F320815

General Info

Members Datasets Scaffolds Average Seq Length
210 140 420 361

Family's Representative Sequence

Representative Sequence 3300047472|Ga0495686_0003447|Ga0495686_0003447_2538_3701
Length 387
Sequence MSHIEPQPVASSEISGQTIAVAMSGGVDSSAVAALLRGQGHTLVGLTLQLWNQRRLAGHEGMPESVQGRCCSIDDVYDARRVAEQLDIPYYLVNQQDRFEADVVKPFVSEYLAGRTPIPCTLCNNHLKFDQLLLTAQQIGADLIATGHYARNHFDEARGRWILSRPADHAKDQTYFLFGLTQHQLAHTLFPLGEMQKPAVRVMASEAGLNVAAKPDSQEICFIPGGDYQTFLRAYLDEQGEEMPDSSGDLVSSSGEVLGKHTGIHSFTVGQRKGLGLTSPNPLYVLNIHPDSHQVTVGTDAELMSRELRADRLNWISIPSLTEPIRVLAKVRHRHEPQPATLSPGPLSPDGQPTAVALFDEPQRAITPGQAAIFYQGDEVVGGGWII

Samples

Sample ID Description Type Environment
1 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
17 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
21 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
22 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
26 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
27 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
28 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
29 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
30 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
31 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
32 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
33 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
34 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
35 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
36 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
37 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
38 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
39 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
40 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
41 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
42 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
43 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
44 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
45 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
46 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
47 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
48 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
49 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
50 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
51 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
52 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
53 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
76 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
78 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
79 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
80 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
81 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
82 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
83 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
84 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
85 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
86 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
87 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
88 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
89 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
90 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
91 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
92 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
93 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
94 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
95 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
96 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
97 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
98 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
99 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
100 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
101 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
102 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
103 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
104 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
105 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
106 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
107 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
108 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
109 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
110 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
111 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
112 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
113 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
114 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
115 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
116 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
117 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
118 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
119 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
120 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
121 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
122 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
123 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
124 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
125 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
126 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
127 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
128 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
129 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
130 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
131 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
132 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
133 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
134 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
135 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
136 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
137 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
138 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
139 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
140 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.52
Metatranscriptomes 0.48
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.95
Nodule 0
Rhizoplane 7.14
Rhizosphere 90.95
Stem 0
Stem Tuber 0
Unclassified 5.24

