAKPHYVAKRTSDVVDIVIGAEYQQLATSTEVNQSLVELGEPELPPGACAAPADNAAKEQEQ

Samples

Sample ID Description Type Environment
1 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
14 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
15 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
16 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
17 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
18 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
19 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
20 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
21 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
22 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
23 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
24 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
25 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
26 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
27 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
28 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
29 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
30 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
31 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
32 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
33 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
34 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
35 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
36 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
38 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
39 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
41 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
42 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
43 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
44 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
45 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
46 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
47 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
48 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
70 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
71 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
72 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
73 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
74 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
75 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
76 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
77 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
78 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
79 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
80 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
81 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
82 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
83 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
84 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
85 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
86 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
87 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
88 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
89 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
90 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
91 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
92 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
93 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
94 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
95 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
96 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
97 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
98 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
99 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
100 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
101 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
102 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
103 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
104 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
105 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
106 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
107 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
108 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
109 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
110 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
111 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
112 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
113 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
114 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
115 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
116 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
117 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
118 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
119 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
120 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
121 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
122 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
123 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
124 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
125 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
126 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
127 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
128 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
129 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
130 2501939600 Micromonospora sp. L5 Isolate Unclassified
131 2515154088 Salinispora arenicola CNT800 Isolate Rhizosphere
132 2515154129 Salinispora pacifica CNS103 Isolate Rhizosphere
133 2515154137 Salinispora arenicola CNX482 Isolate Rhizosphere
134 2515154202 Salinispora pacifica CNT084 Isolate Rhizosphere
135 2515154203 Salinispora arenicola CNR921 Isolate Rhizosphere
136 2622736626 Micromonospora rhizosphaerae DSM 45431 Isolate Rhizosphere
137 2675903059 Asanoa hainanensis CGMCC 4.5593 Isolate Rhizosphere
138 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
139 2831935698 Jishengella sp. AZ1-13 Isolate Unclassified
140 2832004796 Micromonospora endophytica JCM 18317 Isolate Unclassified
141 2855683550 Micromonospora sp. RP3T Isolate Unclassified
142 2856858025 Micromonospora aurantiaca 110B(2018) Isolate Unclassified
143 2858868258 Micromonospora sp. MH33 Isolate Unclassified
144 2858902515 Micromonospora sp. MW-13 Isolate Rhizosphere
145 2866065130 Micromonospora endophytica DSM 45430 Isolate Unclassified
146 2867302475 Micromonospora globbae WPS1-2 Isolate Unclassified
147 2929219909 Micromonospora sp. R-75348 Hybrid assembly Isolate Unclassified
148 2996221748 Micromonospora veneta CAP181 Isolate Unclassified
149 649633069 Micromonospora sp. L5 Isolate Unclassified
150 8055412473 Micromonospora phytophila DSM 105363 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 90.09
Metatranscriptomes 0
Isolates 9.91

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.6
Nodule 0.47
Rhizoplane 5.66
Rhizosphere 71.23
Stem 0
Stem Tuber 0
Unclassified 0.94

