F320002

General Info

Members Datasets Scaffolds Average Seq Length
210 155 420 197

Family's Representative Sequence

Representative Sequence 3300005355|Ga0070671_101184250|Ga0070671_1011842501
Length 193
Sequence MSQVHEAVLRANAAYAAKFGDKGKLALPPARRFAILTCMDARIDPAKLAGLEEGDAHVIRNAGGRASDDAIRSLVISYKLLGTREWFVIHHSNCGMELFTDETIRGLLAQSLKTASYDGAWKDSGQGPGSRHGDFIDWLTIREQAESVAIDVERIRNHPLVPRDIAIYGYIYQVETGKLIEVPKATALGKVAE

Samples

Sample ID Description Type Environment
1 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
2 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
3 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
4 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
5 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
6 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
7 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
8 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
9 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
10 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
11 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
12 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
13 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
14 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
15 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
16 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
19 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
20 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
21 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
22 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
23 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
24 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
25 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
26 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
27 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
28 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
29 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
30 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
31 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
32 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
33 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
34 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
35 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
36 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
38 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
39 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
40 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
41 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
42 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
43 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
44 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
64 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
65 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
67 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
68 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
69 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
70 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
71 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
72 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
73 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
74 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
75 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
76 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
77 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
78 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
79 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
80 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
81 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
82 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
83 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
84 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
85 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
86 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
87 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
88 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
89 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
90 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
91 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
92 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
93 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
94 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
95 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
96 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
97 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
98 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
99 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
100 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
101 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
102 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
103 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
104 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
105 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
106 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
107 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
108 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
109 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
110 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
111 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
112 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
113 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
114 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
115 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
116 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
117 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
118 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
119 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
120 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
121 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
122 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
123 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
124 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
125 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
126 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
127 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
128 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
129 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
130 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
131 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
132 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
133 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
134 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
135 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
136 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
137 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
138 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
139 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
140 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
141 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
142 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
143 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
144 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
145 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
146 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
147 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
148 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
149 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
150 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
151 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
152 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
153 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
154 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
155 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.71
Metatranscriptomes 4.29
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.29
Rhizosphere 94.76
Stem 0
Stem Tuber 0
Unclassified 3.81

