F320524

General Info

Members Datasets Scaffolds Average Seq Length
210 151 420 291

Family's Representative Sequence

Representative Sequence 3300031456|Ga0307513_10143783|Ga0307513_101437833
Length 309
Sequence MTAPDSPELNRSSAETMKRIFLLIATNVAIMLVLSIVVSALGFDRYLTKEGLNLQALLAFSAVLGFGGAFISLFISKWMAKSAMGVRVITEPRNETEQWLVNTVRSQAQTAGIGMPEVGIFDSPDPNAFATGANKNSALVAVSTGLLAGMRRDEVEAVLGHEVSHVANGDMVTLTLIQGVMNTFVFFLARVIGFVVDRVILKNERGAGIGYMLTVIVAQIVLGILAGMIVAWFSRKREFRADAGGAHLAGTTSMVGALEALKRAVQAPTALPEKMQAFGIRSGPPAGWQRLFMSHPPLEERIAALNNAR

Samples

Sample ID Description Type Environment
1 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
2 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
3 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
4 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
5 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
6 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
7 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
8 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
9 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
10 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
11 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
12 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
13 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
14 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
15 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
16 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
17 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
18 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
19 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
20 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
21 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
22 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
23 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
24 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
25 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
26 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
27 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
28 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
29 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
30 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
31 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
32 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
33 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
34 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
35 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
36 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
38 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
39 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
40 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
41 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
42 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
59 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
61 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
63 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
64 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
65 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
66 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
67 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
68 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
69 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
70 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
71 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
72 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
73 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
74 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
75 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
76 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
77 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
78 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
79 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
80 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
81 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
82 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
83 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
84 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
85 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
86 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
87 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
88 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
89 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
90 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