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10019260 3300003203 Bacteria 2786
2 JGI25406J46586_10024010 3300003203 Bacteria 2398
3 rootH2_10076430 3300003320 Bacteria 1282
4 rootL2_10063593 3300003322 Bacteria 1346
5 rootL2_10063594 3300003322 Bacteria 1200
6 rootH1_10076626 3300003323 Bacteria 1229
7 Ga0070683_100143127 3300005329 Bacteria 2265
8 Ga0070690_100621866 3300005330 Bacteria 822
9 Ga0070670_101013511 3300005331 Bacteria 755
10 Ga0070680_101009016 3300005336 Bacteria 719
11 Ga0070661_100267159 3300005344 Bacteria 1324
12 Ga0070692_10918973 3300005345 Bacteria 606
13 Ga0070668_100019907 3300005347 Bacteria 5057
14 Ga0070668_100021321 3300005347 Bacteria 4897
15 Ga0070667_100152035 3300005367 Bacteria 2034
16 Ga0070709_10032974 3300005434 Bacteria 3128
17 Ga0070663_100487053 3300005455 Bacteria 1022
18 Ga0070678_101476598 3300005456 Unclassified 636
19 Ga0070706_100245941 3300005467 Bacteria 1670
20 Ga0070684_100276904 3300005535 Bacteria 1537
21 Ga0070684_100290665 3300005535 Bacteria 1498
22 Ga0070684_100702073 3300005535 Bacteria 943
23 Ga0070664_101086577 3300005564 Bacteria 753
24 Ga0068857_100222381 3300005577 Bacteria 1725
25 Ga0068857_100277481 3300005577 Bacteria 1541
26 Ga0068857_100296878 3300005577 Bacteria 1489
27 Ga0068859_100260081 3300005617 Bacteria 1827
28 Ga0068864_100013913 3300005618 Bacteria 6668
29 Ga0068864_100041880 3300005618 Bacteria 3917
30 Ga0068861_100498212 3300005719 Bacteria 1101
31 Ga0068851_10357674 3300005834 Bacteria 851
32 Ga0068851_10486873 3300005834 Bacteria 738
33 Ga0068863_100089318 3300005841 Bacteria 2922
34 Ga0068858_100057029 3300005842 Bacteria 3609
35 Ga0068858_100169415 3300005842 Bacteria 2059
36 Ga0068858_100354104 3300005842 Bacteria 1406
37 Ga0068860_100080817 3300005843 Bacteria 3091
38 Ga0068862_100044834 3300005844 Bacteria 3772
39 Ga0068862_100068440 3300005844 Bacteria 3063
40 Ga0081540_1015943 3300005983 Bacteria 4734
41 Ga0081539_10000536 3300005985 Bacteria 78807
42 Ga0081539_10019800 3300005985 Bacteria 4586
43 Ga0070712_100608395 3300006175 Bacteria 925
44 Ga0075370_10533512 3300006353 Bacteria 709
45 Ga0075428_100024973 3300006844 Bacteria 6611
46 Ga0075428_100044493 3300006844 Bacteria 4879
47 Ga0075428_100087443 3300006844 Bacteria 3400
48 Ga0075431_100096733 3300006847 Bacteria 3048
49 Ga0075429_100074037 3300006880 Bacteria 2966
50 Ga0068865_100824486 3300006881 Bacteria 802
51 Ga0097620_100260076 3300006931 Bacteria 1827
52 Ga0105245_10690278 3300009098 Bacteria 1053
53 Ga0105247_10257010 3300009101 Bacteria 1196
54 Ga0114129_10304121 3300009147 Bacteria 2124
55 Ga0114129_10329209 3300009147 Bacteria 2029
56 Ga0114129_11355945 3300009147 Bacteria 879
57 Ga0105248_10019005 3300009177 Bacteria 7597
58 Ga0105237_10951150 3300009545 Bacteria 866
59 Ga0105237_11103935 3300009545 Bacteria 800
60 Ga0105239_10422730 3300010375 Bacteria 1510
61 Ga0157378_10230486 3300013297 Bacteria 1765
62 Ga0163163_10012881 3300014325 Bacteria 7636
63 Ga0163163_10213045 3300014325 Bacteria 1981
64 Ga0163163_10305050 3300014325 Bacteria 1645
65 Ga0163163_11020769 3300014325 Bacteria 890
66 Ga0182008_10438520 3300014497 Bacteria 708
67 Ga0157379_10251226 3300014968 Bacteria 1605
68 Ga0157379_10858227 3300014968 Bacteria 859
69 Ga0157376_10210885 3300014969 Bacteria 1793
70 Ga0207684_10661008 3300025910 Bacteria 890
71 Ga0207693_10187807 3300025915 Bacteria 1626
72 Ga0207652_10091809 3300025921 Bacteria 2670
73 Ga0207687_10620495 3300025927 Bacteria 913
74 Ga0207670_10276479 3300025936 Bacteria 1307
75 Ga0207704_10870102 3300025938 Bacteria 756
76 Ga0207691_10424560 3300025940 Bacteria 1133
77 Ga0207711_10149144 3300025941 Bacteria 2109
