F319593

General Info

Members Datasets Scaffolds Average Seq Length
209 137 209 135

Family's Representative Sequence

Representative Sequence 3300049568|Ga0501031_0342255|Ga0501031_0342255_450_935
Length 150
Sequence MEILMPKGWAPPIGYANGIAAKPGRIVFVAGQVGWDEQQKFQSEDIVPQFEQALKNIVTVLAEAGAKPEHICRMTAYCCDKPAYLAARRQLGRIWMQHIGRHFPAMSMIFVSDLLDNPGKIELEATAVVPAAPAKRAARRKPTRRPRARS

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
3 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
4 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
5 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
6 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
7 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
8 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
9 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
10 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
11 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
12 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
13 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
14 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
15 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
16 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
17 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
18 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
19 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
20 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
21 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
22 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
23 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
24 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
25 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
26 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
27 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
28 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
29 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
30 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
31 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
32 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
33 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
34 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
35 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
65 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
66 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
67 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
68 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
70 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
71 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
72 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
73 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
74 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
75 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
76 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
77 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
78 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
79 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
80 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
81 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
82 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
83 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
84 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
85 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
86 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
87 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
88 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
89 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
90 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
91 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
92 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
93 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
94 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
95 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
96 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
97 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
98 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
99 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
100 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
101 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
102 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
103 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
104 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
105 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
106 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
107 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
108 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
109 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
110 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
111 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
112 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
113 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
114 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
115 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
116 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
117 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
118 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
119 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
120 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
121 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
122 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
123 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
124 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
125 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
126 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
127 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
128 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
129 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
130 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
131 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
132 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
133 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
134 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
135 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
136 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
137 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.87
Rhizosphere 97.13
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10639713 3300005327 Bacteria 923
2 Ga0070660_100091498 3300005339 Bacteria 2400
3 Ga0070689_100151423 3300005340 Bacteria 1871
4 Ga0070687_100038165 3300005343 Bacteria 2406
5 Ga0070692_10695147 3300005345 Bacteria 684
6 Ga0070703_10386880 3300005406 Unclassified 606
7 Ga0070705_100210702 3300005440 Bacteria 1339
8 Ga0070700_100371235 3300005441 Bacteria 1067
9 Ga0070694_100014651 3300005444 Bacteria 4911
10 Ga0070708_100449171 3300005445 Bacteria 1216
11 Ga0070681_10484887 3300005458 Bacteria 1149
12 Ga0070707_100111592 3300005468 Bacteria 2652
13 Ga0070679_100005073 3300005530 Bacteria 12160
14 Ga0070679_101014050 3300005530 Bacteria 774
15 Ga0070695_100000748 3300005545 Bacteria 17404
16 Ga0070695_100862424 3300005545 Bacteria 729
17 Ga0070693_100340063 3300005547 Bacteria 1024
18 Ga0070704_100004170 3300005549 Bacteria 8340
19 Ga0068855_100052545 3300005563 Bacteria 4797
20 Ga0070664_100130835 3300005564 Bacteria 2204
21 Ga0068856_100271416 3300005614 Bacteria 1712
22 Ga0068859_100008153 3300005617 Bacteria 10625
23 Ga0068864_100209289 3300005618 Bacteria 1795
24 Ga0068862_100439205 3300005844 Unclassified 1228
25 Ga0070717_11118713 3300006028 Bacteria 717
26 Ga0075430_100015902 3300006846 Bacteria 6408