91 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
92 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
93 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
94 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
95 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
96 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
97 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
98 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
99 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
100 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
101 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
102 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
103 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
104 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
105 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
106 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
107 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
108 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
109 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
110 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
111 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
112 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
113 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
114 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
115 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
116 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
117 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
118 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
119 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
120 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
121 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
122 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
123 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
124 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
125 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
126 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
127 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
128 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
129 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
130 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
131 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
132 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
133 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
134 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
135 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
136 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
137 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
138 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
139 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
140 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
141 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
142 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
143 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
144 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
145 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
146 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
147 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
148 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
149 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
150 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
151 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.86
Rhizosphere 95.24
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307513_10143783 3300031456 Bacteria 2307
2 Ga0070670_100125546 3300005331 Bacteria 2215
3 Ga0070669_100380615 3300005353 Bacteria 1151
4 Ga0070675_100106440 3300005354 Bacteria 2368
5 Ga0070675_100140365 3300005354 Bacteria 2065
6 Ga0070688_100069460 3300005365 Bacteria 2249
7 Ga0070701_10070144 3300005438 Bacteria 1872
8 Ga0070711_100093863 3300005439 Bacteria 2168
9 Ga0070711_100329496 3300005439 Bacteria 1222
10 Ga0070678_100494804 3300005456 Bacteria 1078
11 Ga0070706_100494141 3300005467 Bacteria 1139
12 Ga0070698_100019059 3300005471 Bacteria 7215
13 Ga0070699_100104575 3300005518 Bacteria 2483
14 Ga0070672_100372147 3300005543 Bacteria 1221
15 Ga0070686_100076256 3300005544 Bacteria 2207
16 Ga0070695_100194210 3300005545 Bacteria 1447
17 Ga0070665_100003982 3300005548 Bacteria 15579
18 Ga0070665_100269525 3300005548 Bacteria 1704
19 Ga0070704_100001577 3300005549 Bacteria 12306
20 Ga0070704_100016425 3300005549 Bacteria 4677
21 Ga0070704_100051497 3300005549 Bacteria 2900
