F321892

General Info

Members Datasets Scaffolds Average Seq Length
211 148 189 336

Family's Representative Sequence

Representative Sequence 3300042876|Ga0451577_0000156|Ga0451577_0000156_68729_69736
Length 335
Sequence MIETDIIIVGAGPCGLFTVFEAGLLKLRCHLIDALPQAGGQLTEIYPKKPIYDIPGFPEVLAGDLIHHLMKQAEPFKPGFTLGERCESFEKTDDGKFIVRTSKGTLHKAPVIAIAGGLGCFEPRKPPIGNIADFEDKGIEYIVRDPNFYKGKKVVISGGGDSALDWSIFLANGVASDVTLIHRSKSFRGHPDSVQKVLDMSASGKITLMTDAEVIGVSGNGVLKSVSVDRQSEGLQELNTDHWLPLFGLSPKLGPLADWGLNIDKNSIEVNTFDYSTNIPGIYAIGDINTYPGKLKLILCGFHEATLMVQSAFKRIYPDKNYVLKYTTVNGVTGF

Samples

Sample ID Description Type Environment
1 2522125168 Dyadobacter beijingensis DSM 21582 Isolate Rhizosphere
2 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
3 2721755487 Sphingobacterium sp. B29 Isolate Rhizosphere
4 2818991444 Filimonas endophytica 3197 Isolate Unclassified
5 2839989709 Pontibacter arcticus 2b14 Isolate Unclassified
6 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
7 2884634485 Algoriphagus kandeliae XY-J91 Isolate Unclassified
8 2890737413 Parapedobacter sp. SGR-10 Isolate Rhizosphere
9 2896317667 Sphingobacterium sp. SGR-19 Isolate Rhizosphere
10 2898713307 Sphingobacterium sp. SGG-5 Isolate Rhizosphere
11 2904780799 Sphingobacterium sp. 1304 Isolate Rhizosphere
12 2910245624 Adhaeribacter radiodurans KUDC8001 Isolate Rhizosphere
13 2911138879 Spirosoma sp. KUDC1026 Isolate Rhizosphere
14 2919177583 Sphingobacterium sp. 2149 Isolate Rhizosphere
15 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
16 2919692658 Algoriphagus sp. 4150 Isolate Rhizosphere
17 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
18 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
19 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified
20 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
21 3003233435 Sphingobacterium shayense CrR18 Isolate Unclassified
22 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
23 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
24 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
25 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
26 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
27 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
28 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
29 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
30 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
31 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
32 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
33 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
42 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
43 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
44 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
46 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
47 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
48 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
49 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
50 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
51 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
52 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
53 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
54 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
55 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
56 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
57 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
58 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
59 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
60 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
61 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
62 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
80 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
82 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
83 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
84 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
85 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
86 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
87 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
88 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
89 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
90 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
91 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
92 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
93 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
94 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
95 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
96 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
97 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
98 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
99 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
100 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
101 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
102 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
103 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
104 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
105 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
106 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
107 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
108 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
109 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
110 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
111 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
112 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
113 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
114 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
115 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
116 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
117 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
118 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
119 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
120 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
121 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
122 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
123 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
124 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
125 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
126 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
127 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
128 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
129 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
130 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
131 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
132 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
133 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
134 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
135 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
136 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
137 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
138 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
139 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
140 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
141 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
142 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
143 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
144 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
145 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
146 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
147 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
148 8055588893 Parapedobacter lycopersici KACC 18788 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 88.63
Metatranscriptomes 0.95
Isolates 10.43