27 Ga0075430_100069351 3300006846 Bacteria 2958
28 Ga0075430_100091000 3300006846 Bacteria 2551
29 Ga0075429_100012773 3300006880 Bacteria 7284
30 Ga0075429_100055953 3300006880 Bacteria 3433
31 Ga0075429_100481767 3300006880 Bacteria 1087
32 Ga0068865_100931255 3300006881 Bacteria 757
33 Ga0097620_100008154 3300006931 Bacteria 10625
34 Ga0105240_10535985 3300009093 Bacteria 1297
35 Ga0111539_10085358 3300009094 Bacteria 3711
36 Ga0114129_10004702 3300009147 Bacteria 19274
37 Ga0114129_10067072 3300009147 Bacteria 5004
38 Ga0114129_10765465 3300009147 Bacteria 1235
39 Ga0114129_10942301 3300009147 Bacteria 1091
40 Ga0114129_11084389 3300009147 Unclassified 1003
41 Ga0105238_10135640 3300009551 Bacteria 2439
42 Ga0105249_10126624 3300009553 Bacteria 2433
43 Ga0157373_10898756 3300013100 Bacteria 657
44 Ga0213872_10001133 3300021361 Bacteria 18215
45 Ga0213872_10004473 3300021361 Bacteria 7421
46 Ga0207697_10060546 3300025315 Bacteria 1574
47 Ga0207656_10094597 3300025321 Bacteria 1361
48 Ga0207645_10018690 3300025907 Bacteria 4552
49 Ga0207705_10098916 3300025909 Bacteria 2144
50 Ga0207707_10147433 3300025912 Unclassified 2057
51 Ga0207707_10435444 3300025912 Bacteria 1123
52 Ga0207695_10067458 3300025913 Bacteria 3670
53 Ga0207660_10007271 3300025917 Bacteria 7164
54 Ga0207660_10087567 3300025917 Bacteria 2301
55 Ga0207662_10159043 3300025918 Bacteria 1442
56 Ga0207657_10005468 3300025919 Bacteria 13260
57 Ga0207657_10143604 3300025919 Bacteria 1948
58 Ga0207649_10011655 3300025920 Bacteria 4857
59 Ga0207652_10002872 3300025921 Bacteria 14414
60 Ga0207652_10894063 3300025921 Bacteria 785
61 Ga0207646_10162801 3300025922 Bacteria 2014
62 Ga0207681_10012137 3300025923 Bacteria 5310
63 Ga0207700_10087471 3300025928 Bacteria 2451
64 Ga0207664_10021828 3300025929 Bacteria 4770
65 Ga0207664_10420105 3300025929 Unclassified 1191
66 Ga0207644_10027767 3300025931 Bacteria 3912
67 Ga0207690_10009984 3300025932 Bacteria 5638
68 Ga0207690_10291500 3300025932 Bacteria 1274
69 Ga0207706_10000114 3300025933 Bacteria 86582
70 Ga0207691_10035562 3300025940 Bacteria 4622
71 Ga0207679_10112204 3300025945 Bacteria 2154
72 Ga0207667_10009219 3300025949 Bacteria 11651
73 Ga0207667_10149986 3300025949 Bacteria 2400
74 Ga0207651_10213375 3300025960 Bacteria 1555
75 Ga0207639_10003824 3300026041 Bacteria 10142
76 Ga0207678_10008561 3300026067 Bacteria 9012
77 Ga0207708_10436262 3300026075 Bacteria 1088
78 Ga0207702_10025474 3300026078 Bacteria 4909
79 Ga0207702_10183666 3300026078 Bacteria 1928
80 Ga0207674_10151399 3300026116 Unclassified 2277
81 Ga0207675_100736298 3300026118 Bacteria 997
82 Ga0207698_10266705 3300026142 Bacteria 1576
83 Ga0209969_1046287 3300027360 Unclassified 679
84 Ga0209971_1026312 3300027682 Bacteria 1390
85 Ga0209971_1057527 3300027682 Bacteria 941
86 Ga0209966_1004335 3300027695 Bacteria 2405
87 Ga0209974_10012615 3300027876 Bacteria 2822
88 Ga0209974_10051806 3300027876 Bacteria 1381
89 Ga0268265_10349770 3300028380 Unclassified 1349
90 Ga0265327_10297657 3300031251 Unclassified 711
91 Ga0307408_100194273 3300031548 Bacteria 1638
92 Ga0316575_10035166 3300031665 Bacteria 1968
93 Ga0316575_10109985 3300031665 Bacteria 1124
94 Ga0316579_10001852 3300031691 Bacteria 7826
95 Ga0316578_10024754 3300031728 Bacteria 3370
96 Ga0307410_10064398 3300031852 Bacteria 2519
97 Ga0307407_10420916 3300031903 Bacteria 963
98 Ga0307409_101949996 3300031995 Bacteria 617
99 Ga0307416_101612047 3300032002 Bacteria 754
100 Ga0307414_11623528 3300032004 Bacteria 603
101 Ga0307411_10215536 3300032005 Bacteria 1486
102 Ga0307411_11665501 3300032005 Bacteria 590
103 Ga0316583_10003651 3300032133 Bacteria 5435
104 Ga0316583_10008725 3300032133 Bacteria 3658
105 Ga0373945_0300915 3300035116 Bacteria 687
106 Ga0373956_0552364 3300035119 Bacteria 550
107 Ga0373957_0200396 3300035120 Bacteria 832
108 Ga0373943_0093387 3300035170 Bacteria 1562
