F320465

General Info

Members Datasets Scaffolds Average Seq Length
210 140 210 136

Family's Representative Sequence

Representative Sequence 3300025960|Ga0207651_11295004|Ga0207651_112950042
Length 146
Sequence MAASVIVDAGFLVALLSRRDTHHRWARDTAARFPPPWRTCESVVSEAVLLLGTRRVSPLHALLRRRSLTLAFDLARELDPVLRLLEKYADVPMSLADACLVRMSEIDSEPMVLTTDSDFKVYRRHSRQVVPMGTAASRLSRSVPSA

Samples

Sample ID Description Type Environment
1 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
2 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
3 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
4 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
8 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
9 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
12 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
13 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
14 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
15 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
18 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
19 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
20 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
26 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
27 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
30 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
31 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
32 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
33 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
34 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
35 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
36 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
37 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
38 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
39 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
40 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
41 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
42 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
43 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
44 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
45 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
46 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
48 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
49 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
50 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
51 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
52 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
53 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
54 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
55 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
56 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
57 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
58 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
59 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
60 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
61 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
62 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
63 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
64 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
88 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
89 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
90 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
92 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
93 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
94 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
95 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
96 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
97 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
98 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
99 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
100 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
101 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
102 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
103 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
104 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
105 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
106 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
107 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
108 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
109 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
110 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
111 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
112 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
113 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
114 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
115 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
116 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
117 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
118 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
119 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
120 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
121 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
122 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
123 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
124 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
125 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
126 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
127 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
128 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
129 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
130 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
131 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
132 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
133 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
134 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
135 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
136 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
137 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
138 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
139 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
140 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.52
Metatranscriptomes 0.48
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.43
Rhizosphere 98.1
Stem 0
Stem Tuber 0
Unclassified 0.48