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.11
Nodule 0
Rhizoplane 0.95
Rhizosphere 76.78
Stem 0
Stem Tuber 0
Unclassified 15.17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24737J22298_10001717 3300001990 Bacteria 7808
2 JGI24735J21928_10000007 3300002067 Bacteria 333510
3 JGI24735J21928_10019927 3300002067 Bacteria 2058
4 JGI25162J39368_1000203 3300002737 Bacteria 62704
5 rootH2_10005336 3300003320 Bacteria 90063
6 rootH2_10169580 3300003320 Bacteria 2248
7 rootL2_10030745 3300003322 Bacteria 3957
8 rootL2_10096443 3300003322 Bacteria 2722
9 rootH1_10004576 3300003323 Bacteria 68064
10 rootH1_10013966 3300003323 Bacteria 1470
11 rootH1_10044982 3300003323 Bacteria 7330
12 rootH1_10162591 3300003323 Bacteria 9010
13 rootH1_10244864 3300003323 Bacteria 1820
14 rootH1_10288806 3300003323 Bacteria 3666
15 Ga0055536_1008793 3300003781 Bacteria 4279
16 Ga0065165_1000266 3300005262 Bacteria 90228
17 Ga0065704_10005268 3300005289 Bacteria 3414
18 Ga0065704_10013286 3300005289 Bacteria 1728
19 Ga0070658_10000049 3300005327 Bacteria 119985
20 Ga0070660_100023582 3300005339 Bacteria 4559
21 Ga0070671_100031152 3300005355 Bacteria 4405
22 Ga0068853_100019207 3300005539 Bacteria 5664
23 Ga0070665_100000032 3300005548 Bacteria 333352
24 Ga0068855_100002305 3300005563 Bacteria 23603
25 Ga0068857_100026081 3300005577 Bacteria 5148
26 Ga0068857_100344998 3300005577 Bacteria 1378
27 Ga0068856_100003417 3300005614 Bacteria 16061
28 Ga0068856_100436735 3300005614 Bacteria 1329
29 Ga0068863_100103734 3300005841 Bacteria 2705
30 Ga0097621_100402182 3300006237 Bacteria 1226
31 Ga0075428_100008074 3300006844 Bacteria 11688
32 Ga0075429_100156380 3300006880 Bacteria 1996
33 Ga0105240_10018900 3300009093 Bacteria 9228
34 Ga0105240_10316166 3300009093 Bacteria 1781
35 Ga0111539_10010577 3300009094 Bacteria 11620
36 Ga0105245_10136414 3300009098 Bacteria 2306
37 Ga0105243_10000141 3300009148 Bacteria 82657
38 Ga0105237_10001669 3300009545 Bacteria 28718
39 Ga0105237_10006377 3300009545 Bacteria 13096
40 Ga0105237_10009412 3300009545 Bacteria 10465
41 Ga0105237_10040439 3300009545 Bacteria 4702
42 Ga0105239_10000009 3300010375 Bacteria 361182
43 Ga0105239_10001867 3300010375 Bacteria 27574
44 Ga0105239_10007160 3300010375 Bacteria 12837
45 Ga0105239_10010995 3300010375 Bacteria 10104
46 Ga0105239_10093479 3300010375 Bacteria 3320
47 Ga0157371_10017418 3300013102 Bacteria 5337
48 Ga0157370_10036736 3300013104 Unclassified 4752
49 Ga0157370_10252472 3300013104 Bacteria 1631
50 Ga0157370_10367352 3300013104 Bacteria 1326
51 Ga0157369_10000533 3300013105 Bacteria 50305
52 Ga0157374_10532635 3300013296 Bacteria 1181
53 Ga0163162_10000010 3300013306 Bacteria 302032
54 Ga0163162_10007152 3300013306 Bacteria 10835
55 Ga0163162_10013585 3300013306 Bacteria 7955
56 Ga0157372_10006692 3300013307 Bacteria 12263
57 Ga0157372_10008881 3300013307 Bacteria 10673
58 Ga0157372_10229904 3300013307 Bacteria 2150
59 Ga0157375_10002043 3300013308 Bacteria 17408
60 Ga0157375_10034881 3300013308 Bacteria 4796
61 Ga0157380_10001536 3300014326 Bacteria 15164