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070671_101184250 3300005355 Bacteria 672
2 Ga0070680_100160138 3300005336 Bacteria 1891
3 Ga0070680_100335825 3300005336 Bacteria 1284
4 Ga0070691_10036401 3300005341 Bacteria 2320
5 Ga0070668_100578680 3300005347 Bacteria 980
6 Ga0070709_10040035 3300005434 Bacteria 2879
7 Ga0070714_100044513 3300005435 Bacteria 3758
8 Ga0070710_10101447 3300005437 Bacteria 1714
9 Ga0070711_100060754 3300005439 Bacteria 2628
10 Ga0070711_100553135 3300005439 Bacteria 955
11 Ga0070711_100711126 3300005439 Unclassified 846
12 Ga0070700_100020564 3300005441 Bacteria 3825
13 Ga0070694_100008422 3300005444 Bacteria 6308
14 Ga0070708_100332368 3300005445 Bacteria 1432
15 Ga0070708_100571402 3300005445 Bacteria 1066
16 Ga0070663_100570891 3300005455 Bacteria 948
17 Ga0070706_100390581 3300005467 Bacteria 1295
18 Ga0070707_100192119 3300005468 Unclassified 1991
19 Ga0070698_100880563 3300005471 Bacteria 841
20 Ga0070699_100402455 3300005518 Bacteria 1238
21 Ga0070699_100825691 3300005518 Bacteria 848
22 Ga0070679_100125399 3300005530 Bacteria 2550
23 Ga0070679_100344361 3300005530 Bacteria 1439
24 Ga0070695_100025510 3300005545 Bacteria 3650
25 Ga0070695_100063080 3300005545 Bacteria 2408
26 Ga0070696_100184216 3300005546 Bacteria 1550
27 Ga0070696_100280266 3300005546 Bacteria 1270
28 Ga0068855_100379351 3300005563 Bacteria 1553
29 Ga0068861_100008484 3300005719 Bacteria 7075
30 Ga0070717_10536219 3300006028 Bacteria 1059
31 Ga0070717_10645541 3300006028 Bacteria 961
32 Ga0070715_10135091 3300006163 Bacteria 1192
33 Ga0070716_100118623 3300006173 Bacteria 1652
34 Ga0070712_100112596 3300006175 Unclassified 2033
35 Ga0070712_100205343 3300006175 Bacteria 1550
36 Ga0075427_10008242 3300006194 Bacteria 1542
37 Ga0075428_100001614 3300006844 Bacteria 24105
38 Ga0075428_100250651 3300006844 Bacteria 1908
39 Ga0075430_100020764 3300006846 Bacteria 5584
40 Ga0075431_100014042 3300006847 Bacteria 8094
41 Ga0075431_100151413 3300006847 Bacteria 2388
42 Ga0075433_10040667 3300006852 Bacteria 4025
43 Ga0075433_10065673 3300006852 Bacteria 3182
44 Ga0075433_10351135 3300006852 Bacteria 1303
45 Ga0075434_100318186 3300006871 Bacteria 1576
46 Ga0075434_100473698 3300006871 Bacteria 1273
47 Ga0075429_100035803 3300006880 Bacteria 4317
48 Ga0075429_100096461 3300006880 Bacteria 2579
49 Ga0075436_100102336 3300006914 Bacteria 1995
50 Ga0075436_100334972 3300006914 Bacteria 1089
51 Ga0075435_100346342 3300007076 Bacteria 1273
52 Ga0111539_10023171 3300009094 Bacteria 7625
53 Ga0114129_10007420 3300009147 Bacteria 15609
54 Ga0114129_10346078 3300009147 Unclassified 1970
55 Ga0105238_11170523 3300009551 Bacteria 793
56 Ga0099796_10185166 3300010159 Bacteria 838
57 Ga0105239_10635026 3300010375 Bacteria 1219
58 Ga0163162_10515570 3300013306 Bacteria 1325
59 Ga0157375_10731387 3300013308 Bacteria 1142
60 Ga0163161_10170689 3300017792 Bacteria 1663
61 Ga0206350_10193164 3300020080 Bacteria 684
62 Ga0207692_10015797 3300025898 Bacteria 3330
63 Ga0207692_10067004 3300025898 Bacteria 1878
64 Ga0207685_10087465 3300025905 Bacteria 1304
65 Ga0207699_10131122 3300025906 Bacteria 1635
66 Ga0207699_10229255 3300025906 Bacteria 1271
67 Ga0207684_10059098 3300025910 Unclassified 3254
68 Ga0207684_10337775 3300025910 Bacteria 1297
69 Ga0207684_10676788 3300025910 Bacteria 878
70 Ga0207707_10116952 3300025912 Bacteria 2330
71 Ga0207693_10540856 3300025915 Bacteria 909
72 Ga0207663_10333502 3300025916 Bacteria 1143
73 Ga0207663_10774424 3300025916 Bacteria 763
74 Ga0207660_10531388 3300025917 Bacteria 956
75 Ga0207660_10544052 3300025917 Bacteria 944
76 Ga0207652_10171944 3300025921 Bacteria 1944
77 Ga0207652_10193680 3300025921 Bacteria 1828
