F320592

General Info

Members Datasets Scaffolds Average Seq Length
210 134 420 311

Family's Representative Sequence

Representative Sequence 3300035695|Ga0373927_0050733|Ga0373927_0050733_619_1620
Length 333
Sequence MQPRVGNIEIEVFPIMKHVASILAVIVATTTSVSAAETRLSIEGPSGVLQGTLAAPDGGLKAPVAIIIPGSGPTDRDGNNPLGVTAGSYRLLAEALAAKGVSTIRIDKRGMFGSIAAAADADNVRMTDYAADVRAWGQEAQKRTSARCAWLMGHSEGSLIALITAQQPEGICGLILVAGAGRKMGDILREQLKANPANAPILPQALAAITELEAGRRVDVSGMHPALMALFRPSVQGFVIDQMSYDPAALLTRYAGPVLVLQGTTDLQVSMQDAQRLAGARPGVSMVALEGVNHILKIAPADPAANFATYANSALPIAPSLVEAIASFLAQHP

Samples

Sample ID Description Type Environment
1 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
19 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
28 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
29 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
30 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
31 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
32 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
33 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
34 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
35 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
36 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
38 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
39 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
40 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
41 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
42 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
43 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
44 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
45 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
46 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
47 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
48 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
49 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
50 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
51 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
52 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
53 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
84 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
85 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
86 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
87 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
88 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
89 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
90 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
91 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
92 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
93 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
94 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
95 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
96 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
97 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
98 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
99 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
100 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
101 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
102 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
103 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
104 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
105 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
106 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
107 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
108 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
109 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
110 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
111 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
112 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
113 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
114 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
115 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
116 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
117 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
118 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
119 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
120 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
121 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
122 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
123 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
124 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
125 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
126 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
127 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
128 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
129 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
130 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
131 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
132 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
133 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
134 2885427238 Sphingomonas mesophila SYSUP0001 Isolate Stem Tuber

Type Distribution

Type Percentage (%)
Metagenomes 99.52
Metatranscriptomes 0
Isolates 0.48

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.95
Nodule 0
Rhizoplane 1.43
Rhizosphere 96.19
Stem 0
Stem Tuber 0.48
Unclassified 1.43