62 Ga0154015_1399988 3300020610 Bacteria 1666
63 Ga0213872_10037187 3300021361 Bacteria 2222
64 Ga0207427_100376 3300025231 Bacteria 27182
65 Ga0209437_100048 3300025233 Bacteria 405107
66 Ga0209437_100102 3300025233 Bacteria 224216
67 Ga0209233_1000029 3300025261 Bacteria 641642
68 Ga0209455_1002242 3300025272 Bacteria 7606
69 Ga0209676_1000948 3300025292 Bacteria 35545
70 Ga0209050_1002880 3300025298 Bacteria 13598
71 Ga0207647_10001468 3300025904 Bacteria 18108
72 Ga0207705_10000079 3300025909 Bacteria 119999
73 Ga0207695_10009594 3300025913 Bacteria 11954
74 Ga0207695_10011420 3300025913 Bacteria 10762
75 Ga0207671_10001553 3300025914 Bacteria 26274
76 Ga0207671_10004487 3300025914 Bacteria 13301
77 Ga0207671_10004827 3300025914 Bacteria 12700
78 Ga0207671_10010262 3300025914 Bacteria 7747
79 Ga0207657_10033300 3300025919 Bacteria 4646
80 Ga0207652_10175381 3300025921 Bacteria 1925
81 Ga0207644_10005751 3300025931 Bacteria 8068
82 Ga0207690_10000343 3300025932 Bacteria 31195
83 Ga0207709_10000072 3300025935 Bacteria 178084
84 Ga0207667_10000204 3300025949 Bacteria 84991
85 Ga0207667_10013351 3300025949 Bacteria 9403
86 Ga0207667_10021946 3300025949 Bacteria 7066
87 Ga0207667_10082995 3300025949 Bacteria 3319
88 Ga0207640_10249895 3300025981 Bacteria 1376
89 Ga0207639_10009211 3300026041 Bacteria 6806
90 Ga0207702_10007581 3300026078 Bacteria 9240
91 Ga0207702_10389469 3300026078 Bacteria 1342
92 Ga0207674_10039856 3300026116 Bacteria 4867
93 Ga0207428_10027574 3300027907 Bacteria 4728
94 Ga0207428_10127216 3300027907 Unclassified 1951
95 Ga0268266_10000030 3300028379 Bacteria 417120
96 Ga0307515_10000744 3300028794 Bacteria 75412
97 Ga0307515_10001710 3300028794 Bacteria 48899
98 Ga0307515_10134578 3300028794 Unclassified 2697
99 Ga0265338_10023657 3300028800 Bacteria 6304
100 Ga0316176_1032241 3300030732 Bacteria 32973
101 Ga0316183_1043120 3300030742 Bacteria 33823
102 Ga0316181_1173145 3300030744 Bacteria 10377
103 Ga0307513_10213214 3300031456 Bacteria 1760
104 Ga0307513_10281776 3300031456 Bacteria 1439
105 Ga0307509_10100842 3300031507 Bacteria 2923
106 Ga0307509_10117761 3300031507 Bacteria 2642
107 Ga0307408_100000958 3300031548 Bacteria 22408
108 Ga0307408_100001471 3300031548 Bacteria 17472
109 Ga0307514_10009026 3300031649 Bacteria 8422
110 Ga0307405_10040630 3300031731 Bacteria 2818
111 Ga0307412_10024147 3300031911 Bacteria 3750
112 Ga0307412_10049706 3300031911 Bacteria 2764
113 Ga0307412_10274154 3300031911 Unclassified 1321
114 Ga0307409_100042036 3300031995 Bacteria 3420
115 Ga0307409_100109386 3300031995 Unclassified 2314
116 Ga0307414_10000183 3300032004 Bacteria 42718
117 Ga0307414_10028341 3300032004 Bacteria 3631
118 Ga0307414_10069804 3300032004 Bacteria 2527
119 Ga0307411_10059443 3300032005 Bacteria 2534
120 Ga0307415_100007429 3300032126 Bacteria 5995
121 Ga0307507_10000071 3300033179 Bacteria 158391
122 Ga0373941_0002433 3300035115 Bacteria 4098
123 Ga0373927_0044641 3300035695 Bacteria 2867
124 Ga0395899_0000887 3300037312 Bacteria 28407
125 Ga0395899_0022989 3300037312 Bacteria 4724