109 Ga0373942_0007285 3300035207 Bacteria 2563
110 Ga0316574_0064989 3300035398 Bacteria 2296
111 Ga0316574_0207653 3300035398 Unclassified 1257
112 Ga0373931_0079121 3300035691 Bacteria 1810
113 Ga0373933_0438558 3300035724 Bacteria 854
114 Ga0373933_0594849 3300035724 Unclassified 726
115 Ga0373937_0028153 3300036401 Bacteria 5084
116 Ga0373937_0063137 3300036401 Bacteria 3406
117 Ga0373937_0073697 3300036401 Bacteria 3150
118 Ga0373937_0152750 3300036401 Bacteria 2163
119 Ga0373937_0372426 3300036401 Bacteria 1354
120 Ga0373937_1478482 3300036401 Bacteria 627
121 Ga0316582_0004591 3300036647 Bacteria 6996
122 Ga0316584_0461431 3300036712 Bacteria 897
123 Ga0316581_0007079 3300037588 Bacteria 2993
124 Ga0436361_0124738 3300039447 Bacteria 1410
125 Ga0436361_0273292 3300039447 Bacteria 742
126 Ga0439434_0000107 3300042435 Bacteria 21642
127 Ga0439435_0000356 3300042436 Bacteria 6951
128 Ga0451577_0158456 3300042876 Bacteria 2038
129 Ga0451577_0230492 3300042876 Bacteria 1675
130 Ga0451577_0296110 3300042876 Bacteria 1466
131 Ga0451577_0441003 3300042876 Bacteria 1182
132 Ga0451577_0501753 3300042876 Bacteria 1102
133 Ga0453684_0097689 3300044712 Bacteria 3604
134 Ga0453684_0224100 3300044712 Bacteria 2176
135 Ga0453684_0604486 3300044712 Bacteria 1202
136 Ga0451576_1024281 3300045051 Unclassified 865
137 Ga0451576_1200633 3300045051 Bacteria 792
138 Ga0495658_0340158 3300046683 Bacteria 953
139 Ga0496101_0104248 3300048904 Unclassified 2127
140 Ga0496102_0017256 3300048905 Bacteria 6322
141 Ga0496103_0134832 3300048906 Bacteria 1578
142 Ga0496106_0006472 3300048909 Bacteria 8675
143 Ga0496107_0011039 3300048910 Bacteria 6284
144 Ga0496110_0954346 3300048913 Bacteria 764
145 Ga0501031_0342255 3300049568 Bacteria 968
146 Ga0501033_0644720 3300049570 Bacteria 724
147 Ga0501036_0253443 3300049572 Bacteria 1475
148 Ga0501037_0327523 3300049573 Bacteria 1060
149 Ga0501038_0039805 3300049574 Bacteria 4111
150 Ga0501039_0028974 3300049575 Bacteria 4264
151 Ga0501039_0126866 3300049575 Bacteria 2002
152 Ga0501040_0023745 3300049576 Bacteria 4112
153 Ga0501040_0033848 3300049576 Bacteria 3463
154 Ga0501040_0318626 3300049576 Bacteria 1112
155 Ga0501040_1088248 3300049576 Unclassified 580
156 Ga0501040_1207864 3300049576 Bacteria 549
157 Ga0501041_0083112 3300049577 Bacteria 1973
158 Ga0501041_0089968 3300049577 Bacteria 1895
159 Ga0501041_0272339 3300049577 Unclassified 1065
160 Ga0501041_0343299 3300049577 Bacteria 943
161 Ga0501042_0034610 3300049578 Bacteria 3583
162 Ga0501042_0067847 3300049578 Bacteria 2550
163 Ga0501042_1181702 3300049578 Bacteria 558
164 Ga0501046_0074124 3300049580 Bacteria 2641
165 Ga0501046_0084276 3300049580 Bacteria 2452
166 Ga0501048_0011886 3300049582 Bacteria 6492
167 Ga0501048_0203999 3300049582 Bacteria 1402
168 Ga0501048_0243067 3300049582 Bacteria 1277
169 Ga0501048_0871629 3300049582 Bacteria 647
170 Ga0501068_0114330 3300049584 Bacteria 1680
171 Ga0501071_0014144 3300049587 Bacteria 5455
172 Ga0501071_0547635 3300049587 Bacteria 889
173 Ga0501072_0568057 3300049588 Bacteria 895
174 Ga0501074_0273040 3300049590 Bacteria 1202
175 Ga0501074_0959343 3300049590 Bacteria 601
176 Ga0501075_0005179 3300049591 Bacteria 8920
177 Ga0501075_0055536 3300049591 Bacteria 2980
178 Ga0501076_0072222 3300049592 Bacteria 2761
179 Ga0501076_0390878 3300049592 Bacteria 1143
180 Ga0501076_0695567 3300049592 Bacteria 839
181 Ga0501077_0062002 3300049593 Bacteria 2373
182 Ga0501077_0182821 3300049593 Bacteria 1332
183 Ga0501079_0007642 3300049741 Bacteria 8189
184 Ga0501079_0161789 3300049741 Bacteria 1746
185 Ga0501079_0901114 3300049741 Bacteria 696
186 Ga0501081_0415925 3300049743 Bacteria 996
187 Ga0501035_0185121 3300049822 Bacteria 1793
188 Ga0501035_0479532 3300049822 Bacteria 1026
189 Ga0501035_0783746 3300049822 Bacteria 763
190 Ga0501045_0004498 3300049824 Bacteria 9632