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373927_0050733 3300035695 Bacteria 2683
2 JGI24741J21665_1004376 3300001915 Bacteria 3147
3 JGI24740J21852_10006860 3300001979 Bacteria 4675
4 JGI24735J21928_10012148 3300002067 Bacteria 2723
5 Ga0070658_10008898 3300005327 Bacteria 8070
6 Ga0070658_10057029 3300005327 Bacteria 3176
7 Ga0070658_10134730 3300005327 Unclassified 2060
8 Ga0070658_10141856 3300005327 Bacteria 2008
9 Ga0070658_10359041 3300005327 Bacteria 1248
10 Ga0070666_10043725 3300005335 Bacteria 3000
11 Ga0070680_100018590 3300005336 Bacteria 5494
12 Ga0070680_100024405 3300005336 Bacteria 4830
13 Ga0068868_100338888 3300005338 Bacteria 1285
14 Ga0070660_100017471 3300005339 Bacteria 5230
15 Ga0070691_10012153 3300005341 Bacteria 3942
16 Ga0070661_100019419 3300005344 Bacteria 4844
17 Ga0070661_100212652 3300005344 Bacteria 1481
18 Ga0070661_100302410 3300005344 Bacteria 1246
19 Ga0070668_100088727 3300005347 Bacteria 2435
20 Ga0070675_100011153 3300005354 Bacteria 7031
21 Ga0070671_100052775 3300005355 Bacteria 3380
22 Ga0070671_100066884 3300005355 Bacteria 2995
23 Ga0070671_100150309 3300005355 Bacteria 1966
24 Ga0070671_100150940 3300005355 Bacteria 1962
25 Ga0070673_100030515 3300005364 Bacteria 4036
26 Ga0070673_100151520 3300005364 Bacteria 1964
27 Ga0070673_100152484 3300005364 Bacteria 1958
28 Ga0070659_100003694 3300005366 Bacteria 10914
29 Ga0070659_100197220 3300005366 Bacteria 1656
30 Ga0070667_100089450 3300005367 Bacteria 2645
31 Ga0070667_100161005 3300005367 Bacteria 1977
32 Ga0070663_100164416 3300005455 Bacteria 1710
33 Ga0070663_100283394 3300005455 Bacteria 1321
34 Ga0070662_100195180 3300005457 Bacteria 1603
35 Ga0070662_100341515 3300005457 Bacteria 1225
36 Ga0070681_10076859 3300005458 Bacteria 3296
37 Ga0070679_100091156 3300005530 Bacteria 3036
38 Ga0070679_100212135 3300005530 Bacteria 1900
39 Ga0070679_100255321 3300005530 Bacteria 1708
40 Ga0070684_100162949 3300005535 Bacteria 2023
41 Ga0068853_100016295 3300005539 Bacteria 6114
42 Ga0068853_100029958 3300005539 Bacteria 4593
43 Ga0068853_100078951 3300005539 Bacteria 2877
44 Ga0070672_100041832 3300005543 Bacteria 3526
45 Ga0070672_100057382 3300005543 Bacteria 3056
46 Ga0070672_100067420 3300005543 Bacteria 2836
47 Ga0070665_100000257 3300005548 Bacteria 87607
48 Ga0070665_100088868 3300005548 Bacteria 3095
49 Ga0068855_100036674 3300005563 Bacteria 5833
50 Ga0070664_100034347 3300005564 Bacteria 4254
51 Ga0068854_100042398 3300005578 Bacteria 3221
52 Ga0068856_100186792 3300005614 Bacteria 2086
53 Ga0068856_100303421 3300005614 Bacteria 1615
54 Ga0068852_100004015 3300005616 Bacteria 10348
55 Ga0068864_100367318 3300005618 Bacteria 1361
56 Ga0068861_100192171 3300005719 Bacteria 1707
57 Ga0068858_100167043 3300005842 Bacteria 2074
58 Ga0081455_10020263 3300005937 Bacteria 6268
59 Ga0070712_100299958 3300006175 Bacteria 1300
60 Ga0097621_100061665 3300006237 Bacteria 3076
61 Ga0075433_10071799 3300006852 Bacteria 3043
62 Ga0075434_100012771 3300006871 Bacteria 7971
63 Ga0105240_10387088 3300009093 Bacteria 1578
64 Ga0105241_10115581 3300009174 Bacteria 2154
65 Ga0105248_10031150 3300009177 Bacteria 5961
66 Ga0105238_10019680 3300009551 Bacteria 6873
67 Ga0157373_10010625 3300013100 Bacteria 6773
68 Ga0157371_10013817 3300013102 Bacteria 6117
69 Ga0157370_10003802 3300013104 Bacteria 17612
70 Ga0157374_10083224 3300013296 Bacteria 3040
71 Ga0157378_10136956 3300013297 Bacteria 2270
72 Ga0163162_10203943 3300013306 Bacteria 2107
73 Ga0157372_10078310 3300013307 Bacteria 3735
74 Ga0157375_10003100 3300013308 Bacteria 14434
75 Ga0157375_10091387 3300013308 Bacteria 3106
76 Ga0157375_10196485 3300013308 Bacteria 2172
77 Ga0163161_10000765 3300017792 Bacteria 25300