126 Ga0395900_0000140 3300037418 Bacteria 121917
127 Ga0395900_0000143 3300037418 Bacteria 120234
128 Ga0395900_0044167 3300037418 Bacteria 4593
129 Ga0395898_0127782 3300037466 Bacteria 2435
130 Ga0395905_0000175 3300037471 Bacteria 104024
131 Ga0395905_0002359 3300037471 Bacteria 21041
132 Ga0395901_0000313 3300038443 Bacteria 59766
133 Ga0395901_0001279 3300038443 Bacteria 26662
134 Ga0436361_0924736 3300039447 Bacteria 22942
135 Ga0439436_0026301 3300041404 Bacteria 1707
136 Ga0451577_0000156 3300042876 Bacteria 151954
137 Ga0451577_0000260 3300042876 Bacteria 104156
138 Ga0453684_0000836 3300044712 Bacteria 103922
139 Ga0453684_0007111 3300044712 Bacteria 20859
140 Ga0453684_0319343 3300044712 Bacteria 1760
141 Ga0495629_0187543 3300046459 Bacteria 1432
142 Ga0495638_0000013 3300046460 Bacteria 430133
143 Ga0495651_0090667 3300046462 Bacteria 2293
144 Ga0495650_0000050 3300046471 Bacteria 318894
145 Ga0495585_0000100 3300046492 Bacteria 91669
146 Ga0495585_0000212 3300046492 Bacteria 60869
147 Ga0495583_0020713 3300046506 Bacteria 3399
148 Ga0495606_0001049 3300046507 Bacteria 39892
149 Ga0495610_0001712 3300046512 Bacteria 19233
150 Ga0495616_0011574 3300046513 Bacteria 5048
151 Ga0495616_0012081 3300046513 Bacteria 4916
152 Ga0495637_0037028 3300046520 Bacteria 2121
153 Ga0495648_0035107 3300046524 Bacteria 3253
154 Ga0495648_0089194 3300046524 Bacteria 1731
155 Ga0495609_0010078 3300046538 Bacteria 4548
156 Ga0495633_0000161 3300046558 Bacteria 87685
157 Ga0495633_0003952 3300046558 Bacteria 9642
158 Ga0495668_0000179 3300046616 Bacteria 94559
159 Ga0495611_0043507 3300046648 Bacteria 2008
160 Ga0495625_0000110 3300046660 Bacteria 125028
161 Ga0495625_0000980 3300046660 Bacteria 37899
162 Ga0495625_0084122 3300046660 Bacteria 2210
163 Ga0495661_0001127 3300046665 Bacteria 23347
164 Ga0495671_0037440 3300046692 Bacteria 2453
165 Ga0495649_0000011 3300046694 Bacteria 416695
166 Ga0495660_0006983 3300046810 Bacteria 6655
167 Ga0495687_001533 3300047443 Bacteria 21052
168 Ga0495687_006354 3300047443 Bacteria 7264
169 Ga0495679_034187 3300047446 Bacteria 1620
170 Ga0495686_0000107 3300047472 Bacteria 174386
171 Ga0495686_0029462 3300047472 Bacteria 3571
172 Ga0495686_0038344 3300047472 Bacteria 3065
173 Ga0495614_0011871 3300048089 Bacteria 3829
174 Ga0496115_0100709 3300048918 Bacteria 2368
175 Ga0496116_0009485 3300048919 Bacteria 8287
176 Ga0496117_0000407 3300048920 Bacteria 72427
177 Ga0496122_0009841 3300048925 Bacteria 9974
178 Ga0496123_0019206 3300048926 Bacteria 5394
179 Ga0496124_0134743 3300048927 Bacteria 1957
180 Ga0501310_003688 3300049130 Bacteria 1508
181 Ga0495678_003527 3300049459 Bacteria 9608
182 Ga0501297_003390 3300049520 Bacteria 1586
183 Ga0501033_0128582 3300049570 Bacteria 1836
184 Ga0501257_040174 3300049686 Unclassified 1147
185 Ga0500618_000310 3300053125 Bacteria 36035
186 Ga0500559_0018751 3300053136 Bacteria 2923
187 Ga0500616_0000013 3300053153 Bacteria 674172
188 Ga0500622_0003322 3300053156 Bacteria 10864
189 Ga0500624_000617 3300053157 Bacteria 9699