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065707_10002427 3300005295 Bacteria 9653
2 Ga0070690_100044611 3300005330 Bacteria 2815
3 Ga0068869_100350891 3300005334 Unclassified 1202
4 Ga0070666_10112422 3300005335 Bacteria 1884
5 Ga0070660_100288354 3300005339 Bacteria 1344
6 Ga0070689_101140210 3300005340 Unclassified 698
7 Ga0070687_100014129 3300005343 Bacteria 3579
8 Ga0070687_100256757 3300005343 Unclassified 1089
9 Ga0070659_100582525 3300005366 Bacteria 960
10 Ga0070703_10485632 3300005406 Unclassified 553
11 Ga0070714_100062800 3300005435 Bacteria 3192
12 Ga0070714_100095619 3300005435 Bacteria 2609
13 Ga0070711_100735859 3300005439 Unclassified 832
14 Ga0070711_101391257 3300005439 Unclassified 610
15 Ga0070705_100065280 3300005440 Bacteria 2178
16 Ga0070694_100001927 3300005444 Bacteria 12291
17 Ga0070708_100158268 3300005445 Unclassified 2110
18 Ga0070662_100748502 3300005457 Bacteria 829
19 Ga0070681_10709951 3300005458 Bacteria 921
20 Ga0070706_100035265 3300005467 Bacteria 4620
21 Ga0070707_100254211 3300005468 Unclassified 1710
22 Ga0070707_100304951 3300005468 Bacteria 1547
23 Ga0070698_100000968 3300005471 Bacteria 31507
24 Ga0070698_100017700 3300005471 Bacteria 7505
25 Ga0070698_100019982 3300005471 Bacteria 7023
26 Ga0070699_100043898 3300005518 Bacteria 3869
27 Ga0070699_100259387 3300005518 Bacteria 1554
28 Ga0070699_101637329 3300005518 Bacteria 590
29 Ga0070699_101752148 3300005518 Unclassified 569
30 Ga0070679_100934982 3300005530 Bacteria 811
31 Ga0070684_100329332 3300005535 Unclassified 1403
32 Ga0070697_100019650 3300005536 Bacteria 5336
33 Ga0070697_101322960 3300005536 Unclassified 643
34 Ga0068853_101212784 3300005539 Unclassified 729
35 Ga0070686_100000725 3300005544 Bacteria 19148
36 Ga0070696_100004755 3300005546 Bacteria 9069
37 Ga0070704_100014525 3300005549 Bacteria 4920
38 Ga0068855_101560193 3300005563 Unclassified 676
39 Ga0068857_100144582 3300005577 Unclassified 2151
40 Ga0068854_100014535 3300005578 Bacteria 5193
41 Ga0068859_102985503 3300005617 Bacteria 517
42 Ga0068866_11148042 3300005718 Unclassified 559
43 Ga0068858_100551043 3300005842 Unclassified 1116
44 Ga0081455_10298836 3300005937 Bacteria 1156
45 Ga0081538_10143917 3300005981 Bacteria 1093
46 Ga0075432_10073883 3300006058 Bacteria 1228
47 Ga0070715_10392348 3300006163 Bacteria 769
48 Ga0075427_10020688 3300006194 Unclassified 1044
49 Ga0075428_100276846 3300006844 Unclassified 1805
50 Ga0075430_100034388 3300006846 Bacteria 4301
51 Ga0075431_100049043 3300006847 Bacteria 4355
52 Ga0075431_100166726 3300006847 Bacteria 2264
53 Ga0075431_101490219 3300006847 Unclassified 635
54 Ga0075431_101726134 3300006847 Unclassified 583
55 Ga0075433_10084632 3300006852 Bacteria 2799
56 Ga0075433_10145061 3300006852 Unclassified 2110
57 Ga0075434_100016510 3300006871 Bacteria 7098
58 Ga0075434_100020608 3300006871 Bacteria 6398
59 Ga0075434_100185290 3300006871 Bacteria 2102
60 Ga0075434_100357462 3300006871 Bacteria 1481
61 Ga0075434_100652849 3300006871 Bacteria 1070
62 Ga0075434_100672930 3300006871 Unclassified 1053
63 Ga0075429_100240636 3300006880 Bacteria 1585
64 Ga0075436_100129670 3300006914 Bacteria 1768
65 Ga0075436_101206559 3300006914 Unclassified 571
66 Ga0097620_102986250 3300006931 Bacteria 517
67 Ga0075435_100000226 3300007076 Bacteria 34458
68 Ga0075435_100090753 3300007076 Bacteria 2520
69 Ga0075435_100145098 3300007076 Unclassified 1993
70 Ga0075435_100238153 3300007076 Bacteria 1547