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495686_0003447 3300047472 Bacteria 13704
2 SwRhRL2b_contig_2777737 2162886007 Unclassified 3385
3 LJNas_1000237 3300000546 Bacteria 9497
4 Ga0065704_10073404 3300005289 Bacteria 7204
5 Ga0065707_10000515 3300005295 Bacteria 26646
6 Ga0065707_10098703 3300005295 Unclassified 3064
7 Ga0070658_10000007 3300005327 Bacteria 349444
8 Ga0070658_10021570 3300005327 Bacteria 5162
9 Ga0070658_10055169 3300005327 Bacteria 3228
10 Ga0070658_10058989 3300005327 Bacteria 3125
11 Ga0070666_10008237 3300005335 Bacteria 6462
12 Ga0070666_10233663 3300005335 Bacteria 1299
13 Ga0070680_100155802 3300005336 Bacteria 1919
14 Ga0068868_100164740 3300005338 Bacteria 1833
15 Ga0070660_100147525 3300005339 Bacteria 1890
16 Ga0070661_100031850 3300005344 Bacteria 3814
17 Ga0070671_100014972 3300005355 Bacteria 6263
18 Ga0070659_100002591 3300005366 Bacteria 12855
19 Ga0070659_100007704 3300005366 Bacteria 7832
20 Ga0070713_100004221 3300005436 Bacteria 9600
21 Ga0070708_100014540 3300005445 Bacteria 6482
22 Ga0070663_100008901 3300005455 Bacteria 6198
23 Ga0070699_100002867 3300005518 Bacteria 15369
24 Ga0070699_100023186 3300005518 Bacteria 5348
25 Ga0070699_100035588 3300005518 Bacteria 4304
26 Ga0070679_100107858 3300005530 Bacteria 2770
27 Ga0070684_100232420 3300005535 Bacteria 1684
28 Ga0070697_100013064 3300005536 Bacteria 6509
29 Ga0068853_100000793 3300005539 Bacteria 21912
30 Ga0068853_100004354 3300005539 Bacteria 10959
31 Ga0070696_100009960 3300005546 Bacteria 6359
32 Ga0070665_100003757 3300005548 Bacteria 16073
33 Ga0070665_100006211 3300005548 Bacteria 12222
34 Ga0070665_100198398 3300005548 Bacteria 2007
35 Ga0068855_100005974 3300005563 Bacteria 14853
36 Ga0068855_100024726 3300005563 Bacteria 7185
37 Ga0068855_100042381 3300005563 Bacteria 5393
38 Ga0068857_100149373 3300005577 Bacteria 2116
39 Ga0068854_100000162 3300005578 Bacteria 46114
40 Ga0068859_100427955 3300005617 Bacteria 1420
41 Ga0068864_100097494 3300005618 Unclassified 2603
42 Ga0070712_100088488 3300006175 Bacteria 2263
43 Ga0068865_100083337 3300006881 Bacteria 2301
44 Ga0105240_10018153 3300009093 Bacteria 9457
45 Ga0105240_10033358 3300009093 Bacteria 6652
46 Ga0105240_10322405 3300009093 Bacteria 1760
47 Ga0111539_10003784 3300009094 Bacteria 19908
48 Ga0105245_10015178 3300009098 Bacteria 6710
49 Ga0105245_10123920 3300009098 Bacteria 2417
50 Ga0114129_10044573 3300009147 Bacteria 6239
51 Ga0114129_10173805 3300009147 Unclassified 2935
52 Ga0105243_10322480 3300009148 Bacteria 1408
53 Ga0105248_10004403 3300009177 Bacteria 15589
54 Ga0105237_10017209 3300009545 Bacteria 7499
55 Ga0105237_10135185 3300009545 Bacteria 2460
56 Ga0105238_10000347 3300009551 Bacteria 49819
57 Ga0105238_10038365 3300009551 Bacteria 4865
58 Ga0105238_10124703 3300009551 Bacteria 2555
59 Ga0105239_10147566 3300010375 Bacteria 2624
60 Ga0105239_10217905 3300010375 Bacteria 2140
61 Ga0157370_10045318 3300013104 Bacteria 4220
62 Ga0157370_10052811 3300013104 Bacteria 3878
63 Ga0157369_10003846 3300013105 Bacteria 17837
64 Ga0157369_10023096 3300013105 Bacteria 6930
65 Ga0157369_10071652 3300013105 Bacteria 3720
66 Ga0157374_10007620 3300013296 Bacteria 9240
67 Ga0157374_10270982 3300013296 Bacteria 1674
68 Ga0157378_10130896 3300013297 Bacteria 2322
69 Ga0163162_10130477 3300013306 Bacteria 2622
70 Ga0157372_10035984 3300013307 Bacteria 5453
71 Ga0157372_10039839 3300013307 Bacteria 5187
72 Ga0157372_10152312 3300013307 Bacteria 2670
73 Ga0157375_10463927 3300013308 Bacteria 1432
74 Ga0163163_10006424 3300014325 Bacteria 10274
75 Ga0163163_10033188 3300014325 Bacteria 4991
76 Ga0163163_10105684 3300014325 Bacteria 2841
77 Ga0163163_10128330 3300014325 Bacteria 2575