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013308 Ga0157375_10034881 Ga0157375_100348814 316
2 3300044712 Ga0453684_0007111 Ga0453684_0007111_18686_19690 317
3 3300032004 Ga0307414_10069804 Ga0307414_100698043 321
4 iso_pu_bacteria 2522125168 2522551541 330
5 iso_pu_bacteria 2721755487 2722730210 330
6 iso_pu_bacteria 2818991444 2819587934 330
7 iso_pu_bacteria 2842903701 2842903961 330
8 iso_pu_bacteria 2884634485 2884637016 330
9 iso_pu_bacteria 2890737413 2890737917 330
10 iso_pu_bacteria 2896317667 2896320060 330
11 iso_pu_bacteria 2898713307 2898714899 330
12 iso_pu_bacteria 2904780799 2904783854 330
13 iso_pu_bacteria 2910245624 2910247176 330
14 iso_pu_bacteria 2919177583 2919181793 330
15 iso_pu_bacteria 2919692658 2919694475 330
16 iso_pu_bacteria 3003233435 3003237360 330
17 iso_pu_bacteria 2599185184 2599479842 332
18 iso_pu_bacteria 2839989709 2839992539 332
19 iso_pu_bacteria 2919437846 2919440239 332
20 iso_pu_bacteria 2928078545 2928080972 332
21 iso_pu_bacteria 2928147474 2928152611 332
22 iso_pu_bacteria 2929154850 2929157739 332
23 iso_pu_bacteria 2932082852 2932087340 332
24 3300003320 rootH2_10169580 rootH2_101695802 334
25 3300003781 Ga0055536_1008793 Ga0055536_10087935 334
26 3300005262 Ga0065165_1000266 Ga0065165_100026687 334
27 3300005289 Ga0065704_10005268 Ga0065704_100052684 334
28 3300005289 Ga0065704_10013286 Ga0065704_100132862 334
29 3300005841 Ga0068863_100103734 Ga0068863_1001037341 334
30 3300006237 Ga0097621_100402182 Ga0097621_1004021822 334
31 3300006844 Ga0075428_100008074 Ga0075428_10000807412 334
32 3300006880 Ga0075429_100156380 Ga0075429_1001563803 334
33 3300009148 Ga0105243_10000141 Ga0105243_1000014150 334
34 3300013104 Ga0157370_10252472 Ga0157370_102524721 334
35 3300025292 Ga0209676_1000948 Ga0209676_10009485 334
36 3300025298 Ga0209050_1002880 Ga0209050_10028805 334
37 3300025932 Ga0207690_10000343 Ga0207690_100003438 334
38 3300025935 Ga0207709_10000072 Ga0207709_10000072140 334
39 3300027907 Ga0207428_10027574 Ga0207428_100275743 334
40 3300027907 Ga0207428_10127216 Ga0207428_101272161 334
41 3300030732 Ga0316176_1032241 Ga0316176_103224120 334
42 3300030742 Ga0316183_1043120 Ga0316183_10431202 334
43 3300030744 Ga0316181_1173145 Ga0316181_11731453 334
44 3300031456 Ga0307513_10213214 Ga0307513_102132142 334
45 3300031456 Ga0307513_10281776 Ga0307513_102817762 334
46 3300032004 Ga0307414_10000183 Ga0307414_100001835 334
47 3300032004 Ga0307414_10028341 Ga0307414_100283413 334
48 3300032005 Ga0307411_10059443 Ga0307411_100594433 334
49 3300042876 Ga0451577_0000156 Ga0451577_0000156_68729_69736 334
50 3300042876 Ga0451577_0000260 Ga0451577_0000260_64541_65545 334
51 3300044712 Ga0453684_0000836 Ga0453684_0000836_6196_7200 334
52 3300044712 Ga0453684_0319343 Ga0453684_0319343_407_1411 334
53 3300046460 Ga0495638_0000013 Ga0495638_0000013_183780_184784 334
54 3300048918 Ga0496115_0100709 Ga0496115_0100709_1287_2291 334
55 3300048919 Ga0496116_0009485 Ga0496116_0009485_7213_8217 334
56 3300048920 Ga0496117_0000407 Ga0496117_0000407_17200_18204 334
57 3300048925 Ga0496122_0009841 Ga0496122_0009841_6880_7884 334
58 3300048926 Ga0496123_0019206 Ga0496123_0019206_4228_5232 334
59 3300048927 Ga0496124_0134743 Ga0496124_0134743_690_1694 334
60 3300049130 Ga0501310_003688 Ga0501310_003688_333_1337 334
61 3300053136 Ga0500559_0018751 Ga0500559_0018751_1230_2234 334
62 3300053153 Ga0500616_0000013 Ga0500616_0000013_532957_533961 334
63 iso_pu_bacteria 8055588893 8055589609 334
64 3300001990 JGI24737J22298_10001717 JGI24737J22298_100017177 336
65 3300002067 JGI24735J21928_10000007 JGI24735J21928_10000007118 336
66 3300002067 JGI24735J21928_10019927 JGI24735J21928_100199274 336
67 3300002737 JGI25162J39368_1000203 JGI25162J39368_10002035 336
68 3300003320 rootH2_10005336 rootH2_1000533683 336
69 3300003322 rootL2_10030745 rootL2_100307453 336
70 3300003322 rootL2_10096443 rootL2_100964434 336
71 3300003323 rootH1_10004576 rootH1_1000457649 336
72 3300003323 rootH1_10013966 rootH1_100139662 336
73 3300003323 rootH1_10044982 rootH1_100449826 336
74 3300003323 rootH1_10162591 rootH1_101625918 336
75 3300003323 rootH1_10244864 rootH1_102448642 336