71 Ga0075435_100774296 3300007076 Unclassified 835
72 Ga0099794_10475487 3300007265 Unclassified 656
73 Ga0099795_10265221 3300007788 Unclassified 745
74 Ga0105240_10173664 3300009093 Bacteria 2550
75 Ga0105243_10400586 3300009148 Bacteria 1275
76 Ga0105243_11198593 3300009148 Unclassified 772
77 Ga0105241_10036141 3300009174 Bacteria 3717
78 Ga0105241_10565313 3300009174 Bacteria 1023
79 Ga0105241_11710674 3300009174 Unclassified 611
80 Ga0105242_10163486 3300009176 Bacteria 1950
81 Ga0105238_10296606 3300009551 Unclassified 1600
82 Ga0105238_10700840 3300009551 Bacteria 1025
83 Ga0105249_11073565 3300009553 Unclassified 875
84 Ga0099796_10026656 3300010159 Bacteria 1838
85 Ga0099796_10044529 3300010159 Unclassified 1516
86 Ga0157370_10228971 3300013104 Unclassified 1721
87 Ga0157369_10901230 3300013105 Bacteria 907
88 Ga0157372_10340594 3300013307 Bacteria 1747
89 Ga0157375_10192558 3300013308 Unclassified 2194
90 Ga0163163_10430667 3300014325 Unclassified 1378
91 Ga0206353_11166583 3300020082 Unclassified 2042
92 Ga0213871_10204072 3300021441 Unclassified 617
93 Ga0207680_10183080 3300025903 Bacteria 1418
94 Ga0207685_10365075 3300025905 Unclassified 732
95 Ga0207684_10003334 3300025910 Bacteria 15758
96 Ga0207684_10089928 3300025910 Bacteria 2616
97 Ga0207684_10129998 3300025910 Unclassified 2161
98 Ga0207684_10413477 3300025910 Bacteria 1159
99 Ga0207654_11012925 3300025911 Unclassified 604
100 Ga0207693_10073231 3300025915 Bacteria 2682
101 Ga0207663_10230208 3300025916 Bacteria 1353
102 Ga0207662_10032493 3300025918 Bacteria 3039
103 Ga0207657_10347897 3300025919 Bacteria 1169
104 Ga0207652_10589419 3300025921 Unclassified 998
105 Ga0207646_10568871 3300025922 Bacteria 1018
106 Ga0207646_10937111 3300025922 Unclassified 767
107 Ga0207694_10679733 3300025924 Unclassified 868
108 Ga0207664_10018843 3300025929 Bacteria 5090
109 Ga0207664_10326220 3300025929 Unclassified 1355
110 Ga0207706_10775876 3300025933 Bacteria 815
111 Ga0207709_10390975 3300025935 Unclassified 1061
112 Ga0207709_10625949 3300025935 Bacteria 854
113 Ga0207709_10775540 3300025935 Unclassified 772
114 Ga0207704_10272949 3300025938 Bacteria 1281
115 Ga0207665_10078356 3300025939 Unclassified 2270
116 Ga0207661_10239123 3300025944 Unclassified 1611
117 Ga0207667_10369925 3300025949 Bacteria 1461
118 Ga0207667_11052275 3300025949 Bacteria 799
119 Ga0207651_11295004 3300025960 Unclassified 655
120 Ga0207640_10005422 3300025981 Bacteria 6952
121 Ga0207640_11672392 3300025981 Unclassified 574
122 Ga0207639_11249881 3300026041 Bacteria 697
123 Ga0207702_11152632 3300026078 Bacteria 769
124 Ga0207698_10885582 3300026142 Bacteria 899
125 Ga0209998_10021043 3300027717 Unclassified 1399
126 Ga0209974_10004997 3300027876 Bacteria 4689
127 Ga0207428_10314337 3300027907 Bacteria 1158
128 Ga0268264_10052642 3300028381 Bacteria 3395
129 Ga0268264_12534289 3300028381 Unclassified 518
130 Ga0265331_10019398 3300031250 Bacteria 3512
131 Ga0265327_10000969 3300031251 Bacteria 41053
132 Ga0307416_100430724 3300032002 Bacteria 1366
133 Ga0373954_0168088 3300035118 Unclassified 1074
134 Ga0373947_0151972 3300035725 Bacteria 1492
135 Ga0436363_1505054 3300039450 Unclassified 1221
136 Ga0439459_0064077 3300042438 Unclassified 836
137 Ga0451577_0594886 3300042876 Bacteria 1004
138 Ga0453683_0890976 3300044673 Unclassified 588
139 Ga0466957_1189985 3300044842 Bacteria 551
140 Ga0451576_0363759 3300045051 Bacteria 1515
141 Ga0451576_0414110 3300045051 Bacteria 1414
