F318931

General Info

Members Datasets Scaffolds Average Seq Length
209 147 175 242

Family's Representative Sequence

Representative Sequence 3300006038|Ga0075365_10070132|Ga0075365_100701323
Length 267
Sequence VSAPQGPAGALVQAETMIVLFTDFGLQGPYTGQMKAVLHQIAPGIPAIDLFADAPVGNPKASAYLLAVYAEWFPAETVFLCVVDPGVGGTRPCMIVEADGRWYVGPGNGLFELIQRRARKARGWDIDWKPERLSASFHGRDLFAPVAAMLARGEPPFGQPRTDDADRRPDWPDDLCEIVYVDHFGNAMTGLRAAMLPPDARLAASGRVLQRERTFSDRAPGVAFWYENSNGLAEIAVNQGRADRDLALAIGSRVEIVSRAKAAPSRA

Samples

Sample ID Description Type Environment
1 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
2 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
3 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
4 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
5 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
6 2791355199
7 2842333319 Skermanella aerolata SEMIA 4010 Isolate Nodule
8 2848858292 Azospirillum brasilense Az39 Isolate Unclassified
9 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
10 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
11 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
12 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
13 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
14 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
15 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
16 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
17 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
18 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
19 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
20 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
21 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
22 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
23 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
24 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
25 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
26 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
27 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
28 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
29 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
30 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
31 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
32 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
33 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
34 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
35 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
36 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
37 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
38 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
39 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
40 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
41 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
42 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
43 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
44 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
45 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
46 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
47 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
48 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
49 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
50 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
54 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
55 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
56 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
57 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
58 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
59 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
60 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
61 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
62 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
63 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
64 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
65 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
66 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
67 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
68 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
69 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
70 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
71 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
72 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
75 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
76 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
77 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
78 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
79 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
80 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
81 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
82 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
95 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
96 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
97 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
98 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
99 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
100 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
101 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
102 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
103 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
104 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
105 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
106 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
107 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
108 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
109 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
110 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
111 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
112 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
113 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
114 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
115 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
116 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
117 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
118 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
119 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
120 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
121 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
122 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
123 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
124 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
125 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
126 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
127 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
128 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
129 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
130 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
131 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
132 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
133 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
134 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
135 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
136 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
137 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
138 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
139 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
140 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
141 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
142 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
143 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
144 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
145 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
146 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
147 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 84.13
Metatranscriptomes 0
Isolates 15.87

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.83
Nodule 11.96
Rhizoplane 5.74
Rhizosphere 72.73
Stem 0
Stem Tuber 0
Unclassified 5.74