22 Ga0068856_100408201 3300005614 Bacteria 1378
23 Ga0068852_100029109 3300005616 Bacteria 4532
24 Ga0068859_100082998 3300005617 Bacteria 3247
25 Ga0068861_100024092 3300005719 Bacteria 4398
26 Ga0068858_100213598 3300005842 Bacteria 1826
27 Ga0068862_100323530 3300005844 Bacteria 1424
28 Ga0081455_10005361 3300005937 Bacteria 14079
29 Ga0070716_100019654 3300006173 Bacteria 3533
30 Ga0075428_100018506 3300006844 Bacteria 7702
31 Ga0075428_100176548 3300006844 Bacteria 2313
32 Ga0075431_100033260 3300006847 Bacteria 5314
33 Ga0075433_10213945 3300006852 Bacteria 1713
34 Ga0075434_100000249 3300006871 Bacteria 37720
35 Ga0075434_100168559 3300006871 Bacteria 2210
36 Ga0075434_100425830 3300006871 Bacteria 1348
37 Ga0075429_100005187 3300006880 Bacteria 11204
38 Ga0075436_100000589 3300006914 Bacteria 23780
39 Ga0075436_100027249 3300006914 Bacteria 3934
40 Ga0097620_100082999 3300006931 Bacteria 3247
41 Ga0075435_100052670 3300007076 Bacteria 3279
42 Ga0075435_100434646 3300007076 Bacteria 1131
43 Ga0099794_10008799 3300007265 Bacteria 4207
44 Ga0099794_10026508 3300007265 Bacteria 2679
45 Ga0111539_10228274 3300009094 Bacteria 2168
46 Ga0105245_10169967 3300009098 Bacteria 2075
47 Ga0105245_10426325 3300009098 Bacteria 1330
48 Ga0114129_10003720 3300009147 Bacteria 21501
49 Ga0105243_10341678 3300009148 Bacteria 1371
50 Ga0157370_10351891 3300013104 Bacteria 1358
51 Ga0157380_10475889 3300014326 Bacteria 1207
52 Ga0182006_1008867 3300015261 Bacteria 4539
53 Ga0213872_10001843 3300021361 Bacteria 13133
54 Ga0207684_10483498 3300025910 Bacteria 1062
55 Ga0207663_10370909 3300025916 Bacteria 1088
56 Ga0207660_10293688 3300025917 Bacteria 1293
57 Ga0207662_10064231 3300025918 Bacteria 2208
58 Ga0207650_10057870 3300025925 Bacteria 2884
59 Ga0207687_10213497 3300025927 Bacteria 1515
60 Ga0207700_10114661 3300025928 Bacteria 2174
61 Ga0207706_10247234 3300025933 Bacteria 1558
62 Ga0207706_10553411 3300025933 Bacteria 990
63 Ga0207709_10302879 3300025935 Bacteria 1189
64 Ga0207665_10032610 3300025939 Bacteria 3449
65 Ga0207691_10088238 3300025940 Bacteria 2782
66 Ga0207691_10237110 3300025940 Bacteria 1578
67 Ga0207703_10220849 3300026035 Bacteria 1694
68 Ga0207702_10354808 3300026078 Bacteria 1404
69 Ga0207674_10522919 3300026116 Bacteria 1146
70 Ga0207675_100147214 3300026118 Bacteria 2240
71 Ga0207675_100189044 3300026118 Bacteria 1974
72 Ga0207675_100638445 3300026118 Bacteria 1070
73 Ga0207698_10313533 3300026142 Bacteria 1466
74 Ga0209996_1001437 3300027395 Bacteria 2872
75 Ga0209588_1033025 3300027671 Bacteria 1659
76 Ga0209588_1074858 3300027671 Bacteria 1094
77 Ga0209974_10028196 3300027876 Bacteria 1859
78 Ga0268265_10152530 3300028380 Bacteria 1951
79 Ga0307515_10118491 3300028794 Bacteria 3021
80 Ga0265340_10098163 3300031247 Bacteria 1363
81 Ga0265339_10068657 3300031249 Bacteria 1893
82 Ga0307513_10004214 3300031456 Bacteria 19230
83 Ga0307408_100504681 3300031548 Bacteria 1059
84 Ga0316575_10058903 3300031665 Bacteria 1532
85 Ga0316579_10001428 3300031691 Bacteria 8668
86 Ga0316579_10050477 3300031691 Bacteria 1945
87 Ga0316579_10076805 3300031691 Bacteria 1587
88 Ga0307405_10088402 3300031731 Bacteria 2044
89 Ga0316577_10111983 3300031733 Bacteria 1531
90 Ga0307413_10001296 3300031824 Bacteria 9329
91 Ga0307410_10010802 3300031852 Bacteria 5195
92 Ga0307410_10012801 3300031852 Bacteria 4868
93 Ga0307406_10034361 3300031901 Bacteria 3110
94 Ga0307407_10005616 3300031903 Bacteria 5466
95 Ga0307407_10035695 3300031903 Bacteria 2733
96 Ga0307407_10252531 3300031903 Bacteria 1209
97 Ga0307409_100007664 3300031995 Bacteria 6479
98 Ga0307416_100115978 3300032002 Bacteria 2373
99 Ga0307416_100375154 3300032002 Bacteria 1450
100 Ga0307416_100504038 3300032002 Bacteria 1275
101 Ga0307411_10002298 3300032005 Bacteria 8376
102 Ga0307411_10014901 3300032005 Bacteria 4344
103 Ga0307415_100017131 3300032126 Bacteria 4338
104 Ga0307415_100188815 3300032126 Bacteria 1624
105 Ga0307415_100261777 3300032126 Bacteria 1412
106 Ga0307415_100323459 3300032126 Bacteria 1287
107 Ga0316585_10009726 3300032137 Bacteria 2813
108 Ga0316580_10037733 3300032139 Bacteria 1494
109 Ga0373934_0003735 3300035086 Bacteria 5606
110 Ga0373934_0077067 3300035086 Bacteria 1337
111 Ga0373954_0017866 3300035118 Bacteria 3189
112 Ga0373956_0002095 3300035119 Bacteria 8264
113 Ga0373957_0001704 3300035120 Bacteria 6031
114 Ga0373957_0030963 3300035120 Bacteria 1963
115 Ga0373957_0052050 3300035120 Bacteria 1567
116 Ga0373946_0142917 3300035171 Bacteria 1111
117 Ga0316574_0006434 3300035398 Bacteria 6351
118 Ga0316574_0010759 3300035398 Bacteria 5180