191 Ga0501045_0866494 3300049824 Bacteria 664
192 nmdc:mga05p37_120619_c1 3300050507 Bacteria 3221
193 nmdc:mga05p37_303_c1 3300050507 Bacteria 51679
194 nmdc:mga05p37_911971_c1 3300050507 Bacteria 946
195 nmdc:mga09592_22837_c1 3300050508 Bacteria 5162
196 nmdc:mga09592_592861_c1 3300050508 Bacteria 950
197 nmdc:mga09592_6318_c1 3300050508 Bacteria 9656
198 nmdc:mga0qj67_15824_c1 3300050509 Bacteria 5712
199 nmdc:mga0qj67_407578_c1 3300050509 Bacteria 1097
200 nmdc:mga06r32_5906_c1 3300050510 Bacteria 11020
201 nmdc:mga08y16_61709_c1 3300050511 Bacteria 3914
202 nmdc:mga0a205_1429065_c1 3300050515 Bacteria 540
203 Ga0495601_0085756 3300053077 Bacteria 2024
204 Ga0501084_0017776 3300054114 Bacteria 5917
205 Ga0501084_0121350 3300054114 Bacteria 2198
206 Ga0501084_0364402 3300054114 Bacteria 1221
207 Ga0501082_0044924 3300060353 Bacteria 3810
208 Ga0530510_0010110 3300061734 Bacteria 6613
209 Ga0530510_0105750 3300061734 Bacteria 2060

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049582 Ga0501048_0243067 Ga0501048_0243067_13_420 110
2 3300053077 Ga0495601_0085756 Ga0495601_0085756_916_1392 123
3 3300049578 Ga0501042_1181702 Ga0501042_1181702_99_482 127
4 3300005440 Ga0070705_100210702 Ga0070705_1002107022 130
5 3300005444 Ga0070694_100014651 Ga0070694_1000146513 130
6 3300005445 Ga0070708_100449171 Ga0070708_1004491712 130
7 3300005545 Ga0070695_100000748 Ga0070695_10000074816 130
8 3300005618 Ga0068864_100209289 Ga0068864_1002092893 130
9 3300006846 Ga0075430_100015902 Ga0075430_1000159026 130
10 3300006880 Ga0075429_100055953 Ga0075429_1000559533 130
11 3300009147 Ga0114129_10765465 Ga0114129_107654651 130
12 3300021361 Ga0213872_10001133 Ga0213872_100011336 130
13 3300021361 Ga0213872_10004473 Ga0213872_100044735 130
14 3300031665 Ga0316575_10109985 Ga0316575_101099851 130
15 3300035398 Ga0316574_0064989 Ga0316574_0064989_1533_1925 130
16 3300035691 Ga0373931_0079121 Ga0373931_0079121_535_930 130
17 3300039447 Ga0436361_0124738 Ga0436361_0124738_155_550 130
18 3300049592 Ga0501076_0695567 Ga0501076_0695567_23_415 130
19 3300050508 nmdc:mga09592_22837_c1 nmdc:mga09592_22837_c1_3215_3607 130
20 3300050509 nmdc:mga0qj67_15824_c1 nmdc:mga0qj67_15824_c1_87_479 130
21 3300005547 Ga0070693_100340063 Ga0070693_1003400632 131
22 3300005564 Ga0070664_100130835 Ga0070664_1001308354 131
23 3300009147 Ga0114129_10067072 Ga0114129_100670725 131
24 3300009147 Ga0114129_10942301 Ga0114129_109423012 131
25 3300009147 Ga0114129_11084389 Ga0114129_110843892 131
26 3300013100 Ga0157373_10898756 Ga0157373_108987561 131
27 3300025315 Ga0207697_10060546 Ga0207697_100605463 131
28 3300025321 Ga0207656_10094597 Ga0207656_100945972 131
29 3300025907 Ga0207645_10018690 Ga0207645_100186902 131
30 3300025912 Ga0207707_10147433 Ga0207707_101474333 131
31 3300025919 Ga0207657_10005468 Ga0207657_1000546810 131
32 3300025920 Ga0207649_10011655 Ga0207649_100116554 131
33 3300025923 Ga0207681_10012137 Ga0207681_100121372 131
34 3300025931 Ga0207644_10027767 Ga0207644_100277672 131
35 3300025932 Ga0207690_10009984 Ga0207690_100099844 131
36 3300025933 Ga0207706_10000114 Ga0207706_1000011463 131
37 3300025940 Ga0207691_10035562 Ga0207691_100355622 131
38 3300025945 Ga0207679_10112204 Ga0207679_101122043 131
39 3300025949 Ga0207667_10009219 Ga0207667_100092197 131
40 3300025960 Ga0207651_10213375 Ga0207651_102133752 131
41 3300026041 Ga0207639_10003824 Ga0207639_100038247 131
42 3300026067 Ga0207678_10008561 Ga0207678_100085619 131
43 3300026078 Ga0207702_10025474 Ga0207702_100254745 131
44 3300026116 Ga0207674_10151399 Ga0207674_101513992 131
45 3300026118 Ga0207675_100736298 Ga0207675_1007362982 131
46 3300026142 Ga0207698_10266705 Ga0207698_102667052 131
47 3300027360 Ga0209969_1046287 Ga0209969_10462872 131
48 3300027682 Ga0209971_1026312 Ga0209971_10263122 131
49 3300027682 Ga0209971_1057527 Ga0209971_10575272 131
50 3300027695 Ga0209966_1004335 Ga0209966_10043352 131