142 Ga0451576_1931293 3300045051 Unclassified 609
143 Ga0495629_0738188 3300046459 Unclassified 652
144 Ga0495582_0335548 3300046473 Unclassified 870
145 Ga0495608_0373837 3300046511 Unclassified 874
146 Ga0495658_0485389 3300046683 Bacteria 790
147 Ga0495669_0387147 3300046684 Unclassified 677
148 Ga0495669_0409252 3300046684 Unclassified 658
149 Ga0496102_0695259 3300048905 Unclassified 940
150 Ga0496106_0339551 3300048909 Bacteria 1206
151 Ga0496115_0068589 3300048918 Bacteria 2872
152 Ga0501034_0684993 3300049571 Bacteria 924
153 Ga0501036_0144596 3300049572 Bacteria 2006
154 Ga0501037_0537231 3300049573 Bacteria 790
155 Ga0501038_0189848 3300049574 Bacteria 1654
156 Ga0501039_0093827 3300049575 Unclassified 2339
157 Ga0501041_0466981 3300049577 Unclassified 802
158 Ga0501041_0536947 3300049577 Unclassified 745
159 Ga0501042_0765894 3300049578 Bacteria 702
160 Ga0501042_0770002 3300049578 Unclassified 700
161 Ga0501043_0542489 3300049579 Bacteria 865
162 Ga0501046_0881803 3300049580 Unclassified 625
163 Ga0501047_0226233 3300049581 Bacteria 1725
164 Ga0501047_0659471 3300049581 Unclassified 865
165 Ga0501069_0858640 3300049585 Unclassified 551
166 Ga0501070_0679933 3300049586 Unclassified 815
167 Ga0501073_0011045 3300049589 Bacteria 6606
168 Ga0501073_1225995 3300049589 Unclassified 515
169 Ga0501074_0563127 3300049590 Unclassified 807
170 Ga0501075_1394082 3300049591 Unclassified 531
171 Ga0501077_0006248 3300049593 Bacteria 7283
172 Ga0501079_0617158 3300049741 Bacteria 853
173 Ga0501080_0272391 3300049742 Bacteria 1540
174 Ga0501080_1239240 3300049742 Unclassified 640
175 Ga0501081_0038087 3300049743 Bacteria 3283
176 Ga0501044_0128099 3300049823 Bacteria 2534
177 Ga0501044_0142608 3300049823 Bacteria 2384
178 nmdc:mga05p37_413103_c1 3300050507 Unclassified 1573
179 nmdc:mga05p37_471649_c1 3300050507 Bacteria 1448
180 nmdc:mga05p37_698535_c1 3300050507 Bacteria 1127
181 nmdc:mga09592_1490491_c1 3300050508 Unclassified 551
182 nmdc:mga09592_192232_c1 3300050508 Unclassified 1767
183 nmdc:mga0qj67_123465_c2 3300050509 Bacteria 1754
184 nmdc:mga0qj67_198930_c1 3300050509 Bacteria 1628
185 nmdc:mga0qj67_67599_c1 3300050509 Bacteria 2847
186 nmdc:mga06r32_1031515_c1 3300050510 Unclassified 774
187 nmdc:mga06r32_196054_c1 3300050510 Bacteria 2007
188 nmdc:mga06r32_272907_c1 3300050510 Unclassified 1679
189 nmdc:mga0n895_23797_c1 3300050512 Bacteria 5763
190 nmdc:mga0n895_366556_c1 3300050512 Bacteria 1459
191 nmdc:mga0n895_541061_c1 3300050512 Unclassified 1171
192 nmdc:mga0n895_590006_c1 3300050512 Bacteria 1114
193 nmdc:mga0n895_811530_c1 3300050512 Bacteria 925
194 nmdc:mga0n895_81806_c1 3300050512 Bacteria 3218
195 nmdc:mga0n895_861968_c1 3300050512 Unclassified 893
196 nmdc:mga0rr50_109347_c1 3300050513 Bacteria 2185
197 nmdc:mga0rr50_167985_c1 3300050513 Bacteria 1785
198 nmdc:mga0rr50_468759_c1 3300050513 Unclassified 1069
199 nmdc:mga0rr50_53270_c1 3300050513 Bacteria 3010
200 nmdc:mga0rr50_563124_c1 3300050513 Bacteria 971
201 nmdc:mga0rr50_6296_c1 3300050513 Bacteria 7207
202 nmdc:mga08x19_1090609_c1 3300050514 Unclassified 567
203 nmdc:mga08x19_1105024_c1 3300050514 Unclassified 563
204 nmdc:mga08x19_111933_c1 3300050514 Bacteria 1821
205 nmdc:mga0a205_1024_c1 3300050515 Bacteria 23241
206 nmdc:mga0a205_160551_c1 3300050515 Unclassified 2145
207 nmdc:mga0a205_89745_c1 3300050515 Bacteria 2971
208 Ga0590071_019121 3300059421 Bacteria 1612
209 Ga0501082_0086377 3300060353 Bacteria 2706
210 Ga0530510_0921325 3300061734 Bacteria 668