78 Ga0207679_10122087 3300025945 Bacteria 2076
79 Ga0207679_10272127 3300025945 Bacteria 1449
80 Ga0207712_10373028 3300025961 Bacteria 1192
81 Ga0207668_10002512 3300025972 Bacteria 10713
82 Ga0207668_10059085 3300025972 Bacteria 2684
83 Ga0207677_10118301 3300026023 Bacteria 1988
84 Ga0207703_10085306 3300026035 Bacteria 2642
85 Ga0207703_10209635 3300026035 Bacteria 1737
86 Ga0207678_10024977 3300026067 Bacteria 5218
87 Ga0207678_10143004 3300026067 Bacteria 2042
88 Ga0207641_10026524 3300026088 Bacteria 4783
89 Ga0207676_10059937 3300026095 Bacteria 3007
90 Ga0207676_10162011 3300026095 Bacteria 1939
91 Ga0207674_10115668 3300026116 Bacteria 2654
92 Ga0207674_10149660 3300026116 Bacteria 2291
93 Ga0207674_10809524 3300026116 Bacteria 904
94 Ga0207674_11676822 3300026116 Bacteria 604
95 Ga0207675_100256806 3300026118 Bacteria 1693
96 Ga0268266_11286215 3300028379 Bacteria 707
97 Ga0268265_10837654 3300028380 Bacteria 899
98 Ga0268264_10123224 3300028381 Bacteria 2287
99 Ga0307515_10020095 3300028794 Bacteria 11954
100 Ga0307515_10072065 3300028794 Bacteria 4671
101 Ga0307512_10003152 3300030522 Bacteria 19595
102 Ga0307512_10075785 3300030522 Bacteria 2458
103 Ga0307512_10094518 3300030522 Bacteria 2062
104 Ga0307513_10079219 3300031456 Bacteria 3395
105 Ga0307509_10013619 3300031507 Bacteria 9612
106 Ga0307509_10065648 3300031507 Bacteria 3810
107 Ga0307509_10345065 3300031507 Bacteria 1215
108 Ga0307408_100404970 3300031548 Bacteria 1172
109 Ga0307408_100578590 3300031548 Bacteria 995
110 Ga0307508_10010412 3300031616 Bacteria 8510
111 Ga0307508_10012015 3300031616 Bacteria 7923
112 Ga0307508_10085984 3300031616 Bacteria 2728
113 Ga0307508_10175197 3300031616 Bacteria 1748
114 Ga0307516_10005626 3300031730 Bacteria 14910
115 Ga0307516_10016903 3300031730 Bacteria 7614
116 Ga0307516_10042798 3300031730 Bacteria 4490
117 Ga0307516_10161161 3300031730 Bacteria 1993
118 Ga0307405_10079820 3300031731 Bacteria 2134
119 Ga0307405_10169894 3300031731 Bacteria 1554
120 Ga0307405_10351712 3300031731 Bacteria 1137
121 Ga0307413_10107490 3300031824 Bacteria 1859
122 Ga0307413_10167314 3300031824 Bacteria 1552
123 Ga0326468_10000065 3300031889 Bacteria 8625
124 Ga0307406_10012366 3300031901 Bacteria 4868
125 Ga0307406_10214663 3300031901 Bacteria 1426
126 Ga0307406_10352170 3300031901 Bacteria 1151
127 Ga0307406_10443158 3300031901 Bacteria 1040
128 Ga0307407_10040043 3300031903 Bacteria 2610
129 Ga0307412_10086622 3300031911 Bacteria 2180
130 Ga0307409_100048243 3300031995 Bacteria 3238
131 Ga0307409_100052641 3300031995 Bacteria 3123
132 Ga0307409_100264061 3300031995 Bacteria 1582
133 Ga0307409_100917319 3300031995 Bacteria 890
134 Ga0307416_100005043 3300032002 Bacteria 8047
135 Ga0307416_100377858 3300032002 Bacteria 1446
136 Ga0307416_100819650 3300032002 Bacteria 1027
137 Ga0307414_10099853 3300032004 Bacteria 2182
138 Ga0307411_10060619 3300032005 Bacteria 2514
139 Ga0307411_10109775 3300032005 Bacteria 1971
140 Ga0307415_100033950 3300032126 Bacteria 3316
141 Ga0307415_100034927 3300032126 Bacteria 3279
142 Ga0307415_100075199 3300032126 Bacteria 2390
143 Ga0307415_100260518 3300032126 Bacteria 1415
144 Ga0307415_100411928 3300032126 Bacteria 1157
145 Ga0307510_10070060 3300033180 Bacteria 3506
146 Ga0373938_0011393 3300034957 Bacteria 1653
147 Ga0373940_0001088 3300035088 Bacteria 4717
148 Ga0373942_0000145 3300035207 Bacteria 16942
149 Ga0373962_0009828 3300035242 Bacteria 2376
150 Ga0373935_0032123 3300035692 Bacteria 3261
151 Ga0373933_0262773 3300035724 Bacteria 1113
152 Ga0373937_0154445 3300036401 Bacteria 2151
153 Ga0395899_0076460 3300037312 Bacteria 2444
154 Ga0395900_0010187 3300037418 Bacteria 9616