51 3300027876 Ga0209974_10012615 Ga0209974_100126152 131
52 3300027876 Ga0209974_10051806 Ga0209974_100518062 131
53 3300031665 Ga0316575_10035166 Ga0316575_100351662 131
54 3300031691 Ga0316579_10001852 Ga0316579_100018524 131
55 3300031728 Ga0316578_10024754 Ga0316578_100247544 131
56 3300031995 Ga0307409_101949996 Ga0307409_1019499961 131
57 3300032133 Ga0316583_10003651 Ga0316583_100036514 131
58 3300032133 Ga0316583_10008725 Ga0316583_100087254 131
59 3300035116 Ga0373945_0300915 Ga0373945_0300915_266_661 131
60 3300035170 Ga0373943_0093387 Ga0373943_0093387_530_925 131
61 3300035207 Ga0373942_0007285 Ga0373942_0007285_251_646 131
62 3300035398 Ga0316574_0207653 Ga0316574_0207653_833_1240 131
63 3300036401 Ga0373937_0063137 Ga0373937_0063137_1586_1993 131
64 3300036401 Ga0373937_0073697 Ga0373937_0073697_2227_2622 131
65 3300036401 Ga0373937_1478482 Ga0373937_1478482_158_553 131
66 3300036647 Ga0316582_0004591 Ga0316582_0004591_5831_6238 131
67 3300036712 Ga0316584_0461431 Ga0316584_0461431_374_781 131
68 3300037588 Ga0316581_0007079 Ga0316581_0007079_1419_1826 131
69 3300042876 Ga0451577_0158456 Ga0451577_0158456_759_1154 131
70 3300042876 Ga0451577_0230492 Ga0451577_0230492_725_1120 131
71 3300042876 Ga0451577_0501753 Ga0451577_0501753_337_732 131
72 3300044712 Ga0453684_0224100 Ga0453684_0224100_918_1313 131
73 3300046683 Ga0495658_0340158 Ga0495658_0340158_539_934 131
74 3300048904 Ga0496101_0104248 Ga0496101_0104248_735_1136 131
75 3300048905 Ga0496102_0017256 Ga0496102_0017256_2887_3288 131
76 3300048906 Ga0496103_0134832 Ga0496103_0134832_278_679 131
77 3300048909 Ga0496106_0006472 Ga0496106_0006472_2193_2594 131
78 3300048910 Ga0496107_0011039 Ga0496107_0011039_2492_2893 131
79 3300048913 Ga0496110_0954346 Ga0496110_0954346_103_504 131
80 3300049576 Ga0501040_0318626 Ga0501040_0318626_508_903 131
81 3300049576 Ga0501040_1207864 Ga0501040_1207864_122_517 131
82 3300049577 Ga0501041_0272339 Ga0501041_0272339_542_937 131
83 3300049578 Ga0501042_0034610 Ga0501042_0034610_2529_2924 131
84 3300049588 Ga0501072_0568057 Ga0501072_0568057_187_582 131
85 3300049741 Ga0501079_0161789 Ga0501079_0161789_1146_1541 131
86 3300049743 Ga0501081_0415925 Ga0501081_0415925_269_664 131
87 3300049822 Ga0501035_0479532 Ga0501035_0479532_529_924 131
88 3300049822 Ga0501035_0783746 Ga0501035_0783746_153_548 131
89 3300050507 nmdc:mga05p37_120619_c1 nmdc:mga05p37_120619_c1_14_409 131
90 3300050515 nmdc:mga0a205_1429065_c1 nmdc:mga0a205_1429065_c1_101_508 131
91 3300054114 Ga0501084_0121350 Ga0501084_0121350_642_1037 131
92 3300006846 Ga0075430_100069351 Ga0075430_1000693512 132
93 3300006880 Ga0075429_100481767 Ga0075429_1004817672 132
94 3300006881 Ga0068865_100931255 Ga0068865_1009312552 132
95 3300025929 Ga0207664_10420105 Ga0207664_104201052 132
96 3300031251 Ga0265327_10297657 Ga0265327_102976572 132
97 3300031548 Ga0307408_100194273 Ga0307408_1001942731 132
98 3300035119 Ga0373956_0552364 Ga0373956_0552364_126_524 132
99 3300035724 Ga0373933_0438558 Ga0373933_0438558_210_608 132
100 3300036401 Ga0373937_0152750 Ga0373937_0152750_1161_1559 132
101 3300036401 Ga0373937_0372426 Ga0373937_0372426_822_1220 132
102 3300039447 Ga0436361_0273292 Ga0436361_0273292_30_431 132
103 3300042876 Ga0451577_0296110 Ga0451577_0296110_296_694 132
104 3300049572 Ga0501036_0253443 Ga0501036_0253443_371_769 132
105 3300049573 Ga0501037_0327523 Ga0501037_0327523_302_700 132
106 3300049576 Ga0501040_0033848 Ga0501040_0033848_1868_2266 132
107 3300049577 Ga0501041_0343299 Ga0501041_0343299_398_796 132
108 3300049578 Ga0501042_0067847 Ga0501042_0067847_1471_1869 132
109 3300049580 Ga0501046_0084276 Ga0501046_0084276_1204_1602 132
110 3300049584 Ga0501068_0114330 Ga0501068_0114330_574_972 132
111 3300049590 Ga0501074_0959343 Ga0501074_0959343_110_508 132
112 3300049591 Ga0501075_0055536 Ga0501075_0055536_466_864 132