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049572 Ga0501036_0144596 Ga0501036_0144596_914_1243 109
2 3300049581 Ga0501047_0659471 Ga0501047_0659471_163_492 109
3 3300049586 Ga0501070_0679933 Ga0501070_0679933_350_679 109
4 3300007788 Ga0099795_10265221 Ga0099795_102652212 123
5 3300010159 Ga0099796_10044529 Ga0099796_100445291 123
6 3300025935 Ga0207709_10390975 Ga0207709_103909752 127
7 3300005339 Ga0070660_100288354 Ga0070660_1002883542 134
8 3300005577 Ga0068857_100144582 Ga0068857_1001445822 134
9 3300007076 Ga0075435_100774296 Ga0075435_1007742963 134
10 3300025919 Ga0207657_10347897 Ga0207657_103478972 134
11 3300026142 Ga0207698_10885582 Ga0207698_108855821 134
12 3300050513 nmdc:mga0rr50_468759_c1 nmdc:mga0rr50_468759_c1_596_1000 134
13 3300005330 Ga0070690_100044611 Ga0070690_1000446115 135
14 3300005335 Ga0070666_10112422 Ga0070666_101124223 135
15 3300005343 Ga0070687_100014129 Ga0070687_1000141295 135
16 3300005366 Ga0070659_100582525 Ga0070659_1005825252 135
17 3300005406 Ga0070703_10485632 Ga0070703_104856321 135
18 3300005440 Ga0070705_100065280 Ga0070705_1000652803 135
19 3300005444 Ga0070694_100001927 Ga0070694_1000019278 135
20 3300005457 Ga0070662_100748502 Ga0070662_1007485021 135
21 3300005471 Ga0070698_100019982 Ga0070698_1000199825 135
22 3300005518 Ga0070699_100043898 Ga0070699_1000438986 135
23 3300005539 Ga0068853_101212784 Ga0068853_1012127841 135
24 3300005544 Ga0070686_100000725 Ga0070686_1000007258 135
25 3300005546 Ga0070696_100004755 Ga0070696_1000047557 135
26 3300005549 Ga0070704_100014525 Ga0070704_1000145253 135
27 3300005578 Ga0068854_100014535 Ga0068854_1000145356 135
28 3300005842 Ga0068858_100551043 Ga0068858_1005510432 135
29 3300006852 Ga0075433_10084632 Ga0075433_100846325 135
30 3300006871 Ga0075434_100185290 Ga0075434_1001852903 135
31 3300006871 Ga0075434_100652849 Ga0075434_1006528492 135
32 3300007076 Ga0075435_100000226 Ga0075435_10000022610 135
33 3300007076 Ga0075435_100238153 Ga0075435_1002381532 135
34 3300009093 Ga0105240_10173664 Ga0105240_101736643 135
35 3300009174 Ga0105241_10036141 Ga0105241_100361414 135
36 3300009551 Ga0105238_10700840 Ga0105238_107008403 135
37 3300025903 Ga0207680_10183080 Ga0207680_101830801 135
38 3300025910 Ga0207684_10089928 Ga0207684_100899283 135
39 3300025918 Ga0207662_10032493 Ga0207662_100324934 135
40 3300025933 Ga0207706_10775876 Ga0207706_107758762 135
41 3300025949 Ga0207667_10369925 Ga0207667_103699252 135
42 3300025981 Ga0207640_10005422 Ga0207640_100054223 135
43 3300026041 Ga0207639_11249881 Ga0207639_112498812 135
44 3300031250 Ga0265331_10019398 Ga0265331_100193984 135
45 3300031251 Ga0265327_10000969 Ga0265327_1000096942 135
46 3300035725 Ga0373947_0151972 Ga0373947_0151972_320_727 135
47 3300039450 Ga0436363_1505054 Ga0436363_1505054_132_539 135
48 3300046473 Ga0495582_0335548 Ga0495582_0335548_399_812 135
49 3300046683 Ga0495658_0485389 Ga0495658_0485389_141_548 135
50 3300046684 Ga0495669_0387147 Ga0495669_0387147_207_614 135
51 3300048905 Ga0496102_0695259 Ga0496102_0695259_337_744 135
52 3300048909 Ga0496106_0339551 Ga0496106_0339551_778_1185 135
53 3300049571 Ga0501034_0684993 Ga0501034_0684993_278_685 135
54 3300049578 Ga0501042_0765894 Ga0501042_0765894_175_582 135
55 3300049585 Ga0501069_0858640 Ga0501069_0858640_130_537 135
56 3300049823 Ga0501044_0142608 Ga0501044_0142608_654_1061 135
57 3300050507 nmdc:mga05p37_471649_c1 nmdc:mga05p37_471649_c1_712_1119 135
58 3300050512 nmdc:mga0n895_366556_c1 nmdc:mga0n895_366556_c1_943_1350 135
59 3300050512 nmdc:mga0n895_590006_c1 nmdc:mga0n895_590006_c1_132_539 135
60 3300050512 nmdc:mga0n895_81806_c1 nmdc:mga0n895_81806_c1_1455_1862 135
61 3300050512 nmdc:mga0n895_861968_c1 nmdc:mga0n895_861968_c1_196_606 135
62 3300050513 nmdc:mga0rr50_109347_c1 nmdc:mga0rr50_109347_c1_1083_1490 135
63 3300050513 nmdc:mga0rr50_167985_c1 nmdc:mga0rr50_167985_c1_932_1339 135
64 3300050513 nmdc:mga0rr50_6296_c1 nmdc:mga0rr50_6296_c1_3085_3492 135
65 3300050515 nmdc:mga0a205_89745_c1 nmdc:mga0a205_89745_c1_1750_2157 135
66 3300061734 Ga0530510_0921325 Ga0530510_0921325_76_483 135
67 3300005295 Ga0065707_10002427 Ga0065707_100024274 136
68 3300005334 Ga0068869_100350891 Ga0068869_1003508913 136
69 3300005340 Ga0070689_101140210 Ga0070689_1011402101 136
70 3300005343 Ga0070687_100256757 Ga0070687_1002567572 136