78 Ga0207646_10077151 3300025922 Bacteria 2978
79 Ga0207646_10098444 3300025922 Bacteria 2621
80 Ga0207700_10228081 3300025928 Bacteria 1582
81 Ga0207700_10235554 3300025928 Bacteria 1558
82 Ga0207664_11174107 3300025929 Bacteria 685
83 Ga0207644_10956961 3300025931 Bacteria 718
84 Ga0207665_10034466 3300025939 Bacteria 3359
85 Ga0207661_10324758 3300025944 Bacteria 1384
86 Ga0207667_10289584 3300025949 Bacteria 1673
87 Ga0207678_10429268 3300026067 Unclassified 1147
88 Ga0207708_10040373 3300026075 Bacteria 3558
89 Ga0207675_100134883 3300026118 Bacteria 2342
90 Ga0209974_10003836 3300027876 Bacteria 5384
91 Ga0207428_10013593 3300027907 Bacteria 7104
92 Ga0268264_10612425 3300028381 Bacteria 1074
93 Ga0265337_1008449 3300028556 Bacteria 3744
94 Ga0265337_1019685 3300028556 Bacteria 2124
95 Ga0265318_10007976 3300028577 Bacteria 4749
96 Ga0265323_10007840 3300028653 Bacteria 4417
97 Ga0265336_10000054 3300028666 Bacteria 112835
98 Ga0265338_10087439 3300028800 Bacteria 2589
99 Ga0265324_10001601 3300029957 Bacteria 12603
100 Ga0265332_10032396 3300031238 Bacteria 2278
101 Ga0265320_10038511 3300031240 Bacteria 2398
102 Ga0265325_10000096 3300031241 Bacteria 61608
103 Ga0265325_10006687 3300031241 Bacteria 6975
104 Ga0265329_10116685 3300031242 Bacteria 855
105 Ga0265340_10000508 3300031247 Bacteria 21378
106 Ga0265340_10000870 3300031247 Bacteria 17104
107 Ga0265339_10028751 3300031249 Bacteria 3159
108 Ga0265331_10001834 3300031250 Bacteria 15055
109 Ga0265327_10002111 3300031251 Bacteria 22057
110 Ga0265327_10063261 3300031251 Bacteria 1879
111 Ga0265316_10002240 3300031344 Bacteria 20269
112 Ga0265313_10007980 3300031595 Bacteria 7106
113 Ga0265314_10000007 3300031711 Bacteria 491737
114 Ga0265314_10096138 3300031711 Bacteria 1917
115 Ga0265342_10000619 3300031712 Bacteria 37353
116 Ga0265342_10029078 3300031712 Bacteria 3435
117 Ga0316576_10156585 3300031727 Bacteria 1717
118 Ga0316576_10220128 3300031727 Bacteria 1428
119 Ga0316576_10546251 3300031727 Bacteria 849
120 Ga0316578_10356561 3300031728 Bacteria 870
121 Ga0316577_10378200 3300031733 Bacteria 804
122 Ga0316583_10076961 3300032133 Bacteria 1166
123 Ga0316593_10008371 3300032168 Bacteria 2881
124 Ga0316593_10034737 3300032168 Bacteria 1655
125 Ga0316593_10056556 3300032168 Bacteria 1335
126 Ga0316593_10107759 3300032168 Bacteria 993
127 Ga0316593_10250424 3300032168 Bacteria 663
128 Ga0316592_1005753 3300033524 Bacteria 2364
129 Ga0316587_1056571 3300033529 Bacteria 723
130 Ga0316596_1072769 3300033541 Bacteria 921
131 Ga0373956_0201682 3300035119 Bacteria 943
132 Ga0316574_0273584 3300035398 Unclassified 1077
133 Ga0316574_0323022 3300035398 Bacteria 979
134 Ga0373924_0132291 3300035410 Bacteria 1086
135 Ga0373935_0429398 3300035692 Bacteria 952
136 Ga0373927_0007076 3300035695 Bacteria 7608
137 Ga0373927_0488814 3300035695 Bacteria 813
138 Ga0373947_0076397 3300035725 Bacteria 2064
139 Ga0373937_0858267 3300036401 Bacteria 856
140 Ga0316582_0283746 3300036647 Bacteria 1137
141 Ga0316584_0083990 3300036712 Bacteria 2385
142 Ga0316584_0119250 3300036712 Bacteria 1972
143 Ga0373925_0029104 3300037068 Bacteria 4052
144 Ga0395898_0473563 3300037466 Bacteria 1192
145 Ga0400489_62521 3300039093 Bacteria 2333
146 Ga0436360_0556137 3300039438 Bacteria 1171
147 Ga0451577_0078343 3300042876 Bacteria 2947
148 Ga0451577_0113934 3300042876 Bacteria 2420
149 Ga0451577_0281237 3300042876 Bacteria 1507
150 Ga0451577_0485452 3300042876 Bacteria 1122
151 Ga0453683_0008328 3300044673 Bacteria 6968
152 Ga0453683_0221374 3300044673 Bacteria 1203
153 Ga0453684_0012930 3300044712 Bacteria 13666
154 Ga0453684_0322674 3300044712 Bacteria 1748
155 Ga0453684_1150919 3300044712 Bacteria 817
156 Ga0451576_0612425 3300045051 Bacteria 1144