78 Ga0213876_10000714 3300021384 Bacteria 23269
79 Ga0207680_10010385 3300025903 Bacteria 4656
80 Ga0207680_10211518 3300025903 Bacteria 1326
81 Ga0207647_10037765 3300025904 Bacteria 3059
82 Ga0207705_10008021 3300025909 Bacteria 7742
83 Ga0207705_10025383 3300025909 Bacteria 4230
84 Ga0207705_10034864 3300025909 Bacteria 3599
85 Ga0207705_10051802 3300025909 Unclassified 2954
86 Ga0207705_10125046 3300025909 Bacteria 1911
87 Ga0207695_10020119 3300025913 Bacteria 7657
88 Ga0207671_10019877 3300025914 Bacteria 5125
89 Ga0207660_10020278 3300025917 Bacteria 4457
90 Ga0207660_10148571 3300025917 Bacteria 1798
91 Ga0207657_10007988 3300025919 Bacteria 10787
92 Ga0207657_10030637 3300025919 Bacteria 4881
93 Ga0207657_10054444 3300025919 Bacteria 3460
94 Ga0207649_10023080 3300025920 Bacteria 3600
95 Ga0207649_10024630 3300025920 Bacteria 3501
96 Ga0207652_10037701 3300025921 Bacteria 4092
97 Ga0207694_10020139 3300025924 Bacteria 5045
98 Ga0207659_10015015 3300025926 Bacteria 5008
99 Ga0207664_10269302 3300025929 Bacteria 1492
100 Ga0207644_10001043 3300025931 Bacteria 17777
101 Ga0207644_10014626 3300025931 Bacteria 5255
102 Ga0207644_10060953 3300025931 Bacteria 2731
103 Ga0207644_10073866 3300025931 Bacteria 2501
104 Ga0207644_10121466 3300025931 Bacteria 1989
105 Ga0207690_10016647 3300025932 Bacteria 4479
106 Ga0207690_10069876 3300025932 Bacteria 2417
107 Ga0207690_10364813 3300025932 Bacteria 1145
108 Ga0207706_10198559 3300025933 Bacteria 1759
109 Ga0207691_10035886 3300025940 Bacteria 4597
110 Ga0207691_10059439 3300025940 Bacteria 3475
111 Ga0207691_10068077 3300025940 Bacteria 3217
112 Ga0207679_10031391 3300025945 Bacteria 3718
113 Ga0207667_10069067 3300025949 Bacteria 3678
114 Ga0207651_10135097 3300025960 Bacteria 1895
115 Ga0207640_10128597 3300025981 Bacteria 1827
116 Ga0207658_10034265 3300025986 Bacteria 3628
117 Ga0207658_10173830 3300025986 Bacteria 1777
118 Ga0207703_10143132 3300026035 Bacteria 2077
119 Ga0207639_10008812 3300026041 Bacteria 6934
120 Ga0207639_10022305 3300026041 Bacteria 4559
121 Ga0207639_10032700 3300026041 Bacteria 3831
122 Ga0207702_10215168 3300026078 Bacteria 1788
123 Ga0207676_10448191 3300026095 Bacteria 1216
124 Ga0207674_10040922 3300026116 Bacteria 4796
125 Ga0207683_10050188 3300026121 Bacteria 3654
126 Ga0207698_10007504 3300026142 Bacteria 6834
127 Ga0207698_10017020 3300026142 Bacteria 4920
128 Ga0268266_10030755 3300028379 Bacteria 4560
129 Ga0268264_10100080 3300028381 Bacteria 2517
130 Ga0316182_1039278 3300030745 Bacteria 2024
131 Ga0307405_10193297 3300031731 Bacteria 1471
132 Ga0307413_10065656 3300031824 Bacteria 2260
133 Ga0307406_10270600 3300031901 Bacteria 1290
134 Ga0307412_10011871 3300031911 Bacteria 5059
135 Ga0307416_100020302 3300032002 Bacteria 4737
136 Ga0307414_10005577 3300032004 Bacteria 6941
137 Ga0307411_10105265 3300032005 Bacteria 2005
138 Ga0307415_100069759 3300032126 Bacteria 2466
139 Ga0373925_0056651 3300037068 Bacteria 2936
140 Ga0395899_0133823 3300037312 Bacteria 1768
141 Ga0395899_0171730 3300037312 Bacteria 1526
142 Ga0395900_0076928 3300037418 Bacteria 3428
143 Ga0395900_0372534 3300037418 Bacteria 1397
144 Ga0395900_0389239 3300037418 Bacteria 1360
145 Ga0395900_0673035 3300037418 Bacteria 970
146 Ga0395898_0137903 3300037466 Bacteria 2335
147 Ga0395898_0143464 3300037466 Bacteria 2286
148 Ga0395905_0067411 3300037471 Bacteria 3352
149 Ga0395905_0077131 3300037471 Bacteria 3122
150 Ga0395901_0014711 3300038443 Bacteria 7951
151 Ga0395901_0266466 3300038443 Bacteria 1782
152 Ga0395901_0281278 3300038443 Bacteria 1729
153 Ga0395901_0328470 3300038443 Bacteria 1581
154 Ga0436365_1878803 3300039437 Bacteria 14035
155 Ga0466965_0291959 3300044683 Bacteria 883