113 3300049593 Ga0501077_0182821 Ga0501077_0182821_907_1308 132
114 3300049741 Ga0501079_0901114 Ga0501079_0901114_175_576 132
115 3300049822 Ga0501035_0185121 Ga0501035_0185121_659_1057 132
116 3300049824 Ga0501045_0866494 Ga0501045_0866494_237_635 132
117 3300050508 nmdc:mga09592_592861_c1 nmdc:mga09592_592861_c1_465_863 132
118 3300050509 nmdc:mga0qj67_407578_c1 nmdc:mga0qj67_407578_c1_140_538 132
119 3300054114 Ga0501084_0364402 Ga0501084_0364402_549_947 132
120 3300061734 Ga0530510_0105750 Ga0530510_0105750_932_1330 132
121 3300005340 Ga0070689_100151423 Ga0070689_1001514233 133
122 3300005343 Ga0070687_100038165 Ga0070687_1000381653 133
123 3300005345 Ga0070692_10695147 Ga0070692_106951472 133
124 3300005406 Ga0070703_10386880 Ga0070703_103868801 133
125 3300005441 Ga0070700_100371235 Ga0070700_1003712352 133
126 3300005468 Ga0070707_100111592 Ga0070707_1001115923 133
127 3300005530 Ga0070679_101014050 Ga0070679_1010140502 133
128 3300005545 Ga0070695_100862424 Ga0070695_1008624241 133
129 3300005549 Ga0070704_100004170 Ga0070704_1000041706 133
130 3300005614 Ga0068856_100271416 Ga0068856_1002714163 133
131 3300005617 Ga0068859_100008153 Ga0068859_1000081536 133
132 3300005844 Ga0068862_100439205 Ga0068862_1004392052 133
133 3300006846 Ga0075430_100091000 Ga0075430_1000910002 133
134 3300006880 Ga0075429_100012773 Ga0075429_1000127734 133
135 3300006931 Ga0097620_100008154 Ga0097620_1000081546 133
136 3300009094 Ga0111539_10085358 Ga0111539_100853583 133
137 3300009147 Ga0114129_10004702 Ga0114129_1000470212 133
138 3300009553 Ga0105249_10126624 Ga0105249_101266243 133
139 3300025918 Ga0207662_10159043 Ga0207662_101590433 133
140 3300025921 Ga0207652_10894063 Ga0207652_108940632 133
141 3300025922 Ga0207646_10162801 Ga0207646_101628013 133
142 3300026075 Ga0207708_10436262 Ga0207708_104362622 133
143 3300026078 Ga0207702_10183666 Ga0207702_101836663 133
144 3300028380 Ga0268265_10349770 Ga0268265_103497702 133
145 3300031852 Ga0307410_10064398 Ga0307410_100643983 133
146 3300031903 Ga0307407_10420916 Ga0307407_104209162 133
147 3300032004 Ga0307414_11623528 Ga0307414_116235281 133
148 3300032005 Ga0307411_10215536 Ga0307411_102155362 133
149 3300045051 Ga0451576_1200633 Ga0451576_1200633_306_707 133
150 3300049576 Ga0501040_1088248 Ga0501040_1088248_130_540 133
151 3300049582 Ga0501048_0203999 Ga0501048_0203999_215_616 133
152 3300050507 nmdc:mga05p37_303_c1 nmdc:mga05p37_303_c1_734_1135 133
153 3300050508 nmdc:mga09592_6318_c1 nmdc:mga09592_6318_c1_3776_4177 133
154 3300050510 nmdc:mga06r32_5906_c1 nmdc:mga06r32_5906_c1_5435_5836 133
155 3300050511 nmdc:mga08y16_61709_c1 nmdc:mga08y16_61709_c1_1225_1626 133
156 3300009093 Ga0105240_10535985 Ga0105240_105359852 134
157 3300025917 Ga0207660_10007271 Ga0207660_100072715 134
158 3300025921 Ga0207652_10002872 Ga0207652_100028724 134
159 3300025932 Ga0207690_10291500 Ga0207690_102915002 134
160 3300032005 Ga0307411_11665501 Ga0307411_116655012 134
161 3300044712 Ga0453684_0604486 Ga0453684_0604486_106_525 134
162 3300049582 Ga0501048_0871629 Ga0501048_0871629_196_609 134
163 3300006028 Ga0070717_11118713 Ga0070717_111187132 135
164 3300025928 Ga0207700_10087471 Ga0207700_100874713 135
165 3300032002 Ga0307416_101612047 Ga0307416_1016120471 135
166 3300035120 Ga0373957_0200396 Ga0373957_0200396_139_552 135
167 3300035724 Ga0373933_0594849 Ga0373933_0594849_227_634 135
168 3300036401 Ga0373937_0028153 Ga0373937_0028153_2847_3254 135
169 3300042435 Ga0439434_0000107 Ga0439434_0000107_6480_6914 135
170 3300042436 Ga0439435_0000356 Ga0439435_0000356_6302_6736 135
171 3300045051 Ga0451576_1024281 Ga0451576_1024281_200_607 135
172 3300005327 Ga0070658_10639713 Ga0070658_106397132 136
173 3300005339 Ga0070660_100091498 Ga0070660_1000914983 136
174 3300005458 Ga0070681_10484887 Ga0070681_104848872 136
175 3300005530 Ga0070679_100005073 Ga0070679_1000050736 136