155 Ga0395898_0030787 3300037466 Bacteria 5368
156 Ga0395905_0004281 3300037471 Bacteria 14882
157 Ga0395901_0320937 3300038443 Bacteria 1602
158 Ga0439459_0009023 3300042438 Bacteria 1718
159 Ga0466957_0801711 3300044842 Bacteria 669
160 Ga0495629_0034970 3300046459 Bacteria 3552
161 Ga0495638_0068495 3300046460 Bacteria 2176
162 Ga0496101_0342172 3300048904 Bacteria 1175
163 Ga0496104_0217288 3300048907 Bacteria 1823
164 Ga0496105_0008869 3300048908 Bacteria 7836
165 Ga0496107_0564281 3300048910 Bacteria 843
166 Ga0496108_0000198 3300048911 Bacteria 55637
167 Ga0496108_0066502 3300048911 Bacteria 3039
168 Ga0496109_0022488 3300048912 Bacteria 5586
169 Ga0496110_0014495 3300048913 Bacteria 6549
170 Ga0496111_0027188 3300048914 Bacteria 4045
171 Ga0496112_0052588 3300048915 Bacteria 3997
172 Ga0496113_0008433 3300048916 Bacteria 6714
173 Ga0496115_0149236 3300048918 Bacteria 1930
174 Ga0496124_0337011 3300048927 Bacteria 1073
175 Ga0501081_0147844 3300049743 Bacteria 1687
176 nmdc:mga09592_38061_c1 3300050508 Bacteria 4036
177 nmdc:mga06r32_88237_c1 3300050510 Bacteria 3027
178 Ga0495619_0012624 3300053085 Bacteria 5317
179 Ga0500644_0011358 3300053088 Bacteria 2433
180 Ga0500646_0001684 3300053090 Bacteria 5845
181 Ga0500646_0044781 3300053090 Bacteria 1257
182 Ga0500646_0223177 3300053090 Unclassified 654
183 Ga0500583_0007871 3300053092 Bacteria 3784
184 Ga0500583_0254812 3300053092 Bacteria 866
185 Ga0500651_0058348 3300053093 Bacteria 2414
186 Ga0500641_0025444 3300053096 Bacteria 2290
187 Ga0500650_0015109 3300053098 Bacteria 3282
188 Ga0500559_0141006 3300053136 Bacteria 1129
189 Ga0500588_0000810 3300053146 Bacteria 5417
190 Ga0500604_0072132 3300053151 Bacteria 1103
191 Ga0500630_086878 3300053159 Bacteria 1452
192 2501940805 2501939600 Bacteria 6907073
193 2515494201 2515154088 Bacteria 5526283
194 2515722504 2515154129 Bacteria 5584369
195 2515758610 2515154137 Bacteria 5711575
196 2516085642 2515154202 Bacteria 5471270
197 2516090551 2515154203 Bacteria 5458536
198 2623587390 2622736626 Bacteria 7181580
199 2676482029 2675903059 Bacteria 8644972
200 2753262531 2751185782 Bacteria 11227053
201 2831938069 2831935698 Bacteria 5963223
202 2832007675 2832004796 Bacteria 6538017
203 2855686064 2855683550 Bacteria 7134265
204 2856861258 2856858025 Bacteria 7255264
205 2858869313 2858868258 Bacteria 7683772
206 2858903962 2858902515 Bacteria 7086037
207 2866070113 2866065130 Bacteria 6518152
208 2867308483 2867302475 Bacteria 7087181
209 2929221435 2929219909 Bacteria 6984360
210 2996226778 2996221748 Bacteria 6799777
211 649812013 649633069 Bacteria 6962533
212 8055413295 8055412473 Bacteria 6257500
213 JGI25406J46586_10019260
214 JGI25406J46586_10024010
215 rootH2_10076430
216 rootL2_10063593
217 rootL2_10063594
218 rootH1_10076626
219 Ga0070683_100143127
220 Ga0070690_100621866
221 Ga0070670_101013511
222 Ga0070680_101009016
223 Ga0070661_100267159
224 Ga0070692_10918973
225 Ga0070668_100019907
226 Ga0070668_100021321
227 Ga0070667_100152035
228 Ga0070709_10032974
229 Ga0070663_100487053
230 Ga0070678_101476598
231 Ga0070706_100245941
232 Ga0070684_100276904
233 Ga0070684_100290665
234 Ga0070684_100702073
235 Ga0070664_101086577
236 Ga0068857_100222381
237 Ga0068857_100277481
238 Ga0068857_100296878
239 Ga0068859_100260081
240 Ga0068864_100013913
241 Ga0068864_100041880
242 Ga0068861_100498212
243 Ga0068851_10357674
244 Ga0068851_10486873
245 Ga0068863_100089318
246 Ga0068858_100057029
247 Ga0068858_100169415
248 Ga0068858_100354104
249 Ga0068860_100080817
250 Ga0068862_100044834
251 Ga0068862_100068440
252 Ga0081540_1015943
253 Ga0081539_10000536
254 Ga0081539_10019800
255 Ga0070712_100608395
256 Ga0075370_10533512