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070670_100483978 3300005331 Bacteria 1099
2 Ga0070660_100508643 3300005339 Bacteria 1002
3 Ga0070689_100262880 3300005340 Bacteria 1427
4 Ga0070674_100039088 3300005356 Bacteria 3203
5 Ga0070709_10008556 3300005434 Bacteria 5626
6 Ga0070714_100033710 3300005435 Bacteria 4283
7 Ga0070713_100072739 3300005436 Bacteria 2908
8 Ga0070710_10034325 3300005437 Bacteria 2759
9 Ga0070711_100022476 3300005439 Bacteria 4088
10 Ga0070700_100264856 3300005441 Unclassified 1239
11 Ga0070706_100028563 3300005467 Bacteria 5136
12 Ga0070706_100035717 3300005467 Bacteria 4588
13 Ga0070706_100060940 3300005467 Bacteria 3483
14 Ga0070707_100183263 3300005468 Bacteria 2041
15 Ga0070707_100457768 3300005468 Bacteria 1236
16 Ga0070698_100008108 3300005471 Bacteria 11357
17 Ga0070698_100058370 3300005471 Bacteria 3902
18 Ga0070699_100094460 3300005518 Bacteria 2618
19 Ga0070699_100156386 3300005518 Bacteria 2017
20 Ga0070684_100001343 3300005535 Bacteria 17625
21 Ga0070697_100036847 3300005536 Bacteria 3951
22 Ga0070697_100038707 3300005536 Bacteria 3854
23 Ga0070697_100081780 3300005536 Bacteria 2661
24 Ga0070696_100268883 3300005546 Bacteria 1296
25 Ga0070704_100511951 3300005549 Bacteria 1043
26 Ga0068863_100121957 3300005841 Bacteria 2486
27 Ga0068858_100721933 3300005842 Bacteria 970
28 Ga0081455_10001860 3300005937 Bacteria 25395
29 Ga0081455_10023060 3300005937 Bacteria 5800
30 Ga0081538_10008732 3300005981 Bacteria 8550
31 Ga0081538_10031315 3300005981 Bacteria 3590
32 Ga0081538_10037778 3300005981 Bacteria 3125
33 Ga0081538_10076565 3300005981 Bacteria 1807
34 Ga0081539_10009656 3300005985 Bacteria 7999
35 Ga0070717_10078625 3300006028 Bacteria 2764
36 Ga0075365_10070132 3300006038 Bacteria 2357
37 Ga0075364_10050959 3300006051 Bacteria 2702
38 Ga0070715_10015120 3300006163 Bacteria 2872
39 Ga0070716_100013161 3300006173 Bacteria 4212
40 Ga0070716_100028607 3300006173 Bacteria 3004
41 Ga0070712_100012125 3300006175 Bacteria 5477
42 Ga0070712_100138359 3300006175 Bacteria 1855
43 Ga0075427_10007749 3300006194 Bacteria 1582
44 Ga0075428_100132704 3300006844 Bacteria 2708
45 Ga0075428_100133810 3300006844 Bacteria 2696
46 Ga0075430_100154208 3300006846 Bacteria 1912
47 Ga0075431_100006794 3300006847 Bacteria 11364
48 Ga0075431_100032324 3300006847 Bacteria 5392
49 Ga0075431_100157927 3300006847 Bacteria 2333
50 Ga0075431_100334484 3300006847 Bacteria 1525
51 Ga0075431_100370021 3300006847 Bacteria 1438
52 Ga0075433_10075200 3300006852 Bacteria 2972
53 Ga0075433_10336118 3300006852 Bacteria 1335
54 Ga0075434_100076558 3300006871 Bacteria 3341
55 Ga0075434_100715388 3300006871 Bacteria 1019
56 Ga0075429_100053165 3300006880 Bacteria 3524
57 Ga0075435_100429260 3300007076 Bacteria 1139
58 Ga0099794_10012485 3300007265 Bacteria 3668