157 Ga0495603_0000538 3300046455 Bacteria 21096
158 Ga0495629_0001546 3300046459 Bacteria 18065
159 Ga0495641_0012719 3300046461 Bacteria 4684
160 Ga0495580_0002344 3300046472 Bacteria 16527
161 Ga0495580_0085929 3300046472 Bacteria 2191
162 Ga0495582_0001712 3300046473 Bacteria 12373
163 Ga0495639_0000649 3300046475 Bacteria 16048
164 Ga0495594_0000858 3300046499 Bacteria 15650
165 Ga0495665_0009103 3300046531 Bacteria 5380
166 Ga0495622_0003508 3300046557 Bacteria 7392
167 Ga0495634_0010124 3300046642 Bacteria 6918
168 Ga0495634_0499519 3300046642 Bacteria 713
169 Ga0495635_0087654 3300046663 Bacteria 2130
170 Ga0495588_0026411 3300046674 Bacteria 2898
171 Ga0495647_0001223 3300046681 Bacteria 7911
172 Ga0495658_0001002 3300046683 Bacteria 14907
173 Ga0495613_0000511 3300046689 Bacteria 32567
174 Ga0495581_0002797 3300047315 Bacteria 9961
175 Ga0495676_0017862 3300047321 Bacteria 6262
176 Ga0495680_0051012 3300047322 Bacteria 3233
177 Ga0495593_0001165 3300047673 Bacteria 15353
178 Ga0495614_0010087 3300048089 Bacteria 4169
179 Ga0496100_0409788 3300048903 Bacteria 1034
180 Ga0496100_0967908 3300048903 Bacteria 669
181 Ga0496101_0279882 3300048904 Bacteria 1304
182 Ga0496102_0125973 3300048905 Bacteria 2394
183 Ga0496104_0281776 3300048907 Bacteria 1575
184 Ga0496105_0186970 3300048908 Bacteria 1695
185 Ga0496107_0269052 3300048910 Bacteria 1268
186 Ga0496110_0697170 3300048913 Bacteria 917
187 Ga0496113_0157763 3300048916 Bacteria 1793
188 Ga0496126_0029402 3300048929 Bacteria 5220
189 Ga0501038_0000339 3300049574 Bacteria 40357
190 Ga0501039_0286408 3300049575 Bacteria 1295
191 Ga0501047_0303314 3300049581 Bacteria 1439
192 Ga0501070_0022476 3300049586 Bacteria 5282
193 Ga0501070_0056837 3300049586 Bacteria 3244
194 Ga0501070_0187426 3300049586 Bacteria 1701
195 Ga0501073_0591861 3300049589 Bacteria 766
196 Ga0501074_0000255 3300049590 Bacteria 30072
197 Ga0501079_0141679 3300049741 Bacteria 1873
198 Ga0501080_0006959 3300049742 Bacteria 10202
199 Ga0501035_0280604 3300049822 Bacteria 1408
200 nmdc:mga05p37_143333_c1 3300050507 Unclassified 2926
201 nmdc:mga05p37_25900_c1 3300050507 Bacteria 2272
202 nmdc:mga05p37_70804_c1 3300050507 Bacteria 4290
203 nmdc:mga09592_20490_c1 3300050508 Bacteria 5439
204 nmdc:mga0qj67_16080_c1 3300050509 Bacteria 5668
205 nmdc:mga06r32_37994_c1 3300050510 Bacteria 4558
206 nmdc:mga08y16_13503_c1 3300050511 Bacteria 8594
207 nmdc:mga0n895_77307_c1 3300050512 Bacteria 3311
208 nmdc:mga08x19_82385_c1 3300050514 Bacteria 2114
209 nmdc:mga0a205_25390_c1 3300050515 Bacteria 3781
210 Ga0495619_0007943 3300053085 Bacteria 6713
211 Ga0070671_101184250
212 Ga0070680_100160138
213 Ga0070680_100335825
214 Ga0070691_10036401
215 Ga0070668_100578680
216 Ga0070709_10040035
217 Ga0070714_100044513
218 Ga0070710_10101447
219 Ga0070711_100060754
220 Ga0070711_100553135
221 Ga0070711_100711126
222 Ga0070700_100020564
223 Ga0070694_100008422
224 Ga0070708_100332368
225 Ga0070708_100571402
226 Ga0070663_100570891
227 Ga0070706_100390581
228 Ga0070707_100192119
229 Ga0070698_100880563
230 Ga0070699_100402455
231 Ga0070699_100825691
232 Ga0070679_100125399
233 Ga0070679_100344361
234 Ga0070695_100025510
235 Ga0070695_100063080
236 Ga0070696_100184216
237 Ga0070696_100280266
238 Ga0068855_100379351
239 Ga0068861_100008484
240 Ga0070717_10536219
241 Ga0070717_10645541
242 Ga0070715_10135091
243 Ga0070716_100118623
244 Ga0070712_100112596
245 Ga0070712_100205343
246 Ga0075427_10008242
247 Ga0075428_100001614
248 Ga0075428_100250651
249 Ga0075430_100020764
250 Ga0075431_100014042
251 Ga0075431_100151413
252 Ga0075433_10040667
253 Ga0075433_10065673
254 Ga0075433_10351135
255 Ga0075434_100318186
256 Ga0075434_100473698
257 Ga0075429_100035803