257 Ga0075428_100024973
258 Ga0075428_100044493
259 Ga0075428_100087443
260 Ga0075431_100096733
261 Ga0075429_100074037
262 Ga0068865_100824486
263 Ga0097620_100260076
264 Ga0105245_10690278
265 Ga0105247_10257010
266 Ga0114129_10304121
267 Ga0114129_10329209
268 Ga0114129_11355945
269 Ga0105248_10019005
270 Ga0105237_10951150
271 Ga0105237_11103935
272 Ga0105239_10422730
273 Ga0157378_10230486
274 Ga0163163_10012881
275 Ga0163163_10213045
276 Ga0163163_10305050
277 Ga0163163_11020769
278 Ga0182008_10438520
279 Ga0157379_10251226
280 Ga0157379_10858227
281 Ga0157376_10210885
282 Ga0207684_10661008
283 Ga0207693_10187807
284 Ga0207652_10091809
285 Ga0207687_10620495
286 Ga0207670_10276479
287 Ga0207704_10870102
288 Ga0207691_10424560
289 Ga0207711_10149144
290 Ga0207679_10122087
291 Ga0207679_10272127
292 Ga0207712_10373028
293 Ga0207668_10002512
294 Ga0207668_10059085
295 Ga0207677_10118301
296 Ga0207703_10085306
297 Ga0207703_10209635
298 Ga0207678_10024977
299 Ga0207678_10143004
300 Ga0207641_10026524
301 Ga0207676_10059937
302 Ga0207676_10162011
303 Ga0207674_10115668
304 Ga0207674_10149660
305 Ga0207674_10809524
306 Ga0207674_11676822
307 Ga0207675_100256806
308 Ga0268266_11286215
309 Ga0268265_10837654
310 Ga0268264_10123224
311 Ga0307515_10020095
312 Ga0307515_10072065
313 Ga0307512_10003152
314 Ga0307512_10075785
315 Ga0307512_10094518
316 Ga0307513_10079219
317 Ga0307509_10013619
318 Ga0307509_10065648
319 Ga0307509_10345065
320 Ga0307408_100404970
321 Ga0307408_100578590
322 Ga0307508_10010412
323 Ga0307508_10012015
324 Ga0307508_10085984
325 Ga0307508_10175197
326 Ga0307516_10005626
327 Ga0307516_10016903
328 Ga0307516_10042798
329 Ga0307516_10161161
330 Ga0307405_10079820
331 Ga0307405_10169894
332 Ga0307405_10351712
333 Ga0307413_10107490
334 Ga0307413_10167314
335 Ga0326468_10000065
336 Ga0307406_10012366
337 Ga0307406_10214663
338 Ga0307406_10352170
339 Ga0307406_10443158
340 Ga0307407_10040043
341 Ga0307412_10086622
342 Ga0307409_100048243
343 Ga0307409_100052641
344 Ga0307409_100264061
345 Ga0307409_100917319
346 Ga0307416_100005043
347 Ga0307416_100377858
348 Ga0307416_100819650
349 Ga0307414_10099853
350 Ga0307411_10060619
351 Ga0307411_10109775
352 Ga0307415_100033950
353 Ga0307415_100034927
354 Ga0307415_100075199
355 Ga0307415_100260518
356 Ga0307415_100411928
357 Ga0307510_10070060
358 Ga0373938_0011393
359 Ga0373940_0001088
360 Ga0373942_0000145
361 Ga0373962_0009828
362 Ga0373935_0032123
363 Ga0373933_0262773
364 Ga0373937_0154445
365 Ga0395899_0076460
366 Ga0395900_0010187
367 Ga0395898_0030787
368 Ga0395905_0004281
369 Ga0395901_0320937
370 Ga0439459_0009023
371 Ga0466957_0801711
372 Ga0495629_0034970
373 Ga0495638_0068495
374 Ga0496101_0342172
375 Ga0496104_0217288
376 Ga0496105_0008869
377 Ga0496107_0564281
378 Ga0496108_0000198
379 Ga0496108_0066502
380 Ga0496109_0022488
381 Ga0496110_0014495
382 Ga0496111_0027188
383 Ga0496112_0052588
384 Ga0496113_0008433
385 Ga0496115_0149236
386 Ga0496124_0337011
387 Ga0501081_0147844
388 nmdc:mga09592_38061_c1
389 nmdc:mga06r32_88237_c1
390 Ga0495619_0012624
391 Ga0500644_0011358
392 Ga0500646_0001684
393 Ga0500646_0044781
394 Ga0500646_0223177
395 Ga0500583_0007871
396 Ga0500583_0254812
397 Ga0500651_0058348
398 Ga0500641_0025444
399 Ga0500650_0015109
400 Ga0500559_0141006
401 Ga0500588_0000810
402 Ga0500604_0072132
403 Ga0500630_086878
404 2501940805
405 2515494201
406 2515722504
407 2515758610
408 2516085642
409 2516090551
410 2623587390
411 2676482029
412 2753262531
413 2831938069
414 2832007675
415 2855686064
416 2856861258
417 2858869313
418 2858903962
419 2866070113
420 2867308483
421 2929221435
422 2996226778
423 649812013
424 8055413295