71 3300005435 Ga0070714_100062800 Ga0070714_1000628004 136
72 3300005435 Ga0070714_100095619 Ga0070714_1000956192 136
73 3300005439 Ga0070711_100735859 Ga0070711_1007358591 136
74 3300005439 Ga0070711_101391257 Ga0070711_1013912572 136
75 3300005445 Ga0070708_100158268 Ga0070708_1001582682 136
76 3300005458 Ga0070681_10709951 Ga0070681_107099511 136
77 3300005467 Ga0070706_100035265 Ga0070706_1000352653 136
78 3300005468 Ga0070707_100254211 Ga0070707_1002542112 136
79 3300005468 Ga0070707_100304951 Ga0070707_1003049513 136
80 3300005471 Ga0070698_100000968 Ga0070698_1000009685 136
81 3300005471 Ga0070698_100017700 Ga0070698_1000177004 136
82 3300005518 Ga0070699_100259387 Ga0070699_1002593872 136
83 3300005518 Ga0070699_101637329 Ga0070699_1016373292 136
84 3300005518 Ga0070699_101752148 Ga0070699_1017521481 136
85 3300005530 Ga0070679_100934982 Ga0070679_1009349821 136
86 3300005535 Ga0070684_100329332 Ga0070684_1003293322 136
87 3300005536 Ga0070697_100019650 Ga0070697_1000196503 136
88 3300005536 Ga0070697_101322960 Ga0070697_1013229602 136
89 3300005563 Ga0068855_101560193 Ga0068855_1015601932 136
90 3300005617 Ga0068859_102985503 Ga0068859_1029855031 136
91 3300005718 Ga0068866_11148042 Ga0068866_111480421 136
92 3300005937 Ga0081455_10298836 Ga0081455_102988363 136
93 3300005981 Ga0081538_10143917 Ga0081538_101439171 136
94 3300006058 Ga0075432_10073883 Ga0075432_100738833 136
95 3300006163 Ga0070715_10392348 Ga0070715_103923482 136
96 3300006194 Ga0075427_10020688 Ga0075427_100206881 136
97 3300006844 Ga0075428_100276846 Ga0075428_1002768462 136
98 3300006846 Ga0075430_100034388 Ga0075430_1000343883 136
99 3300006847 Ga0075431_100049043 Ga0075431_1000490434 136
100 3300006847 Ga0075431_100166726 Ga0075431_1001667263 136
101 3300006847 Ga0075431_101490219 Ga0075431_1014902192 136
102 3300006847 Ga0075431_101726134 Ga0075431_1017261341 136
103 3300006852 Ga0075433_10145061 Ga0075433_101450613 136
104 3300006871 Ga0075434_100016510 Ga0075434_1000165105 136
105 3300006871 Ga0075434_100020608 Ga0075434_1000206082 136
106 3300006871 Ga0075434_100357462 Ga0075434_1003574621 136
107 3300006871 Ga0075434_100672930 Ga0075434_1006729301 136
108 3300006880 Ga0075429_100240636 Ga0075429_1002406362 136
109 3300006914 Ga0075436_100129670 Ga0075436_1001296703 136
110 3300006914 Ga0075436_101206559 Ga0075436_1012065591 136
111 3300006931 Ga0097620_102986250 Ga0097620_1029862501 136
112 3300007076 Ga0075435_100090753 Ga0075435_1000907532 136
113 3300007076 Ga0075435_100145098 Ga0075435_1001450983 136
114 3300007265 Ga0099794_10475487 Ga0099794_104754871 136
115 3300009148 Ga0105243_10400586 Ga0105243_104005862 136
116 3300009148 Ga0105243_11198593 Ga0105243_111985932 136
117 3300009174 Ga0105241_10565313 Ga0105241_105653132 136
118 3300009174 Ga0105241_11710674 Ga0105241_117106741 136
119 3300009176 Ga0105242_10163486 Ga0105242_101634861 136
120 3300009551 Ga0105238_10296606 Ga0105238_102966063 136
121 3300009553 Ga0105249_11073565 Ga0105249_110735652 136
122 3300010159 Ga0099796_10026656 Ga0099796_100266563 136
123 3300013104 Ga0157370_10228971 Ga0157370_102289713 136
124 3300013105 Ga0157369_10901230 Ga0157369_109012302 136
125 3300013307 Ga0157372_10340594 Ga0157372_103405943 136
126 3300013308 Ga0157375_10192558 Ga0157375_101925583 136
127 3300014325 Ga0163163_10430667 Ga0163163_104306672 136
128 3300020082 Ga0206353_11166583 Ga0206353_111665833 136
129 3300021441 Ga0213871_10204072 Ga0213871_102040721 136
130 3300025905 Ga0207685_10365075 Ga0207685_103650751 136
131 3300025910 Ga0207684_10003334 Ga0207684_100033345 136
132 3300025910 Ga0207684_10129998 Ga0207684_101299983 136
133 3300025910 Ga0207684_10413477 Ga0207684_104134772 136
134 3300025911 Ga0207654_11012925 Ga0207654_110129252 136
135 3300025915 Ga0207693_10073231 Ga0207693_100732313 136
136 3300025916 Ga0207663_10230208 Ga0207663_102302083 136
137 3300025921 Ga0207652_10589419 Ga0207652_105894193 136
138 3300025922 Ga0207646_10568871 Ga0207646_105688713 136
139 3300025922 Ga0207646_10937111 Ga0207646_109371112 136
140 3300025924 Ga0207694_10679733 Ga0207694_106797332 136
141 3300025929 Ga0207664_10018843 Ga0207664_100188434 136
142 3300025929 Ga0207664_10326220 Ga0207664_103262202 136
143 3300025935 Ga0207709_10625949 Ga0207709_106259493 136
144 3300025935 Ga0207709_10775540 Ga0207709_107755402 136