156 Ga0466966_0280030 3300044684 Bacteria 1003
157 Ga0466961_0226516 3300044693 Bacteria 1151
158 Ga0466963_0003194 3300044694 Bacteria 9315
159 Ga0466963_0016310 3300044694 Bacteria 4617
160 Ga0466963_0035821 3300044694 Bacteria 3233
161 Ga0466963_0142077 3300044694 Bacteria 1663
162 Ga0466964_0054440 3300044706 Unclassified 1649
163 Ga0466971_0001995 3300044719 Bacteria 8645
164 Ga0466971_0154887 3300044719 Bacteria 1071
165 Ga0466957_0000196 3300044842 Bacteria 27913
166 Ga0466957_0006782 3300044842 Bacteria 6471
167 Ga0466957_0026574 3300044842 Bacteria 3435
168 Ga0466959_0067129 3300045049 Bacteria 2601
169 Ga0466959_0163623 3300045049 Bacteria 1563
170 Ga0466958_0001871 3300045836 Bacteria 10283
171 Ga0466958_0054571 3300045836 Bacteria 2424
172 Ga0466958_0154703 3300045836 Bacteria 1447
173 Ga0466967_0003640 3300045976 Bacteria 10132
174 Ga0466967_0012946 3300045976 Bacteria 6416
175 Ga0466967_0019091 3300045976 Bacteria 5503
176 Ga0466967_0029292 3300045976 Bacteria 4606
177 Ga0466967_0040597 3300045976 Bacteria 4007
178 Ga0466967_0071056 3300045976 Bacteria 3115
179 Ga0466967_0095729 3300045976 Bacteria 2707
180 Ga0466967_0489427 3300045976 Bacteria 1206
181 Ga0466967_0543925 3300045976 Bacteria 1143
182 Ga0466967_0632420 3300045976 Bacteria 1057
183 Ga0495588_0055736 3300046674 Bacteria 2040
184 Ga0495658_0064379 3300046683 Bacteria 2112
185 Ga0495593_0114125 3300047673 Bacteria 1378
186 Ga0496102_0234254 3300048905 Bacteria 1731
187 Ga0496108_0416058 3300048911 Bacteria 1174
188 Ga0496114_0006559 3300048917 Bacteria 9178
189 Ga0501032_0052214 3300049569 Bacteria 2755
190 Ga0501034_0006562 3300049571 Bacteria 12495
191 Ga0501036_0147297 3300049572 Bacteria 1986
192 Ga0501037_0010230 3300049573 Bacteria 6884
193 Ga0501038_0033901 3300049574 Bacteria 4492
194 Ga0501039_0173502 3300049575 Bacteria 1695
195 Ga0501043_0003492 3300049579 Bacteria 12918
196 Ga0501047_0001491 3300049581 Bacteria 22816
197 Ga0501047_0082448 3300049581 Bacteria 3091
198 Ga0501067_0105985 3300049583 Bacteria 1562
199 Ga0501068_0026247 3300049584 Bacteria 3431
200 Ga0501074_0037036 3300049590 Bacteria 3536
201 Ga0501080_0000746 3300049742 Bacteria 26303
202 Ga0501083_0004609 3300049744 Bacteria 9740
203 Ga0501083_0141982 3300049744 Bacteria 1573
204 Ga0501044_0011611 3300049823 Bacteria 9545
205 nmdc:mga06z11_122985_c1 3300050494 Bacteria 1449
206 nmdc:mga0a205_78559_c1 3300050515 Bacteria 3188
207 Ga0500595_036359 3300053119 Bacteria 1613
208 Ga0501082_0123346 3300060353 Bacteria 2246
209 Ga0466962_0067866 3300061719 Bacteria 1703
210 2885429388 2885427238 Bacteria 2291351
211 Ga0373927_0050733
212 JGI24741J21665_1004376
213 JGI24740J21852_10006860
214 JGI24735J21928_10012148
215 Ga0070658_10008898
216 Ga0070658_10057029
217 Ga0070658_10134730
218 Ga0070658_10141856
219 Ga0070658_10359041
220 Ga0070666_10043725
221 Ga0070680_100018590
222 Ga0070680_100024405
223 Ga0068868_100338888
224 Ga0070660_100017471
225 Ga0070691_10012153
226 Ga0070661_100019419
227 Ga0070661_100212652
228 Ga0070661_100302410
229 Ga0070668_100088727
230 Ga0070675_100011153
231 Ga0070671_100052775
232 Ga0070671_100066884
233 Ga0070671_100150309
234 Ga0070671_100150940
235 Ga0070673_100030515
236 Ga0070673_100151520
237 Ga0070673_100152484
238 Ga0070659_100003694
239 Ga0070659_100197220
240 Ga0070667_100089450
241 Ga0070667_100161005
242 Ga0070663_100164416
243 Ga0070663_100283394
244 Ga0070662_100195180
245 Ga0070662_100341515
246 Ga0070681_10076859
247 Ga0070679_100091156
248 Ga0070679_100212135
249 Ga0070679_100255321
250 Ga0070684_100162949
251 Ga0068853_100016295
252 Ga0068853_100029958
253 Ga0068853_100078951
254 Ga0070672_100041832
255 Ga0070672_100057382
256 Ga0070672_100067420