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13399

LytR_C

LytR cell envelope-related transcriptional attenuator

58

145

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
6q10-assembly1.cif.gz_A crystal structure of the soluble domain (residues 71-217) of a conserved hypothetical secreted protein (rv2700 ortholog) from mycobacterium marinum 0.7908 49 164
4bmd-assembly1.cif.gz_A crystal structure of s.pombe rad4 brct3,4 0.7459 59 89
4fq5-assembly1.cif.gz_B crystal structure of the maleate isomerase iso(c200a) from pseudomonas putida s16 with maleate 0.7161 60 92
4ix1-assembly4.cif.gz_H crystal structure of hypothetical protein opag_01669 from rhodococcus opacus pd630, target 016205 0.7102 59 93
4q3e-assembly1.cif.gz_A pyld cocrystallized with l-ornithine-nd-d-lysine and nad+ 0.7099 59 97
ID Description Score Start End Superfamily
af_I6WZI4_556_638_3.30.70.2390 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9217 59 141 3.30.70.2390
af_I6Y1I5_90_179_3.30.70.2390 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8976 59 141 3.30.70.2390
af_I6WZI4_556_638_3.30.70.2390 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8903 59 141 3.30.70.2390
af_I6Y1I5_90_179_3.30.70.2390 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8232 59 141 3.30.70.2390
af_Q7EYV7_381_476_3.40.50.10190 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;BRCT domain 0.8186 54 88 3.40.50.10190
ID Description Score Start End GO Terms
AF-K6V8K4-F1-model_v4 LytR/CpsA/Psr regulator C-terminal domain-containing protein 0.923 56 152 GO:0016020
AF-A0A3A1X2S4-F1-model_v4 LytR/CpsA/Psr regulator C-terminal domain-containing protein 0.922 59 153
AF-M9YXV0-F1-model_v4 Putative transcriptional regulator 0.9032 53 148 GO:0016020
AF-A0A560WDQ7-F1-model_v4 LytR cell envelope-related transcriptional attenuator 0.8975 51 152 GO:0016020
AF-A0A4Y8YE16-F1-model_v4 LytR family transcriptional regulator 0.8953 53 148 GO:0016020

Map