258 Ga0075429_100096461
259 Ga0075436_100102336
260 Ga0075436_100334972
261 Ga0075435_100346342
262 Ga0111539_10023171
263 Ga0114129_10007420
264 Ga0114129_10346078
265 Ga0105238_11170523
266 Ga0099796_10185166
267 Ga0105239_10635026
268 Ga0163162_10515570
269 Ga0157375_10731387
270 Ga0163161_10170689
271 Ga0206350_10193164
272 Ga0207692_10015797
273 Ga0207692_10067004
274 Ga0207685_10087465
275 Ga0207699_10131122
276 Ga0207699_10229255
277 Ga0207684_10059098
278 Ga0207684_10337775
279 Ga0207684_10676788
280 Ga0207707_10116952
281 Ga0207693_10540856
282 Ga0207663_10333502
283 Ga0207663_10774424
284 Ga0207660_10531388
285 Ga0207660_10544052
286 Ga0207652_10171944
287 Ga0207652_10193680
288 Ga0207646_10077151
289 Ga0207646_10098444
290 Ga0207700_10228081
291 Ga0207700_10235554
292 Ga0207664_11174107
293 Ga0207644_10956961
294 Ga0207665_10034466
295 Ga0207661_10324758
296 Ga0207667_10289584
297 Ga0207678_10429268
298 Ga0207708_10040373
299 Ga0207675_100134883
300 Ga0209974_10003836
301 Ga0207428_10013593
302 Ga0268264_10612425
303 Ga0265337_1008449
304 Ga0265337_1019685
305 Ga0265318_10007976
306 Ga0265323_10007840
307 Ga0265336_10000054
308 Ga0265338_10087439
309 Ga0265324_10001601
310 Ga0265332_10032396
311 Ga0265320_10038511
312 Ga0265325_10000096
313 Ga0265325_10006687
314 Ga0265329_10116685
315 Ga0265340_10000508
316 Ga0265340_10000870
317 Ga0265339_10028751
318 Ga0265331_10001834
319 Ga0265327_10002111
320 Ga0265327_10063261
321 Ga0265316_10002240
322 Ga0265313_10007980
323 Ga0265314_10000007
324 Ga0265314_10096138
325 Ga0265342_10000619
326 Ga0265342_10029078
327 Ga0316576_10156585
328 Ga0316576_10220128
329 Ga0316576_10546251
330 Ga0316578_10356561
331 Ga0316577_10378200
332 Ga0316583_10076961
333 Ga0316593_10008371
334 Ga0316593_10034737
335 Ga0316593_10056556
336 Ga0316593_10107759
337 Ga0316593_10250424
338 Ga0316592_1005753
339 Ga0316587_1056571
340 Ga0316596_1072769
341 Ga0373956_0201682
342 Ga0316574_0273584
343 Ga0316574_0323022
344 Ga0373924_0132291
345 Ga0373935_0429398
346 Ga0373927_0007076
347 Ga0373927_0488814
348 Ga0373947_0076397
349 Ga0373937_0858267
350 Ga0316582_0283746
351 Ga0316584_0083990
352 Ga0316584_0119250
353 Ga0373925_0029104
354 Ga0395898_0473563
355 Ga0400489_62521
356 Ga0436360_0556137
357 Ga0451577_0078343
358 Ga0451577_0113934
359 Ga0451577_0281237
360 Ga0451577_0485452
361 Ga0453683_0008328
362 Ga0453683_0221374
363 Ga0453684_0012930
364 Ga0453684_0322674
365 Ga0453684_1150919
366 Ga0451576_0612425
367 Ga0495603_0000538
368 Ga0495629_0001546
369 Ga0495641_0012719
370 Ga0495580_0002344
371 Ga0495580_0085929
372 Ga0495582_0001712
373 Ga0495639_0000649
374 Ga0495594_0000858
375 Ga0495665_0009103
376 Ga0495622_0003508
377 Ga0495634_0010124
378 Ga0495634_0499519
379 Ga0495635_0087654
380 Ga0495588_0026411
381 Ga0495647_0001223
382 Ga0495658_0001002
383 Ga0495613_0000511
384 Ga0495581_0002797
385 Ga0495676_0017862
386 Ga0495680_0051012
387 Ga0495593_0001165
388 Ga0495614_0010087
389 Ga0496100_0409788
390 Ga0496100_0967908
391 Ga0496101_0279882
392 Ga0496102_0125973
393 Ga0496104_0281776
394 Ga0496105_0186970
395 Ga0496107_0269052
396 Ga0496110_0697170
397 Ga0496113_0157763
398 Ga0496126_0029402
399 Ga0501038_0000339
400 Ga0501039_0286408
401 Ga0501047_0303314
402 Ga0501070_0022476
403 Ga0501070_0056837
404 Ga0501070_0187426
405 Ga0501073_0591861
406 Ga0501074_0000255
407 Ga0501079_0141679
408 Ga0501080_0006959
409 Ga0501035_0280604
410 nmdc:mga05p37_143333_c1
411 nmdc:mga05p37_25900_c1
412 nmdc:mga05p37_70804_c1
413 nmdc:mga09592_20490_c1
414 nmdc:mga0qj67_16080_c1
415 nmdc:mga06r32_37994_c1
416 nmdc:mga08y16_13503_c1
417 nmdc:mga0n895_77307_c1
418 nmdc:mga08x19_82385_c1
419 nmdc:mga0a205_25390_c1
420 Ga0495619_0007943