59 Ga0105240_10099004 3300009093 Bacteria 3550
60 Ga0111539_10149028 3300009094 Bacteria 2739
61 Ga0114129_10054021 3300009147 Bacteria 5633
62 Ga0114129_10181756 3300009147 Bacteria 2861
63 Ga0114129_10334720 3300009147 Bacteria 2009
64 Ga0114129_10363947 3300009147 Bacteria 1913
65 Ga0114129_10646272 3300009147 Bacteria 1366
66 Ga0114129_10952511 3300009147 Bacteria 1084
67 Ga0105248_10331539 3300009177 Bacteria 1714
68 Ga0157374_10047438 3300013296 Bacteria 3983
69 Ga0163162_10070559 3300013306 Bacteria 3545
70 Ga0157375_10055320 3300013308 Bacteria 3912
71 Ga0163163_10003827 3300014325 Bacteria 12814
72 Ga0157379_10641991 3300014968 Bacteria 993
73 Ga0157376_10080347 3300014969 Bacteria 2797
74 Ga0213871_10011401 3300021441 Bacteria 2041
75 Ga0213871_10043278 3300021441 Bacteria 1215
76 Ga0207692_10000821 3300025898 Bacteria 11129
77 Ga0207685_10001017 3300025905 Bacteria 5459
78 Ga0207684_10062938 3300025910 Bacteria 3150
79 Ga0207684_10329223 3300025910 Bacteria 1316
80 Ga0207693_10008424 3300025915 Bacteria 8435
81 Ga0207693_10012052 3300025915 Bacteria 6992
82 Ga0207693_10017855 3300025915 Bacteria 5657
83 Ga0207663_10008722 3300025916 Bacteria 5323
84 Ga0207663_10155117 3300025916 Bacteria 1610
85 Ga0207664_10030030 3300025929 Bacteria 4148
86 Ga0207664_10337990 3300025929 Bacteria 1331
87 Ga0207670_10386375 3300025936 Bacteria 1116
88 Ga0207665_10025087 3300025939 Bacteria 3932
89 Ga0207711_10422168 3300025941 Bacteria 1240
90 Ga0207661_10003175 3300025944 Bacteria 11398
91 Ga0207703_10535602 3300026035 Bacteria 1103
92 Ga0207708_10300951 3300026075 Unclassified 1304
93 Ga0316575_10052642 3300031665 Bacteria 1621
94 Ga0307407_10286647 3300031903 Bacteria 1143
95 Ga0307409_100435076 3300031995 Bacteria 1262
96 Ga0307416_101183596 3300032002 Bacteria 870
97 Ga0307414_10227046 3300032004 Bacteria 1537
98 Ga0307414_10301902 3300032004 Bacteria 1355
99 Ga0307411_10439274 3300032005 Bacteria 1089
100 Ga0315911_1000027 3300033442 Bacteria 85143
101 Ga0373936_0210521 3300035113 Bacteria 860
102 Ga0373961_0016263 3300035241 Bacteria 1915
103 Ga0316574_0031246 3300035398 Bacteria 3230
104 Ga0316574_0115960 3300035398 Bacteria 1718
105 Ga0316582_0165331 3300036647 Bacteria 1500
106 Ga0316584_0074729 3300036712 Bacteria 2541
107 Ga0395900_0942360 3300037418 Bacteria 785
108 Ga0395898_0079619 3300037466 Bacteria 3161
109 Ga0395905_0060317 3300037471 Bacteria 3547
110 Ga0395901_0257702 3300038443 Bacteria 1816
111 Ga0436360_0610807 3300039438 Bacteria 2645
112 Ga0436360_0615488 3300039438 Bacteria 3948
113 Ga0436360_0895091 3300039438 Bacteria 3642
114 Ga0436361_0011160 3300039447 Bacteria 1446
115 Ga0436361_0720566 3300039447 Bacteria 2420
116 Ga0436361_0939444 3300039447 Bacteria 2644
117 Ga0436361_1126581 3300039447 Bacteria 3183
118 Ga0436363_0265895 3300039450 Bacteria 997