76 3300003323 rootH1_10288806 rootH1_102888062 336
77 3300005327 Ga0070658_10000049 Ga0070658_1000004971 336
78 3300005339 Ga0070660_100023582 Ga0070660_1000235823 336
79 3300005355 Ga0070671_100031152 Ga0070671_1000311522 336
80 3300005539 Ga0068853_100019207 Ga0068853_1000192076 336
81 3300005548 Ga0070665_100000032 Ga0070665_100000032181 336
82 3300005563 Ga0068855_100002305 Ga0068855_10000230513 336
83 3300005577 Ga0068857_100026081 Ga0068857_10002608110 336
84 3300005577 Ga0068857_100344998 Ga0068857_1003449982 336
85 3300005614 Ga0068856_100003417 Ga0068856_1000034174 336
86 3300005614 Ga0068856_100436735 Ga0068856_1004367352 336
87 3300009093 Ga0105240_10018900 Ga0105240_100189005 336
88 3300009093 Ga0105240_10316166 Ga0105240_103161662 336
89 3300009094 Ga0111539_10010577 Ga0111539_100105779 336
90 3300009098 Ga0105245_10136414 Ga0105245_101364143 336
91 3300009545 Ga0105237_10001669 Ga0105237_1000166911 336
92 3300009545 Ga0105237_10006377 Ga0105237_100063778 336
93 3300009545 Ga0105237_10009412 Ga0105237_100094126 336
94 3300009545 Ga0105237_10040439 Ga0105237_100404392 336
95 3300010375 Ga0105239_10000009 Ga0105239_10000009200 336
96 3300010375 Ga0105239_10001867 Ga0105239_1000186724 336
97 3300010375 Ga0105239_10007160 Ga0105239_1000716012 336
98 3300010375 Ga0105239_10010995 Ga0105239_100109955 336
99 3300010375 Ga0105239_10093479 Ga0105239_100934792 336
100 3300013102 Ga0157371_10017418 Ga0157371_100174182 336
101 3300013104 Ga0157370_10036736 Ga0157370_100367368 336
102 3300013104 Ga0157370_10367352 Ga0157370_103673522 336
103 3300013105 Ga0157369_10000533 Ga0157369_1000053338 336
104 3300013296 Ga0157374_10532635 Ga0157374_105326351 336
105 3300013306 Ga0163162_10000010 Ga0163162_10000010281 336
106 3300013306 Ga0163162_10007152 Ga0163162_100071524 336
107 3300013306 Ga0163162_10013585 Ga0163162_100135855 336
108 3300013307 Ga0157372_10006692 Ga0157372_100066925 336
109 3300013307 Ga0157372_10008881 Ga0157372_100088812 336
110 3300013307 Ga0157372_10229904 Ga0157372_102299042 336
111 3300013308 Ga0157375_10002043 Ga0157375_100020436 336
112 3300014326 Ga0157380_10001536 Ga0157380_1000153613 336
113 3300020610 Ga0154015_1399988 Ga0154015_13999882 336
114 3300021361 Ga0213872_10037187 Ga0213872_100371872 336
115 3300025231 Ga0207427_100376 Ga0207427_10037620 336
116 3300025233 Ga0209437_100048 Ga0209437_100048144 336
117 3300025233 Ga0209437_100102 Ga0209437_10010258 336
118 3300025261 Ga0209233_1000029 Ga0209233_1000029233 336
119 3300025272 Ga0209455_1002242 Ga0209455_10022422 336
120 3300025904 Ga0207647_10001468 Ga0207647_100014685 336
121 3300025909 Ga0207705_10000079 Ga0207705_1000007930 336
122 3300025913 Ga0207695_10009594 Ga0207695_100095948 336
123 3300025913 Ga0207695_10011420 Ga0207695_100114208 336
124 3300025914 Ga0207671_10001553 Ga0207671_1000155320 336
125 3300025914 Ga0207671_10004487 Ga0207671_100044878 336
126 3300025914 Ga0207671_10004827 Ga0207671_100048276 336
127 3300025914 Ga0207671_10010262 Ga0207671_100102623 336
128 3300025919 Ga0207657_10033300 Ga0207657_100333005 336
129 3300025921 Ga0207652_10175381 Ga0207652_101753813 336
130 3300025931 Ga0207644_10005751 Ga0207644_100057514 336
131 3300025949 Ga0207667_10000204 Ga0207667_1000020431 336
132 3300025949 Ga0207667_10013351 Ga0207667_100133514 336
133 3300025949 Ga0207667_10021946 Ga0207667_100219467 336
134 3300025949 Ga0207667_10082995 Ga0207667_100829953 336
135 3300025981 Ga0207640_10249895 Ga0207640_102498952 336
136 3300026041 Ga0207639_10009211 Ga0207639_100092113 336
137 3300026078 Ga0207702_10007581 Ga0207702_100075814 336
138 3300026078 Ga0207702_10389469 Ga0207702_103894691 336
139 3300026116 Ga0207674_10039856 Ga0207674_100398563 336
140 3300028379 Ga0268266_10000030 Ga0268266_10000030149 336
141 3300028794 Ga0307515_10000744 Ga0307515_1000074463 336
142 3300028794 Ga0307515_10001710 Ga0307515_1000171024 336
143 3300028794 Ga0307515_10134578 Ga0307515_101345783 336
144 3300028800 Ga0265338_10023657 Ga0265338_100236573 336
145 3300031507 Ga0307509_10100842 Ga0307509_101008422 336
146 3300031507 Ga0307509_10117761 Ga0307509_101177613 336