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00484

Pro_CA

Carbonic anhydrase

33

179

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
6jqc-assembly1.cif.gz_B the structural basis of the beta-carbonic anhydrase cafc (wild type) of the filamentous fungus aspergillus fumigatus 0.9215 2 182
6jqd-assembly1.cif.gz_B the structural basis of the beta-carbonic anhydrase cafc (l25g and l78g mutant) of the filamentous fungus aspergillus fumigatus 0.9152 2 182
3las-assembly1.cif.gz_B crystal structure of carbonic anhydrase from streptococcus mutans to 1.4 angstrom resolution 0.9146 1 183
3las-assembly1.cif.gz_B crystal structure of carbonic anhydrase from streptococcus mutans to 1.4 angstrom resolution 0.8988 1 183
6jqc-assembly1.cif.gz_B the structural basis of the beta-carbonic anhydrase cafc (wild type) of the filamentous fungus aspergillus fumigatus 0.8892 2 182
ID Description Score Start End Superfamily
af_Q5A207_1_162_3.40.1050.10 Alpha Beta;3-Layer(aba) Sandwich;Beta-carbonic Anhydrase; Chain A;Carbonic anhydrase 0.9248 1 183 3.40.1050.10
3lasB00 Alpha Beta;3-Layer(aba) Sandwich;Beta-carbonic Anhydrase; Chain A;Carbonic anhydrase 0.9146 1 183 3.40.1050.10
af_Q5A207_1_162_3.40.1050.10 Alpha Beta;3-Layer(aba) Sandwich;Beta-carbonic Anhydrase; Chain A;Carbonic anhydrase 0.9139 1 183 3.40.1050.10
3lasB00 Alpha Beta;3-Layer(aba) Sandwich;Beta-carbonic Anhydrase; Chain A;Carbonic anhydrase 0.8988 1 183 3.40.1050.10
1ylkA00 Alpha Beta;3-Layer(aba) Sandwich;Beta-carbonic Anhydrase; Chain A;Carbonic anhydrase 0.8508 2 182 3.40.1050.10
ID Description Score Start End GO Terms
AF-Q6N8S2-F1-model_v4 Carbonic anhydrase 0.972 5 86 GO:0004089
GO:0008270
AF-H0R5T6-F1-model_v4 Putative carbonic anhydrase 0.9629 39 193 GO:0004089
GO:0008270
AF-A0A6J7PMS7-F1-model_v4 Unannotated protein 0.9612 1 193 GO:0004089
GO:0008270
GO:0016020
AF-A0A1Z4IYK4-F1-model_v4 deleted 0.9588 1 193
AF-A0A838UFF2-F1-model_v4 Carbonic anhydrase 0.9578 6 182 GO:0004089
GO:0008270

Map