145 3300025938 Ga0207704_10272949 Ga0207704_102729491 136
146 3300025939 Ga0207665_10078356 Ga0207665_100783563 136
147 3300025944 Ga0207661_10239123 Ga0207661_102391232 136
148 3300025949 Ga0207667_11052275 Ga0207667_110522752 136
149 3300025960 Ga0207651_11295004 Ga0207651_112950042 136
150 3300025981 Ga0207640_11672392 Ga0207640_116723921 136
151 3300026078 Ga0207702_11152632 Ga0207702_111526322 136
152 3300027717 Ga0209998_10021043 Ga0209998_100210433 136
153 3300027876 Ga0209974_10004997 Ga0209974_100049975 136
154 3300027907 Ga0207428_10314337 Ga0207428_103143371 136
155 3300028381 Ga0268264_10052642 Ga0268264_100526423 136
156 3300028381 Ga0268264_12534289 Ga0268264_125342891 136
157 3300032002 Ga0307416_100430724 Ga0307416_1004307242 136
158 3300035118 Ga0373954_0168088 Ga0373954_0168088_290_700 136
159 3300042438 Ga0439459_0064077 Ga0439459_0064077_289_702 136
160 3300042876 Ga0451577_0594886 Ga0451577_0594886_515_928 136
161 3300044673 Ga0453683_0890976 Ga0453683_0890976_34_444 136
162 3300044842 Ga0466957_1189985 Ga0466957_1189985_123_533 136
163 3300045051 Ga0451576_0363759 Ga0451576_0363759_534_944 136
164 3300045051 Ga0451576_0414110 Ga0451576_0414110_204_614 136
165 3300045051 Ga0451576_1931293 Ga0451576_1931293_93_524 136
166 3300046459 Ga0495629_0738188 Ga0495629_0738188_11_421 136
167 3300046511 Ga0495608_0373837 Ga0495608_0373837_399_809 136
168 3300046684 Ga0495669_0409252 Ga0495669_0409252_158_568 136
169 3300048918 Ga0496115_0068589 Ga0496115_0068589_1836_2276 136
170 3300049573 Ga0501037_0537231 Ga0501037_0537231_57_467 136
171 3300049574 Ga0501038_0189848 Ga0501038_0189848_843_1253 136
172 3300049575 Ga0501039_0093827 Ga0501039_0093827_1842_2252 136
173 3300049577 Ga0501041_0466981 Ga0501041_0466981_33_443 136
174 3300049577 Ga0501041_0536947 Ga0501041_0536947_101_517 136
175 3300049578 Ga0501042_0770002 Ga0501042_0770002_95_505 136
176 3300049579 Ga0501043_0542489 Ga0501043_0542489_291_701 136
177 3300049580 Ga0501046_0881803 Ga0501046_0881803_141_551 136
178 3300049581 Ga0501047_0226233 Ga0501047_0226233_936_1346 136
179 3300049589 Ga0501073_0011045 Ga0501073_0011045_2964_3374 136
180 3300049589 Ga0501073_1225995 Ga0501073_1225995_14_424 136
181 3300049590 Ga0501074_0563127 Ga0501074_0563127_53_463 136
182 3300049591 Ga0501075_1394082 Ga0501075_1394082_73_483 136
183 3300049593 Ga0501077_0006248 Ga0501077_0006248_310_720 136
184 3300049741 Ga0501079_0617158 Ga0501079_0617158_194_604 136
185 3300049742 Ga0501080_0272391 Ga0501080_0272391_474_884 136
186 3300049742 Ga0501080_1239240 Ga0501080_1239240_72_482 136
187 3300049743 Ga0501081_0038087 Ga0501081_0038087_2648_3058 136
188 3300049823 Ga0501044_0128099 Ga0501044_0128099_1876_2286 136
189 3300050507 nmdc:mga05p37_413103_c1 nmdc:mga05p37_413103_c1_554_964 136
190 3300050507 nmdc:mga05p37_698535_c1 nmdc:mga05p37_698535_c1_548_961 136
191 3300050508 nmdc:mga09592_1490491_c1 nmdc:mga09592_1490491_c1_115_525 136
192 3300050508 nmdc:mga09592_192232_c1 nmdc:mga09592_192232_c1_831_1241 136
193 3300050509 nmdc:mga0qj67_123465_c2 nmdc:mga0qj67_123465_c2_1023_1433 136
194 3300050509 nmdc:mga0qj67_198930_c1 nmdc:mga0qj67_198930_c1_217_627 136
195 3300050509 nmdc:mga0qj67_67599_c1 nmdc:mga0qj67_67599_c1_1051_1461 136
196 3300050510 nmdc:mga06r32_1031515_c1 nmdc:mga06r32_1031515_c1_245_655 136
197 3300050510 nmdc:mga06r32_196054_c1 nmdc:mga06r32_196054_c1_1027_1437 136
198 3300050510 nmdc:mga06r32_272907_c1 nmdc:mga06r32_272907_c1_574_984 136
199 3300050512 nmdc:mga0n895_23797_c1 nmdc:mga0n895_23797_c1_5063_5476 136
200 3300050512 nmdc:mga0n895_541061_c1 nmdc:mga0n895_541061_c1_238_648 136
201 3300050512 nmdc:mga0n895_811530_c1 nmdc:mga0n895_811530_c1_150_560 136
202 3300050513 nmdc:mga0rr50_53270_c1 nmdc:mga0rr50_53270_c1_424_834 136
203 3300050513 nmdc:mga0rr50_563124_c1 nmdc:mga0rr50_563124_c1_290_703 136
204 3300050514 nmdc:mga08x19_1090609_c1 nmdc:mga08x19_1090609_c1_52_462 136
205 3300050514 nmdc:mga08x19_1105024_c1 nmdc:mga08x19_1105024_c1_54_467 136
206 3300050514 nmdc:mga08x19_111933_c1 nmdc:mga08x19_111933_c1_21_431 136
207 3300050515 nmdc:mga0a205_1024_c1 nmdc:mga0a205_1024_c1_2459_2872 136
208 3300050515 nmdc:mga0a205_160551_c1 nmdc:mga0a205_160551_c1_635_1045 136
209 3300059421 Ga0590071_019121 Ga0590071_019121_728_1138 136
210 3300060353 Ga0501082_0086377 Ga0501082_0086377_1296_1706 136