147 3300031548 Ga0307408_100000958 Ga0307408_10000095810 336
148 3300031548 Ga0307408_100001471 Ga0307408_10000147114 336
149 3300031649 Ga0307514_10009026 Ga0307514_100090265 336
150 3300031731 Ga0307405_10040630 Ga0307405_100406302 336
151 3300031911 Ga0307412_10024147 Ga0307412_100241474 336
152 3300031911 Ga0307412_10049706 Ga0307412_100497064 336
153 3300031911 Ga0307412_10274154 Ga0307412_102741541 336
154 3300031995 Ga0307409_100042036 Ga0307409_1000420363 336
155 3300031995 Ga0307409_100109386 Ga0307409_1001093864 336
156 3300032126 Ga0307415_100007429 Ga0307415_1000074293 336
157 3300033179 Ga0307507_10000071 Ga0307507_1000007194 336
158 3300035115 Ga0373941_0002433 Ga0373941_0002433_2212_3222 336
159 3300035695 Ga0373927_0044641 Ga0373927_0044641_821_1897 336
160 3300037312 Ga0395899_0000887 Ga0395899_0000887_26658_27668 336
161 3300037312 Ga0395899_0022989 Ga0395899_0022989_3440_4450 336
162 3300037418 Ga0395900_0000140 Ga0395900_0000140_7665_8687 336
163 3300037418 Ga0395900_0000143 Ga0395900_0000143_27826_28836 336
164 3300037418 Ga0395900_0044167 Ga0395900_0044167_1440_2450 336
165 3300037466 Ga0395898_0127782 Ga0395898_0127782_742_1752 336
166 3300037471 Ga0395905_0000175 Ga0395905_0000175_3845_4855 336
167 3300037471 Ga0395905_0002359 Ga0395905_0002359_18745_19755 336
168 3300038443 Ga0395901_0000313 Ga0395901_0000313_729_1739 336
169 3300038443 Ga0395901_0001279 Ga0395901_0001279_23126_24136 336
170 3300039447 Ga0436361_0924736 Ga0436361_0924736_7413_8423 336
171 3300041404 Ga0439436_0026301 Ga0439436_0026301_474_1508 336
172 3300046459 Ga0495629_0187543 Ga0495629_0187543_94_1104 336
173 3300046462 Ga0495651_0090667 Ga0495651_0090667_335_1345 336
174 3300046471 Ga0495650_0000050 Ga0495650_0000050_112941_113951 336
175 3300046492 Ga0495585_0000100 Ga0495585_0000100_44691_45701 336
176 3300046492 Ga0495585_0000212 Ga0495585_0000212_42833_43843 336
177 3300046506 Ga0495583_0020713 Ga0495583_0020713_1829_2839 336
178 3300046507 Ga0495606_0001049 Ga0495606_0001049_5147_6157 336
179 3300046512 Ga0495610_0001712 Ga0495610_0001712_9320_10330 336
180 3300046513 Ga0495616_0011574 Ga0495616_0011574_2071_3081 336
181 3300046513 Ga0495616_0012081 Ga0495616_0012081_1749_2759 336
182 3300046520 Ga0495637_0037028 Ga0495637_0037028_791_1801 336
183 3300046524 Ga0495648_0035107 Ga0495648_0035107_200_1210 336
184 3300046524 Ga0495648_0089194 Ga0495648_0089194_653_1663 336
185 3300046538 Ga0495609_0010078 Ga0495609_0010078_3058_4068 336
186 3300046558 Ga0495633_0000161 Ga0495633_0000161_58581_59645 336
187 3300046558 Ga0495633_0003952 Ga0495633_0003952_6290_7300 336
188 3300046616 Ga0495668_0000179 Ga0495668_0000179_85604_86614 336
189 3300046648 Ga0495611_0043507 Ga0495611_0043507_265_1275 336
190 3300046660 Ga0495625_0000110 Ga0495625_0000110_24805_25815 336
191 3300046660 Ga0495625_0000980 Ga0495625_0000980_19615_20625 336
192 3300046660 Ga0495625_0084122 Ga0495625_0084122_919_1929 336
193 3300046665 Ga0495661_0001127 Ga0495661_0001127_17226_18236 336
194 3300046692 Ga0495671_0037440 Ga0495671_0037440_703_1713 336
195 3300046694 Ga0495649_0000011 Ga0495649_0000011_273653_274663 336
196 3300046810 Ga0495660_0006983 Ga0495660_0006983_2260_3270 336
197 3300047443 Ga0495687_001533 Ga0495687_001533_4715_5725 336
198 3300047443 Ga0495687_006354 Ga0495687_006354_4866_5876 336
199 3300047446 Ga0495679_034187 Ga0495679_034187_59_1069 336
200 3300047472 Ga0495686_0000107 Ga0495686_0000107_33293_34303 336
201 3300047472 Ga0495686_0029462 Ga0495686_0029462_895_1905 336
202 3300047472 Ga0495686_0038344 Ga0495686_0038344_1067_2077 336
203 3300048089 Ga0495614_0011871 Ga0495614_0011871_2467_3477 336
204 3300049459 Ga0495678_003527 Ga0495678_003527_3405_4415 336
205 3300049520 Ga0501297_003390 Ga0501297_003390_12_1079 336
206 3300049570 Ga0501033_0128582 Ga0501033_0128582_608_1621 336
207 3300049686 Ga0501257_040174 Ga0501257_040174_55_1068 336
208 3300053125 Ga0500618_000310 Ga0500618_000310_19013_20023 336
209 3300053156 Ga0500622_0003322 Ga0500622_0003322_3022_4032 336
210 3300053157 Ga0500624_000617 Ga0500624_000617_6269_7279 336
211 iso_pu_bacteria 2911138879 2911142759 336