119 Ga0373924_0071686 3300035410 Bacteria 1462
120 Ga0373935_0081640 3300035692 Bacteria 2102
121 Ga0373933_0014583 3300035724 Bacteria 4374
122 Ga0373933_0058066 3300035724 Bacteria 2326
123 Ga0373937_0002340 3300036401 Bacteria 15799
124 Ga0373937_0040502 3300036401 Bacteria 4246
125 Ga0373937_0092024 3300036401 Bacteria 2810
126 Ga0373937_0163433 3300036401 Bacteria 2087
127 Ga0373937_0341655 3300036401 Bacteria 1418
128 Ga0316584_0047844 3300036712 Bacteria 3195
129 Ga0316584_0133314 3300036712 Bacteria 1855
130 Ga0316581_0012209 3300037588 Bacteria 2415
131 Ga0316581_0018474 3300037588 Bacteria 2025
132 Ga0436365_0396606 3300039437 Bacteria 7813
133 Ga0436361_0006214 3300039447 Bacteria 2277
134 Ga0451791_1607855 3300041451 Bacteria 1751
135 Ga0451793_1440788 3300041452 Bacteria 1353
136 Ga0451802_0418159 3300041460 Bacteria 2333
137 Ga0451807_0527046 3300041486 Bacteria 2189
138 Ga0451807_1954418 3300041486 Bacteria 1631
139 Ga0451577_0000149 3300042876 Bacteria 155208
140 Ga0451577_0020607 3300042876 Bacteria 6047
141 Ga0451577_0021692 3300042876 Bacteria 5873
142 Ga0466963_0128643 3300044694 Bacteria 1748
143 Ga0453684_0000975 3300044712 Bacteria 94109
144 Ga0453684_0211972 3300044712 Bacteria 2251
145 Ga0451576_0001151 3300045051 Bacteria 47740
146 Ga0466967_0025970 3300045976 Bacteria 4841
147 Ga0495592_0004201 3300046454 Bacteria 10519
148 Ga0495592_0044716 3300046454 Bacteria 3307
149 Ga0495592_0139449 3300046454 Bacteria 1688
150 Ga0495651_0013094 3300046462 Bacteria 6410
151 Ga0495651_0071617 3300046462 Bacteria 2635
152 Ga0495639_0003368 3300046475 Bacteria 6930
153 Ga0495608_0243970 3300046511 Bacteria 1121
154 Ga0495628_0020506 3300046516 Bacteria 5449
155 Ga0495628_0029131 3300046516 Bacteria 4480
156 Ga0495630_0032534 3300046517 Bacteria 3886
157 Ga0495652_0010869 3300046529 Bacteria 8248
158 Ga0495652_0204341 3300046529 Bacteria 1497
159 Ga0495665_0052189 3300046531 Bacteria 2165
160 Ga0495586_0018542 3300046535 Bacteria 3705
161 Ga0495586_0098913 3300046535 Bacteria 1617
162 Ga0495621_0045533 3300046539 Bacteria 1554
163 Ga0495645_0002874 3300046543 Bacteria 11693
164 Ga0495667_0032556 3300046559 Bacteria 3493
165 Ga0495667_0059242 3300046559 Bacteria 2513
166 Ga0495658_0021478 3300046683 Bacteria 3403
167 Ga0495636_0060219 3300047318 Bacteria 1604
168 Ga0495674_0058773 3300047319 Bacteria 3360
169 Ga0495675_0043747 3300047444 Bacteria 2853
170 Ga0495684_0037863 3300047471 Bacteria 3699
171 Ga0496115_0294358 3300048918 Bacteria 1331
172 Ga0501031_0280835 3300049568 Bacteria 1080
173 Ga0501034_0684771 3300049571 Bacteria 925
174 Ga0501036_0298846 3300049572 Bacteria 1347
175 Ga0501037_0019571 3300049573 Bacteria 4995
176 Ga0501039_0035452 3300049575 Bacteria 3850
177 Ga0501040_0138637 3300049576 Bacteria 1712
178 Ga0501041_0008291 3300049577 Bacteria 6114
179 Ga0501042_0063907 3300049578 Bacteria 2630
180 Ga0501043_0128897 3300049579 Bacteria 1983
181 Ga0501048_0028290 3300049582 Bacteria 4068
182 Ga0501071_0006382 3300049587 Bacteria 7652
183 Ga0501071_0314536 3300049587 Bacteria 1188
184 Ga0501072_0060853 3300049588 Bacteria 2977
185 Ga0501073_0070118 3300049589 Bacteria 2442
186 Ga0501074_0279794 3300049590 Bacteria 1186
187 Ga0501075_0001455 3300049591 Bacteria 15403
188 Ga0501075_0060086 3300049591 Bacteria 2864
189 Ga0501076_0028626 3300049592 Bacteria 4327
190 Ga0501076_0060386 3300049592 Bacteria 3016
191 Ga0501077_0021879 3300049593 Bacteria 4048
192 Ga0501079_0009752 3300049741 Bacteria 7283
193 Ga0501079_0441338 3300049741 Bacteria 1022
194 Ga0501081_0008155 3300049743 Bacteria 6798
195 Ga0501241_006650 3300049758 Bacteria 2124
196 Ga0501045_0000737 3300049824 Bacteria 20878
197 nmdc:mga05p37_2493_c1 3300050507 Bacteria 21412
198 nmdc:mga09592_838_c1 3300050508 Bacteria 23869
199 nmdc:mga06r32_26709_c1 3300050510 Bacteria 5387
200 nmdc:mga08y16_209122_c1 3300050511 Bacteria 2021
201 nmdc:mga0n895_1016_c1 3300050512 Bacteria 20401
202 nmdc:mga0n895_221046_c1 3300050512 Bacteria 1923
203 nmdc:mga0n895_91907_c1 3300050512 Bacteria 3037
204 nmdc:mga0rr50_440973_c1 3300050513 Bacteria 1103
205 nmdc:mga0rr50_906_c2 3300050513 Bacteria 4995
206 nmdc:mga08x19_21147_c1 3300050514 Bacteria 4012
207 nmdc:mga08x19_3016_c1 3300050514 Bacteria 10119
208 nmdc:mga0a205_218270_c1 3300050515 Bacteria 1793
209 Ga0495601_0003549 3300053077 Bacteria 8968
210 Ga0501082_0006515 3300060353 Bacteria 10125
211 Ga0307513_10143783
212 Ga0070670_100125546
213 Ga0070669_100380615
214 Ga0070675_100106440
215 Ga0070675_100140365
216 Ga0070688_100069460
217 Ga0070701_10070144
218 Ga0070711_100093863
219 Ga0070711_100329496