257 Ga0070665_100000257
258 Ga0070665_100088868
259 Ga0068855_100036674
260 Ga0070664_100034347
261 Ga0068854_100042398
262 Ga0068856_100186792
263 Ga0068856_100303421
264 Ga0068852_100004015
265 Ga0068864_100367318
266 Ga0068861_100192171
267 Ga0068858_100167043
268 Ga0081455_10020263
269 Ga0070712_100299958
270 Ga0097621_100061665
271 Ga0075433_10071799
272 Ga0075434_100012771
273 Ga0105240_10387088
274 Ga0105241_10115581
275 Ga0105248_10031150
276 Ga0105238_10019680
277 Ga0157373_10010625
278 Ga0157371_10013817
279 Ga0157370_10003802
280 Ga0157374_10083224
281 Ga0157378_10136956
282 Ga0163162_10203943
283 Ga0157372_10078310
284 Ga0157375_10003100
285 Ga0157375_10091387
286 Ga0157375_10196485
287 Ga0163161_10000765
288 Ga0213876_10000714
289 Ga0207680_10010385
290 Ga0207680_10211518
291 Ga0207647_10037765
292 Ga0207705_10008021
293 Ga0207705_10025383
294 Ga0207705_10034864
295 Ga0207705_10051802
296 Ga0207705_10125046
297 Ga0207695_10020119
298 Ga0207671_10019877
299 Ga0207660_10020278
300 Ga0207660_10148571
301 Ga0207657_10007988
302 Ga0207657_10030637
303 Ga0207657_10054444
304 Ga0207649_10023080
305 Ga0207649_10024630
306 Ga0207652_10037701
307 Ga0207694_10020139
308 Ga0207659_10015015
309 Ga0207664_10269302
310 Ga0207644_10001043
311 Ga0207644_10014626
312 Ga0207644_10060953
313 Ga0207644_10073866
314 Ga0207644_10121466
315 Ga0207690_10016647
316 Ga0207690_10069876
317 Ga0207690_10364813
318 Ga0207706_10198559
319 Ga0207691_10035886
320 Ga0207691_10059439
321 Ga0207691_10068077
322 Ga0207679_10031391
323 Ga0207667_10069067
324 Ga0207651_10135097
325 Ga0207640_10128597
326 Ga0207658_10034265
327 Ga0207658_10173830
328 Ga0207703_10143132
329 Ga0207639_10008812
330 Ga0207639_10022305
331 Ga0207639_10032700
332 Ga0207702_10215168
333 Ga0207676_10448191
334 Ga0207674_10040922
335 Ga0207683_10050188
336 Ga0207698_10007504
337 Ga0207698_10017020
338 Ga0268266_10030755
339 Ga0268264_10100080
340 Ga0316182_1039278
341 Ga0307405_10193297
342 Ga0307413_10065656
343 Ga0307406_10270600
344 Ga0307412_10011871
345 Ga0307416_100020302
346 Ga0307414_10005577
347 Ga0307411_10105265
348 Ga0307415_100069759
349 Ga0373925_0056651
350 Ga0395899_0133823
351 Ga0395899_0171730
352 Ga0395900_0076928
353 Ga0395900_0372534
354 Ga0395900_0389239
355 Ga0395900_0673035
356 Ga0395898_0137903
357 Ga0395898_0143464
358 Ga0395905_0067411
359 Ga0395905_0077131
360 Ga0395901_0014711
361 Ga0395901_0266466
362 Ga0395901_0281278
363 Ga0395901_0328470
364 Ga0436365_1878803
365 Ga0466965_0291959
366 Ga0466966_0280030
367 Ga0466961_0226516
368 Ga0466963_0003194
369 Ga0466963_0016310
370 Ga0466963_0035821
371 Ga0466963_0142077
372 Ga0466964_0054440
373 Ga0466971_0001995
374 Ga0466971_0154887
375 Ga0466957_0000196
376 Ga0466957_0006782
377 Ga0466957_0026574
378 Ga0466959_0067129
379 Ga0466959_0163623
380 Ga0466958_0001871
381 Ga0466958_0054571
382 Ga0466958_0154703
383 Ga0466967_0003640
384 Ga0466967_0012946
385 Ga0466967_0019091
386 Ga0466967_0029292
387 Ga0466967_0040597
388 Ga0466967_0071056
389 Ga0466967_0095729
390 Ga0466967_0489427
391 Ga0466967_0543925
392 Ga0466967_0632420
393 Ga0495588_0055736
394 Ga0495658_0064379
395 Ga0495593_0114125
396 Ga0496102_0234254
397 Ga0496108_0416058
398 Ga0496114_0006559
399 Ga0501032_0052214
400 Ga0501034_0006562
401 Ga0501036_0147297
402 Ga0501037_0010230
403 Ga0501038_0033901
404 Ga0501039_0173502
405 Ga0501043_0003492
406 Ga0501047_0001491
407 Ga0501047_0082448
408 Ga0501067_0105985
409 Ga0501068_0026247
410 Ga0501074_0037036
411 Ga0501080_0000746
412 Ga0501083_0004609
413 Ga0501083_0141982
414 Ga0501044_0011611
415 nmdc:mga06z11_122985_c1
416 nmdc:mga0a205_78559_c1
417 Ga0500595_036359
418 Ga0501082_0123346
419 Ga0466962_0067866
420 2885429388