78 Ga0157379_10222483 3300014968 Bacteria 1710
79 Ga0157376_10227466 3300014969 Bacteria 1731
80 Ga0157376_10256069 3300014969 Bacteria 1637
81 Ga0213872_10015830 3300021361 Bacteria 3504
82 Ga0213872_10032246 3300021361 Bacteria 2401
83 Ga0224572_1016162 3300024225 Bacteria 1431
84 Ga0209233_1001419 3300025261 Bacteria 9451
85 Ga0207680_10033577 3300025903 Bacteria 2928
86 Ga0207647_10001022 3300025904 Bacteria 21750
87 Ga0207705_10000013 3300025909 Bacteria 451680
88 Ga0207705_10005997 3300025909 Bacteria 9043
89 Ga0207705_10092985 3300025909 Bacteria 2211
90 Ga0207705_10285782 3300025909 Bacteria 1263
91 Ga0207695_10014894 3300025913 Bacteria 9178
92 Ga0207657_10016453 3300025919 Bacteria 7134
93 Ga0207657_10024342 3300025919 Bacteria 5611
94 Ga0207649_10003594 3300025920 Bacteria 8471
95 Ga0207694_10003593 3300025924 Bacteria 12298
96 Ga0207694_10003854 3300025924 Bacteria 11855
97 Ga0207687_10238887 3300025927 Bacteria 1439
98 Ga0207700_10088277 3300025928 Bacteria 2441
99 Ga0207644_10273870 3300025931 Bacteria 1353
100 Ga0207690_10034473 3300025932 Bacteria 3262
101 Ga0207669_10108075 3300025937 Bacteria 1857
102 Ga0207665_10050700 3300025939 Bacteria 2792
103 Ga0207667_10016396 3300025949 Bacteria 8374
104 Ga0207667_10036766 3300025949 Bacteria 5243
105 Ga0207667_10040896 3300025949 Bacteria 4934
106 Ga0207640_10000013 3300025981 Bacteria 224767
107 Ga0207677_10073421 3300026023 Bacteria 2423
108 Ga0207703_10129307 3300026035 Bacteria 2179
109 Ga0207639_10000075 3300026041 Bacteria 90425
110 Ga0207639_10013461 3300026041 Bacteria 5727
111 Ga0207678_10002887 3300026067 Bacteria 15600
112 Ga0207678_10003355 3300026067 Bacteria 14442
113 Ga0207641_10022382 3300026088 Bacteria 5203
114 Ga0207648_10121905 3300026089 Bacteria 2293
115 Ga0207676_10042868 3300026095 Bacteria 3481
116 Ga0207676_10111082 3300026095 Unclassified 2294
117 Ga0207428_10031489 3300027907 Bacteria 4373
118 Ga0268266_10037640 3300028379 Unclassified 4120
119 Ga0268266_10091299 3300028379 Bacteria 2670
120 Ga0265338_10143185 3300028800 Bacteria 1869
121 Ga0265760_10001055 3300031090 Bacteria 7998
122 Ga0265327_10001522 3300031251 Bacteria 28628
123 Ga0307410_10001111 3300031852 Bacteria 11744
124 Ga0307406_10025911 3300031901 Bacteria 3515
125 Ga0307412_10150190 3300031911 Bacteria 1718
126 Ga0307415_100145407 3300032126 Bacteria 1817
127 Ga0395900_0056462 3300037418 Bacteria 4041
128 Ga0395905_0013069 3300037471 Bacteria 7972
129 Ga0395905_0106819 3300037471 Bacteria 2628
130 Ga0395901_0014662 3300038443 Bacteria 7965
131 Ga0395901_0051240 3300038443 Bacteria 4291
132 Ga0395901_0640645 3300038443 Bacteria 1067
133 Ga0436361_0035228 3300039447 Bacteria 17454
134 Ga0436361_0930976 3300039447 Bacteria 5825
135 Ga0466963_0114750 3300044694 Bacteria 1851
136 Ga0453684_0067383 3300044712 Bacteria 4552
137 Ga0453684_0155932 3300044712 Unclassified 2708
138 Ga0466959_0042070 3300045049 Bacteria 3371
139 Ga0451576_0012449 3300045051 Bacteria 9553
140 Ga0451576_0387665 3300045051 Unclassified 1464
141 Ga0495592_0018363 3300046454 Bacteria 5318
142 Ga0495590_0028073 3300046457 Bacteria 1974
143 Ga0495650_0000010 3300046471 Bacteria 645599
144 Ga0495580_0136467 3300046472 Bacteria 1701
145 Ga0495664_0028661 3300046477 Bacteria 3252
146 Ga0495606_0055659 3300046507 Bacteria 2557
147 Ga0495618_0158845 3300046514 Bacteria 1442
148 Ga0495618_0169467 3300046514 Bacteria 1390
149 Ga0495628_0151792 3300046516 Bacteria 1764
150 Ga0495628_0167984 3300046516 Bacteria 1664
151 Ga0495652_0073647 3300046529 Bacteria 2843
152 Ga0495586_0035219 3300046535 Bacteria 2689
153 Ga0495587_0004315 3300046536 Bacteria 9386
154 Ga0495645_0000892 3300046543 Bacteria 20333
155 Ga0495645_0064483 3300046543 Bacteria 2651