119 Ga0436363_0913728 3300039450 Bacteria 943
120 Ga0436363_1349736 3300039450 Bacteria 872
121 Ga0436362_0048844 3300039453 Bacteria 2084
122 Ga0439435_0109535 3300042436 Bacteria 856
123 Ga0453684_0014428 3300044712 Bacteria 12643
124 Ga0453684_0015104 3300044712 Bacteria 12252
125 Ga0451576_0142039 3300045051 Bacteria 2503
126 Ga0495580_0147628 3300046472 Bacteria 1630
127 Ga0495633_0127014 3300046558 Bacteria 1180
128 Ga0496104_0019424 3300048907 Bacteria 6218
129 Ga0496105_0182361 3300048908 Bacteria 1719
130 Ga0496105_0242307 3300048908 Bacteria 1463
131 Ga0496106_0013966 3300048909 Bacteria 5939
132 Ga0496107_0179683 3300048910 Bacteria 1571
133 Ga0496109_0038622 3300048912 Bacteria 4317
134 Ga0496110_0125968 3300048913 Bacteria 2311
135 Ga0496110_0271907 3300048913 Bacteria 1543
136 Ga0496112_0172920 3300048915 Bacteria 2125
137 Ga0496115_0029355 3300048918 Bacteria 4319
138 Ga0496115_0630216 3300048918 Bacteria 850
139 Ga0501032_0319509 3300049569 Bacteria 1002
140 Ga0501034_0022312 3300049571 Bacteria 6453
141 Ga0501043_0436579 3300049579 Bacteria 986
142 Ga0501047_0013034 3300049581 Bacteria 7875
143 Ga0501070_0726084 3300049586 Bacteria 784
144 Ga0501071_0801629 3300049587 Unclassified 726
145 nmdc:mga00v17_14463_c1 3300050491 Bacteria 4404
146 nmdc:mga0yw44_13908_c1 3300050492 Bacteria 4254
147 nmdc:mga0yw44_82320_c1 3300050492 Bacteria 2019
148 nmdc:mga05p37_11830_c1 3300050507 Bacteria 10401
149 nmdc:mga05p37_325435_c1 3300050507 Bacteria 1818
150 nmdc:mga05p37_460541_c1 3300050507 Bacteria 1470
151 nmdc:mga05p37_48845_c1 3300050507 Bacteria 5204
152 nmdc:mga05p37_491186_c1 3300050507 Bacteria 1411
153 nmdc:mga05p37_91597_c2 3300050507 Bacteria 3145
154 nmdc:mga09592_176678_c1 3300050508 Bacteria 1847
155 nmdc:mga0qj67_101820_c1 3300050509 Bacteria 2316
156 nmdc:mga0qj67_118034_c1 3300050509 Bacteria 2144
157 nmdc:mga06r32_160033_c1 3300050510 Bacteria 2234
158 nmdc:mga06r32_219557_c1 3300050510 Bacteria 1889
159 nmdc:mga06r32_223763_c1 3300050510 Bacteria 1870
160 nmdc:mga06r32_237407_c1 3300050510 Bacteria 1811
161 nmdc:mga06r32_33656_c1 3300050510 Bacteria 4827
162 nmdc:mga08y16_156150_c1 3300050511 Bacteria 2371
163 nmdc:mga08y16_333874_c1 3300050511 Bacteria 1559
164 nmdc:mga08y16_43445_c1 3300050511 Bacteria 4710
165 nmdc:mga0n895_385567_c1 3300050512 Bacteria 1418
166 nmdc:mga0n895_44346_c1 3300050512 Bacteria 4337
167 nmdc:mga0rr50_53038_c1 3300050513 Bacteria 3016
168 nmdc:mga0rr50_8822_c1 3300050513 Bacteria 6293
169 nmdc:mga08x19_453597_c1 3300050514 Bacteria 903
170 nmdc:mga0a205_120429_c1 3300050515 Bacteria 2524
171 nmdc:mga0a205_226519_c1 3300050515 Bacteria 1754
172 nmdc:mga0a205_546036_c1 3300050515 Bacteria 1014
173 Ga0500578_0145344 3300053086 Bacteria 1480
174 Ga0500577_0015758 3300053142 Bacteria 2369
175 Ga0500609_001402 3300053731 Bacteria 3539