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12146

Hydrolase_4

Serine aminopeptidase, S33

82

218

0.85

PF00561

Abhydrolase_1

alpha/beta hydrolase fold

65

212

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
7wwh-assembly2.cif.gz_B crystal structure of the geobacillus thermoglucosidasius feruloyl esterase gthfae 0.7708 16 306
3trd-assembly1.cif.gz_A structure of an alpha-beta serine hydrolase homologue from coxiella burnetii 0.7672 16 272
3bdi-assembly1.cif.gz_A crystal structure of predicted cib-like hydrolase (np_393672.1) from thermoplasma acidophilum at 1.45 a resolution 0.7651 13 307
7wwh-assembly2.cif.gz_B crystal structure of the geobacillus thermoglucosidasius feruloyl esterase gthfae 0.7624 16 306
7xrh-assembly1.cif.gz_B feruloyl esterase from lactobacillus acidophilus 0.7609 14 308
ID Description Score Start End Superfamily
af_P9WLC7_41_273_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8133 14 305 3.40.50.1820
af_Q7L211_70_310_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7984 13 270 3.40.50.1820
af_P77538_37_280_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7814 15 283 3.40.50.1820
af_Q9XVA7_129_350_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7761 40 308 3.40.50.1820
af_Q0DRS5_1_166_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7745 110 305 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A6D0EKM1-F1-model_v4 deleted 0.9577 177 308
AF-A0A149STI5-F1-model_v4 deleted 0.9576 20 307
AF-A0A0K8P3H9-F1-model_v4 Serine aminopeptidase S33 domain-containing protein 0.9569 13 308 GO:0052689
AF-A0A4Q3LWH7-F1-model_v4 deleted 0.9569 48 307
AF-A0A6P2V5T5-F1-model_v4 Hydrolase 0.9553 32 308 GO:0052689

Map