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00070

Pyr_redox

Pyridine nucleotide-disulphide oxidoreductase

153

233

0.9

PF07992

Pyr_redox_2

Pyridine nucleotide-disulphide oxidoreductase

4

307

0.83

PF13738

Pyr_redox_3

Pyridine nucleotide-disulphide oxidoreductase

62

286

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
4a5l-assembly1.cif.gz_A crystal structure of the thioredoxin reductase from entamoeba histolytica 0.8347 7 319
4mo2-assembly1.cif.gz_B-2 crystal structure of udp-n-acetylgalactopyranose mutase from campylobacter jejuni 0.8317 6 46
4a5l-assembly1.cif.gz_A crystal structure of the thioredoxin reductase from entamoeba histolytica 0.8202 7 319
5vt3-assembly1.cif.gz_A high resolution structure of thioredoxin-disulfide reductase from vibrio vulnificus cmcp6 in complex with nadp and fad 0.8074 5 317
6pr0-assembly1.cif.gz_A p133h-s128a s. typhimurium siroheme synthase 0.8069 151 211
ID Description Score Start End Superfamily
2zbwB02 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9808 130 247 3.50.50.60
2zbwB02 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9413 130 247 3.50.50.60
5u63A02 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9277 126 249 3.50.50.60
4ykgA03 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.926 126 249 3.50.50.60
3ab1B02 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9251 126 247 3.50.50.60
ID Description Score Start End GO Terms
AF-A0A3D3C2H9-F1-model_v4 Thioredoxin-disulfide reductase 0.9409 148 242 GO:0016491
AF-A0A009LKK5-F1-model_v4 Pyridine nucleotide-disulfide oxidoreductase family protein 0.9137 121 246 GO:0016668
AF-A0A6N6X486-F1-model_v4 deleted 0.9085 121 245
AF-A0A7C1RWM3-F1-model_v4 NAD(P)/FAD-dependent oxidoreductase 0.9028 4 117 GO:0016491
AF-A0A435E010-F1-model_v4 NAD(P)/FAD-dependent oxidoreductase 0.8956 2 117 GO:0016491

Feature Viewer

pLDDT pTM Quality
83.56 0.67 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map