156 Ga0495645_0115586 3300046543 Bacteria 1895
157 Ga0495645_0120365 3300046543 Bacteria 1849
158 Ga0495668_0145613 3300046616 Bacteria 1297
159 Ga0495635_0037330 3300046663 Unclassified 3364
160 Ga0495635_0104033 3300046663 Bacteria 1940
161 Ga0495661_0073844 3300046665 Bacteria 1986
162 Ga0495588_0024949 3300046674 Bacteria 2975
163 Ga0495623_0034851 3300046679 Bacteria 3227
164 Ga0495646_0026333 3300046680 Bacteria 3652
165 Ga0495658_0122376 3300046683 Bacteria 1575
166 Ga0495613_0039280 3300046689 Bacteria 3509
167 Ga0495600_0130357 3300046809 Bacteria 1635
168 Ga0495604_0010935 3300047317 Bacteria 7205
169 Ga0495676_0019099 3300047321 Bacteria 6034
170 Ga0495675_0003366 3300047444 Bacteria 9628
171 Ga0495675_0155882 3300047444 Unclassified 1409
172 Ga0495684_0063226 3300047471 Bacteria 2814
173 Ga0495684_0225932 3300047471 Bacteria 1371
174 Ga0495686_0000027 3300047472 Bacteria 382657
175 Ga0495686_0070136 3300047472 Bacteria 2160
176 Ga0495686_0098002 3300047472 Bacteria 1772
177 Ga0495602_0034024 3300048088 Bacteria 4772
178 Ga0495602_0294951 3300048088 Bacteria 1189
179 Ga0496100_0010731 3300048903 Bacteria 5194
180 Ga0496101_0000773 3300048904 Bacteria 18926
181 Ga0496102_0048795 3300048905 Bacteria 3850
182 Ga0496102_0313606 3300048905 Bacteria 1478
183 Ga0496104_0000014 3300048907 Bacteria 377972
184 Ga0496104_0048058 3300048907 Bacteria 4023
185 Ga0496105_0209729 3300048908 Bacteria 1588
186 Ga0496105_0282822 3300048908 Unclassified 1337
187 Ga0496109_0097004 3300048912 Bacteria 2732
188 Ga0496110_0011827 3300048913 Bacteria 7166
189 Ga0496112_0109997 3300048915 Bacteria 2726
190 Ga0496112_0494019 3300048915 Bacteria 1159
191 Ga0496114_0000233 3300048917 Bacteria 40546
192 Ga0496115_0076034 3300048918 Bacteria 2729
193 Ga0496115_0343070 3300048918 Bacteria 1219
194 Ga0496126_0000111 3300048929 Bacteria 195620
195 Ga0496126_0002662 3300048929 Bacteria 23656
196 Ga0501034_0159490 3300049571 Bacteria 2228
197 Ga0501071_0133023 3300049587 Bacteria 1849
198 Ga0501072_0144500 3300049588 Bacteria 1897
199 Ga0501076_0106741 3300049592 Bacteria 2261
200 Ga0501076_0181908 3300049592 Bacteria 1714
201 Ga0501079_0305272 3300049741 Bacteria 1245
202 nmdc:mga05p37_137579_c1 3300050507 Bacteria 2994
203 nmdc:mga05p37_85449_c1 3300050507 Bacteria 3888
204 nmdc:mga06r32_201050_c1 3300050510 Bacteria 1980
205 nmdc:mga08y16_43069_c1 3300050511 Bacteria 4729
206 Ga0495601_0038297 3300053077 Bacteria 2998
207 Ga0495601_0111612 3300053077 Bacteria 1771
208 Ga0495612_0020420 3300053078 Bacteria 2655
209 Ga0500643_037333 3300053087 Bacteria 1447
210 Ga0530510_0119855 3300061734 Bacteria 1931
211 Ga0495686_0003447
212 SwRhRL2b_contig_2777737
213 LJNas_1000237
214 Ga0065704_10073404
215 Ga0065707_10000515
216 Ga0065707_10098703
217 Ga0070658_10000007
218 Ga0070658_10021570
219 Ga0070658_10055169
220 Ga0070658_10058989
221 Ga0070666_10008237
222 Ga0070666_10233663
223 Ga0070680_100155802
224 Ga0068868_100164740
225 Ga0070660_100147525
226 Ga0070661_100031850
227 Ga0070671_100014972
228 Ga0070659_100002591
229 Ga0070659_100007704
230 Ga0070713_100004221
231 Ga0070708_100014540
232 Ga0070663_100008901
233 Ga0070699_100002867
234 Ga0070699_100023186
235 Ga0070699_100035588
236 Ga0070679_100107858
237 Ga0070684_100232420
238 Ga0070697_100013064
239 Ga0068853_100000793
240 Ga0068853_100004354
241 Ga0070696_100009960
242 Ga0070665_100003757
243 Ga0070665_100006211
244 Ga0070665_100198398
245 Ga0068855_100005974
246 Ga0068855_100024726
247 Ga0068855_100042381
248 Ga0068857_100149373
249 Ga0068854_100000162
250 Ga0068859_100427955
251 Ga0068864_100097494
252 Ga0070712_100088488
253 Ga0068865_100083337
254 Ga0105240_10018153
255 Ga0105240_10033358
256 Ga0105240_10322405