220 Ga0070678_100494804
221 Ga0070706_100494141
222 Ga0070698_100019059
223 Ga0070699_100104575
224 Ga0070672_100372147
225 Ga0070686_100076256
226 Ga0070695_100194210
227 Ga0070665_100003982
228 Ga0070665_100269525
229 Ga0070704_100001577
230 Ga0070704_100016425
231 Ga0070704_100051497
232 Ga0068856_100408201
233 Ga0068852_100029109
234 Ga0068859_100082998
235 Ga0068861_100024092
236 Ga0068858_100213598
237 Ga0068862_100323530
238 Ga0081455_10005361
239 Ga0070716_100019654
240 Ga0075428_100018506
241 Ga0075428_100176548
242 Ga0075431_100033260
243 Ga0075433_10213945
244 Ga0075434_100000249
245 Ga0075434_100168559
246 Ga0075434_100425830
247 Ga0075429_100005187
248 Ga0075436_100000589
249 Ga0075436_100027249
250 Ga0097620_100082999
251 Ga0075435_100052670
252 Ga0075435_100434646
253 Ga0099794_10008799
254 Ga0099794_10026508
255 Ga0111539_10228274
256 Ga0105245_10169967
257 Ga0105245_10426325
258 Ga0114129_10003720
259 Ga0105243_10341678
260 Ga0157370_10351891
261 Ga0157380_10475889
262 Ga0182006_1008867
263 Ga0213872_10001843
264 Ga0207684_10483498
265 Ga0207663_10370909
266 Ga0207660_10293688
267 Ga0207662_10064231
268 Ga0207650_10057870
269 Ga0207687_10213497
270 Ga0207700_10114661
271 Ga0207706_10247234
272 Ga0207706_10553411
273 Ga0207709_10302879
274 Ga0207665_10032610
275 Ga0207691_10088238
276 Ga0207691_10237110
277 Ga0207703_10220849
278 Ga0207702_10354808
279 Ga0207674_10522919
280 Ga0207675_100147214
281 Ga0207675_100189044
282 Ga0207675_100638445
283 Ga0207698_10313533
284 Ga0209996_1001437
285 Ga0209588_1033025
286 Ga0209588_1074858
287 Ga0209974_10028196
288 Ga0268265_10152530
289 Ga0307515_10118491
290 Ga0265340_10098163
291 Ga0265339_10068657
292 Ga0307513_10004214
293 Ga0307408_100504681
294 Ga0316575_10058903
295 Ga0316579_10001428
296 Ga0316579_10050477
297 Ga0316579_10076805
298 Ga0307405_10088402
299 Ga0316577_10111983
300 Ga0307413_10001296
301 Ga0307410_10010802
302 Ga0307410_10012801
303 Ga0307406_10034361
304 Ga0307407_10005616
305 Ga0307407_10035695
306 Ga0307407_10252531
307 Ga0307409_100007664
308 Ga0307416_100115978
309 Ga0307416_100375154
310 Ga0307416_100504038
311 Ga0307411_10002298
312 Ga0307411_10014901
313 Ga0307415_100017131
314 Ga0307415_100188815
315 Ga0307415_100261777
316 Ga0307415_100323459
317 Ga0316585_10009726
318 Ga0316580_10037733
319 Ga0373934_0003735
320 Ga0373934_0077067
321 Ga0373954_0017866
322 Ga0373956_0002095
323 Ga0373957_0001704
324 Ga0373957_0030963
325 Ga0373957_0052050
326 Ga0373946_0142917
327 Ga0316574_0006434
328 Ga0316574_0010759
329 Ga0373924_0071686
330 Ga0373935_0081640
331 Ga0373933_0014583
332 Ga0373933_0058066
333 Ga0373937_0002340
334 Ga0373937_0040502
335 Ga0373937_0092024
336 Ga0373937_0163433
337 Ga0373937_0341655
338 Ga0316584_0047844
339 Ga0316584_0133314
340 Ga0316581_0012209
341 Ga0316581_0018474
342 Ga0436365_0396606
343 Ga0436361_0006214
344 Ga0451791_1607855
345 Ga0451793_1440788
346 Ga0451802_0418159
347 Ga0451807_0527046
348 Ga0451807_1954418
349 Ga0451577_0000149
350 Ga0451577_0020607
351 Ga0451577_0021692
352 Ga0466963_0128643
353 Ga0453684_0000975
354 Ga0453684_0211972
355 Ga0451576_0001151
356 Ga0466967_0025970
357 Ga0495592_0004201
358 Ga0495592_0044716
359 Ga0495592_0139449
360 Ga0495651_0013094
361 Ga0495651_0071617
362 Ga0495639_0003368
363 Ga0495608_0243970
364 Ga0495628_0020506
365 Ga0495628_0029131
366 Ga0495630_0032534
367 Ga0495652_0010869
368 Ga0495652_0204341
369 Ga0495665_0052189
370 Ga0495586_0018542
371 Ga0495586_0098913
372 Ga0495621_0045533
373 Ga0495645_0002874
374 Ga0495667_0032556
375 Ga0495667_0059242
376 Ga0495658_0021478
377 Ga0495636_0060219
378 Ga0495674_0058773
379 Ga0495675_0043747
380 Ga0495684_0037863
381 Ga0496115_0294358
382 Ga0501031_0280835
383 Ga0501034_0684771
384 Ga0501036_0298846
385 Ga0501037_0019571
386 Ga0501039_0035452
387 Ga0501040_0138637
388 Ga0501041_0008291
389 Ga0501042_0063907
390 Ga0501043_0128897
391 Ga0501048_0028290
392 Ga0501071_0006382
393 Ga0501071_0314536
394 Ga0501072_0060853
395 Ga0501073_0070118
396 Ga0501074_0279794
397 Ga0501075_0001455
398 Ga0501075_0060086
399 Ga0501076_0028626
400 Ga0501076_0060386
401 Ga0501077_0021879
402 Ga0501079_0009752
403 Ga0501079_0441338
404 Ga0501081_0008155
405 Ga0501241_006650
406 Ga0501045_0000737
407 nmdc:mga05p37_2493_c1
408 nmdc:mga09592_838_c1
409 nmdc:mga06r32_26709_c1
410 nmdc:mga08y16_209122_c1
411 nmdc:mga0n895_1016_c1
412 nmdc:mga0n895_221046_c1
413 nmdc:mga0n895_91907_c1
414 nmdc:mga0rr50_440973_c1
415 nmdc:mga0rr50_906_c2
416 nmdc:mga08x19_21147_c1
417 nmdc:mga08x19_3016_c1
418 nmdc:mga0a205_218270_c1
419 Ga0495601_0003549
420 Ga0501082_0006515