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01850

PIN

PIN domain

5

124

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
5x3t-assembly1.cif.gz_H vapbc from mycobacterium tuberculosis 0.7881 5 135
5wz4-assembly1.cif.gz_B crystal structure of mycobacterium tuberculosis vapc20 (rv2549c), sarcin-ricin loop cleaving toxin 0.7879 4 118
5wzf-assembly1.cif.gz_A crystal structure of mycobacterium tuberculosis vapc20 (rv2549c), sarcin-ricin loop cleaving toxin 0.7862 4 118
1w8i-assembly1.cif.gz_A-2 the structure of gene product af1683 from archaeoglobus fulgidus. 0.7633 5 132
5x3t-assembly1.cif.gz_H vapbc from mycobacterium tuberculosis 0.7571 5 135
ID Description Score Start End Superfamily
af_P95004_1_128_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.885 5 118 3.40.50.1010
af_O53779_1_126_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.8299 6 124 3.40.50.1010
af_P95004_1_128_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.7899 5 118 3.40.50.1010
af_O53779_1_126_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.7825 6 124 3.40.50.1010
af_P9WF69_2_135_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.7599 6 119 3.40.50.1010
ID Description Score Start End GO Terms
AF-A0A2V8Z9S5-F1-model_v4 Pilus assembly protein 0.9945 1 136
AF-A0A327KMF8-F1-model_v4 Ribonuclease VapC (RNase VapC) (EC 3.1.-.-) (Toxin VapC) 0.9905 1 136 GO:0000287
GO:0004540
GO:0090729
AF-A0A2V8M3L1-F1-model_v4 Pilus assembly protein 0.9873 2 135
AF-A0A2V8Z9S5-F1-model_v4 Pilus assembly protein 0.9873 1 136
AF-A0A2V8BE27-F1-model_v4 Pilus assembly protein 0.9843 44 135

Feature Viewer

pLDDT pTM Quality
95.67 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map