176 3300005563 Ga0068855_100052545 Ga0068855_1000525455 136
177 3300009551 Ga0105238_10135640 Ga0105238_101356403 136
178 3300025909 Ga0207705_10098916 Ga0207705_100989163 136
179 3300025912 Ga0207707_10435444 Ga0207707_104354442 136
180 3300025913 Ga0207695_10067458 Ga0207695_100674585 136
181 3300025917 Ga0207660_10087567 Ga0207660_100875673 136
182 3300025919 Ga0207657_10143604 Ga0207657_101436043 136
183 3300025929 Ga0207664_10021828 Ga0207664_100218285 136
184 3300025949 Ga0207667_10149986 Ga0207667_101499862 136
185 3300042876 Ga0451577_0441003 Ga0451577_0441003_40_471 136
186 3300044712 Ga0453684_0097689 Ga0453684_0097689_1939_2349 136
187 3300049568 Ga0501031_0342255 Ga0501031_0342255_450_935 136
188 3300049570 Ga0501033_0644720 Ga0501033_0644720_88_573 136
189 3300049574 Ga0501038_0039805 Ga0501038_0039805_2396_2881 136
190 3300049575 Ga0501039_0028974 Ga0501039_0028974_596_1081 136
191 3300049575 Ga0501039_0126866 Ga0501039_0126866_584_1069 136
192 3300049576 Ga0501040_0023745 Ga0501040_0023745_426_911 136
193 3300049577 Ga0501041_0083112 Ga0501041_0083112_72_557 136
194 3300049577 Ga0501041_0089968 Ga0501041_0089968_1146_1631 136
195 3300049580 Ga0501046_0074124 Ga0501046_0074124_1697_2182 136
196 3300049582 Ga0501048_0011886 Ga0501048_0011886_365_850 136
197 3300049587 Ga0501071_0014144 Ga0501071_0014144_2868_3353 136
198 3300049587 Ga0501071_0547635 Ga0501071_0547635_106_591 136
199 3300049590 Ga0501074_0273040 Ga0501074_0273040_490_975 136
200 3300049591 Ga0501075_0005179 Ga0501075_0005179_1324_1809 136
201 3300049592 Ga0501076_0072222 Ga0501076_0072222_222_707 136
202 3300049592 Ga0501076_0390878 Ga0501076_0390878_159_644 136
203 3300049593 Ga0501077_0062002 Ga0501077_0062002_301_786 136
204 3300049741 Ga0501079_0007642 Ga0501079_0007642_7091_7576 136
205 3300049824 Ga0501045_0004498 Ga0501045_0004498_3976_4461 136
206 3300050507 nmdc:mga05p37_911971_c1 nmdc:mga05p37_911971_c1_15_434 136
207 3300054114 Ga0501084_0017776 Ga0501084_0017776_5240_5725 136
208 3300060353 Ga0501082_0044924 Ga0501082_0044924_1484_1969 136
209 3300061734 Ga0530510_0010110 Ga0530510_0010110_5020_5505 136

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01042

Ribonuc_L-PSP

Endoribonuclease L-PSP

9

129

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
2dyy-assembly3.cif.gz_G crystal structure of putative translation initiation inhibitor ph0854 from pyrococcus horikoshii 0.8922 1 130
5hp7-assembly1.cif.gz_A crystal structures of rida in the apo form 0.892 16 129
3m4s-assembly2.cif.gz_F crystal structure of a putative endoribonuclease l-psp from entamoeba histolytica, orthorhombic form 0.8901 2 129
2dyy-assembly1.cif.gz_A crystal structure of putative translation initiation inhibitor ph0854 from pyrococcus horikoshii 0.8896 2 130
1x25-assembly2.cif.gz_B crystal structure of a member of yjgf family from sulfolobus tokodaii (st0811) 0.8878 2 128
ID Description Score Start End Superfamily
2dyyG00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.8922 1 130 3.30.1330.40
5hp8A00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.8884 16 129 3.30.1330.40
2dyyG00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.8856 1 130 3.30.1330.40
3k0tB00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.8853 1 129 3.30.1330.40
3i7tA00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.8835 13 129 3.30.1330.40
ID Description Score Start End GO Terms
AF-A0A0C2V0L1-F1-model_v4 Bona fide RidA/YjgF/TdcF/RutC subgroup 0.9836 2 131
AF-S6GS04-F1-model_v4 Uncharacterized protein 0.9827 1 129
AF-A0A527W0G0-F1-model_v4 RidA family protein 0.9801 25 131 GO:0005829
GO:0019239
AF-A0A7C7UY16-F1-model_v4 RidA family protein 0.9757 1 130
AF-A0A4R6VKS3-F1-model_v4 Enamine deaminase RidA (YjgF/YER057c/UK114 family) 0.9752 2 132

Feature Viewer

pLDDT pTM Quality
93.58 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map