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01435

Peptidase_M48

Peptidase family M48

94

309

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
3cqb-assembly1.cif.gz_B crystal structure of heat shock protein htpx domain from vibrio parahaemolyticus rimd 2210633 0.9386 63 152
3cqb-assembly1.cif.gz_A crystal structure of heat shock protein htpx domain from vibrio parahaemolyticus rimd 2210633 0.8646 64 153
3cqb-assembly1.cif.gz_B crystal structure of heat shock protein htpx domain from vibrio parahaemolyticus rimd 2210633 0.831 63 152
3cqb-assembly1.cif.gz_A crystal structure of heat shock protein htpx domain from vibrio parahaemolyticus rimd 2210633 0.75 64 153
2ypt-assembly4.cif.gz_E crystal structure of the human nuclear membrane zinc metalloprotease zmpste24 mutant (e336a) in complex with a synthetic csim tetrapeptide from the c-terminus of prelamin a 0.7322 43 290
ID Description Score Start End Superfamily
af_P23894_64_157_3.30.2010.10 "Alpha Beta;2-Layer Sandwich;Zincin-like;Metalloproteases (""zincins""), catalytic domain" 1.003 71 162 3.30.2010.10
af_P23894_64_157_3.30.2010.10 "Alpha Beta;2-Layer Sandwich;Zincin-like;Metalloproteases (""zincins""), catalytic domain" 0.9714 71 162 3.30.2010.10
3cqbA01 "Alpha Beta;2-Layer Sandwich;Zincin-like;Metalloproteases (""zincins""), catalytic domain" 0.9602 71 153 3.30.2010.10
3cqbA01 "Alpha Beta;2-Layer Sandwich;Zincin-like;Metalloproteases (""zincins""), catalytic domain" 0.884 71 153 3.30.2010.10
af_P9WHS5_62_152_3.30.2010.10 "Alpha Beta;2-Layer Sandwich;Zincin-like;Metalloproteases (""zincins""), catalytic domain" 0.8641 75 157 3.30.2010.10
ID Description Score Start End GO Terms
AF-A0A377CHR2-F1-model_v4 M48B family peptidase (EC 3.4.24.-) 0.9794 61 153 GO:0004222
GO:0005886
GO:0006508
GO:0046872
AF-A0A6I1IQ61-F1-model_v4 deleted 0.9791 45 176
AF-A0A524AY00-F1-model_v4 Protease HtpX (EC 3.4.24.-) 0.9585 82 290 GO:0004222
GO:0005886
GO:0006508
GO:0046872
AF-A0A6I1IQ61-F1-model_v4 deleted 0.9577 45 176
AF-A0A833KN15-F1-model_v4 deleted 0.9474 36 184

Map