257 Ga0111539_10003784
258 Ga0105245_10015178
259 Ga0105245_10123920
260 Ga0114129_10044573
261 Ga0114129_10173805
262 Ga0105243_10322480
263 Ga0105248_10004403
264 Ga0105237_10017209
265 Ga0105237_10135185
266 Ga0105238_10000347
267 Ga0105238_10038365
268 Ga0105238_10124703
269 Ga0105239_10147566
270 Ga0105239_10217905
271 Ga0157370_10045318
272 Ga0157370_10052811
273 Ga0157369_10003846
274 Ga0157369_10023096
275 Ga0157369_10071652
276 Ga0157374_10007620
277 Ga0157374_10270982
278 Ga0157378_10130896
279 Ga0163162_10130477
280 Ga0157372_10035984
281 Ga0157372_10039839
282 Ga0157372_10152312
283 Ga0157375_10463927
284 Ga0163163_10006424
285 Ga0163163_10033188
286 Ga0163163_10105684
287 Ga0163163_10128330
288 Ga0157379_10222483
289 Ga0157376_10227466
290 Ga0157376_10256069
291 Ga0213872_10015830
292 Ga0213872_10032246
293 Ga0224572_1016162
294 Ga0209233_1001419
295 Ga0207680_10033577
296 Ga0207647_10001022
297 Ga0207705_10000013
298 Ga0207705_10005997
299 Ga0207705_10092985
300 Ga0207705_10285782
301 Ga0207695_10014894
302 Ga0207657_10016453
303 Ga0207657_10024342
304 Ga0207649_10003594
305 Ga0207694_10003593
306 Ga0207694_10003854
307 Ga0207687_10238887
308 Ga0207700_10088277
309 Ga0207644_10273870
310 Ga0207690_10034473
311 Ga0207669_10108075
312 Ga0207665_10050700
313 Ga0207667_10016396
314 Ga0207667_10036766
315 Ga0207667_10040896
316 Ga0207640_10000013
317 Ga0207677_10073421
318 Ga0207703_10129307
319 Ga0207639_10000075
320 Ga0207639_10013461
321 Ga0207678_10002887
322 Ga0207678_10003355
323 Ga0207641_10022382
324 Ga0207648_10121905
325 Ga0207676_10042868
326 Ga0207676_10111082
327 Ga0207428_10031489
328 Ga0268266_10037640
329 Ga0268266_10091299
330 Ga0265338_10143185
331 Ga0265760_10001055
332 Ga0265327_10001522
333 Ga0307410_10001111
334 Ga0307406_10025911
335 Ga0307412_10150190
336 Ga0307415_100145407
337 Ga0395900_0056462
338 Ga0395905_0013069
339 Ga0395905_0106819
340 Ga0395901_0014662
341 Ga0395901_0051240
342 Ga0395901_0640645
343 Ga0436361_0035228
344 Ga0436361_0930976
345 Ga0466963_0114750
346 Ga0453684_0067383
347 Ga0453684_0155932
348 Ga0466959_0042070
349 Ga0451576_0012449
350 Ga0451576_0387665
351 Ga0495592_0018363
352 Ga0495590_0028073
353 Ga0495650_0000010
354 Ga0495580_0136467
355 Ga0495664_0028661
356 Ga0495606_0055659
357 Ga0495618_0158845
358 Ga0495618_0169467
359 Ga0495628_0151792
360 Ga0495628_0167984
361 Ga0495652_0073647
362 Ga0495586_0035219
363 Ga0495587_0004315
364 Ga0495645_0000892
365 Ga0495645_0064483
366 Ga0495645_0115586
367 Ga0495645_0120365
368 Ga0495668_0145613
369 Ga0495635_0037330
370 Ga0495635_0104033
371 Ga0495661_0073844
372 Ga0495588_0024949
373 Ga0495623_0034851
374 Ga0495646_0026333
375 Ga0495658_0122376
376 Ga0495613_0039280
377 Ga0495600_0130357
378 Ga0495604_0010935
379 Ga0495676_0019099
380 Ga0495675_0003366
381 Ga0495675_0155882
382 Ga0495684_0063226
383 Ga0495684_0225932
384 Ga0495686_0000027
385 Ga0495686_0070136
386 Ga0495686_0098002
387 Ga0495602_0034024
388 Ga0495602_0294951
389 Ga0496100_0010731
390 Ga0496101_0000773
391 Ga0496102_0048795
392 Ga0496102_0313606
393 Ga0496104_0000014
394 Ga0496104_0048058
395 Ga0496105_0209729
396 Ga0496105_0282822
397 Ga0496109_0097004
398 Ga0496110_0011827
399 Ga0496112_0109997
400 Ga0496112_0494019
401 Ga0496114_0000233
402 Ga0496115_0076034
403 Ga0496115_0343070
404 Ga0496126_0000111
405 Ga0496126_0002662
406 Ga0501034_0159490
407 Ga0501071_0133023
408 Ga0501072_0144500
409 Ga0501076_0106741
410 Ga0501076_0181908
411 Ga0501079_0305272
412 nmdc:mga05p37_137579_c1
413 nmdc:mga05p37_85449_c1
414 nmdc:mga06r32_201050_c1
415 nmdc:mga08y16_43069_c1
416 Ga0495601_0038297
417 Ga0495601_0111612
418 Ga0495612_0020420
419 Ga0500643_037333
420 Ga0530510_0119855

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03054

tRNA_Me_trans

tRNA methyl transferase HUP domain

17

225

0.96

PF20259

tRNA_Me_trans_M

tRNA methyl transferase PRC-barrel domain

231

299

0.94

PF20258

tRNA_Me_trans_C

Aminomethyltransferase beta-barrel domain

305

386

0.87

PF00733

Asn_synthase

Asparagine synthase

8

243

0.71

Structural Annotation

Top 5 Hits

ID Description Score Start End
2deu-assembly2.cif.gz_B cocrystal structure of an rna sulfuration enzyme mnma and trna-glu in the adenylated intermediate state 0.9311 1 351
2deu-assembly2.cif.gz_B cocrystal structure of an rna sulfuration enzyme mnma and trna-glu in the adenylated intermediate state 0.9261 1 351
2hma-assembly1.cif.gz_A-2 the crystal structure of trna (5-methylaminomethyl-2-thiouridylate)-methyltransferase trmu from streptococcus pneumoniae 0.926 2 351
2der-assembly1.cif.gz_A cocrystal structure of an rna sulfuration enzyme mnma and trna-glu in the initial trna binding state 0.9218 1 351
2hma-assembly1.cif.gz_A-2 the crystal structure of trna (5-methylaminomethyl-2-thiouridylate)-methyltransferase trmu from streptococcus pneumoniae 0.9082 2 351
ID Description Score Start End Superfamily
af_P9WJS5_275_357_2.40.30.10 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;Translation factors 0.9486 276 351 2.40.30.10
2derA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9431 1 209 3.40.50.620
2detA03 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;Translation factors 0.9426 273 351 2.40.30.10
2hmaA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9398 2 208 3.40.50.620
2derA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9383 1 209 3.40.50.620
ID Description Score Start End GO Terms
AF-A0A350MSX1-F1-model_v4 tRNA 2-thiouridine(34) synthase MnmA 0.9865 231 351 GO:0002143
GO:0016783
AF-A0A349VSP1-F1-model_v4 tRNA-specific 2-thiouridylase MnmA-like C-terminal domain-containing protein 0.9845 275 352 GO:0002143
AF-X1PQM8-F1-model_v4 Uncharacterized protein 0.98 73 329 GO:0000049
GO:0002143
GO:0005524
GO:0016783
AF-A0A382AXZ0-F1-model_v4 tRNA-5-taurinomethyluridine 2-sulfurtransferase 0.9769 51 192 GO:0000049
GO:0008033
AF-A0A150MB98-F1-model_v4 tRNA-specific 2-thiouridylase MnmA-like C-terminal domain-containing protein 0.9769 273 351 GO:0002143

Map