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300036712 Ga0316584_0074729 Ga0316584_0074729_1662_2321 212
2 iso_pu_bacteria 2889033259 2889038580 221
3 3300009094 Ga0111539_10149028 Ga0111539_101490284 225
4 3300009147 Ga0114129_10181756 Ga0114129_101817563 225
5 3300049587 Ga0501071_0801629 Ga0501071_0801629_21_707 225
6 3300053142 Ga0500577_0015758 Ga0500577_0015758_41_718 225
7 iso_pu_bacteria 2599185301 2599940636 227
8 iso_pu_bacteria 2881147464 2881154662 229
9 3300005441 Ga0070700_100264856 Ga0070700_1002648561 233
10 3300026075 Ga0207708_10300951 Ga0207708_103009513 233
11 3300049569 Ga0501032_0319509 Ga0501032_0319509_23_844 234
12 3300049571 Ga0501034_0022312 Ga0501034_0022312_1128_1949 234
13 3300049579 Ga0501043_0436579 Ga0501043_0436579_179_943 234
14 3300049581 Ga0501047_0013034 Ga0501047_0013034_251_1072 234
15 iso_pu_bacteria 2871495908 2871496226 235
16 iso_pu_bacteria 2878760144 2878760455 235
17 iso_pu_bacteria 2878767105 2878767418 235
18 iso_pu_bacteria 2885305155 2885308887 235
19 iso_pu_bacteria 2885326080 2885327010 235
20 iso_pu_bacteria 2903540706 2903541020 235
21 3300006847 Ga0075431_100370021 Ga0075431_1003700212 237
22 3300044712 Ga0453684_0014428 Ga0453684_0014428_371_1090 237
23 iso_pu_bacteria 2524023205 2524436654 237
24 iso_pu_bacteria 2751185821 2753463749 237
25 iso_pu_bacteria 2513237101 2513696664 238
26 iso_pu_bacteria 2721755755 2723846693 238
27 iso_pu_bacteria 2791355199 2793077722 238
28 iso_pu_bacteria 2842333319 2842335464 238
29 iso_pu_bacteria 2848858292 2848858338 238
30 iso_pu_bacteria 2874123672 2874127802 238
31 iso_pu_bacteria 2874168670 2874170101 238
32 iso_pu_bacteria 2874612657 2874616427 238
33 iso_pu_bacteria 2876761206 2876768897 238
34 iso_pu_bacteria 2879110137 2879116084 238
35 iso_pu_bacteria 2885374607 2885375707 238
36 iso_pu_bacteria 2885409591 2885410014 238
37 iso_pu_bacteria 2885409591 2885415994 238
38 iso_pu_bacteria 2903768456 2903772937 238
39 iso_pu_bacteria 2906643746 2906646327 238
40 iso_pu_bacteria 2958165035 2958165353 238
41 iso_pu_bacteria 2961163497 2961163811 238
42 iso_pu_bacteria 2965018300 2965018616 238
43 iso_pu_bacteria 2968171901 2968172217 238
44 iso_pu_bacteria 2970554993 2970555307 238
45 iso_pu_bacteria 2987659509 2987659823 238
46 iso_pu_bacteria 3004188549 3004188870 238
47 iso_pu_bacteria 8006964411 8006972537 238
48 3300031995 Ga0307409_100435076 Ga0307409_1004350762 239
49 3300037418 Ga0395900_0942360 Ga0395900_0942360_10_729 239
50 3300038443 Ga0395901_0257702 Ga0395901_0257702_775_1494 239
51 3300031665 Ga0316575_10052642 Ga0316575_100526421 240
52 3300035241 Ga0373961_0016263 Ga0373961_0016263_489_1268 240
53 3300046558 Ga0495633_0127014 Ga0495633_0127014_90_830 240
54 3300006847 Ga0075431_100032324 Ga0075431_1000323246 241
55 3300009147 Ga0114129_10334720 Ga0114129_103347205 241
56 3300009147 Ga0114129_10952511 Ga0114129_109525111 241
57 3300039438 Ga0436360_0895091 Ga0436360_0895091_649_1374 241
58 3300039447 Ga0436361_0720566 Ga0436361_0720566_106_831 241
59 3300039450 Ga0436363_0265895 Ga0436363_0265895_35_760 241
60 3300039450 Ga0436363_1349736 Ga0436363_1349736_112_837 241
61 3300044712 Ga0453684_0015104 Ga0453684_0015104_7648_8376 241
62 3300049586 Ga0501070_0726084 Ga0501070_0726084_29_769 241
63 3300050507 nmdc:mga05p37_11830_c1 nmdc:mga05p37_11830_c1_9615_10340 241
64 3300050507 nmdc:mga05p37_491186_c1 nmdc:mga05p37_491186_c1_177_902 241
65 3300050509 nmdc:mga0qj67_118034_c1 nmdc:mga0qj67_118034_c1_981_1706 241
66 3300050510 nmdc:mga06r32_33656_c1 nmdc:mga06r32_33656_c1_2375_3100 241
67 3300005331 Ga0070670_100483978 Ga0070670_1004839781 242
68 3300005339 Ga0070660_100508643 Ga0070660_1005086432 242
69 3300005340 Ga0070689_100262880 Ga0070689_1002628801 242
70 3300005356 Ga0070674_100039088 Ga0070674_1000390885 242
71 3300005434 Ga0070709_10008556 Ga0070709_100085562 242
72 3300005435 Ga0070714_100033710 Ga0070714_1000337103 242
73 3300005436 Ga0070713_100072739 Ga0070713_1000727392 242
74 3300005437 Ga0070710_10034325 Ga0070710_100343252 242
75 3300005439 Ga0070711_100022476 Ga0070711_1000224764 242
76 3300005467 Ga0070706_100028563 Ga0070706_1000285634 242
77 3300005467 Ga0070706_100035717 Ga0070706_1000357177 242
78 3300005467 Ga0070706_100060940 Ga0070706_1000609403 242
79 3300005468 Ga0070707_100183263 Ga0070707_1001832631 242
80 3300005468 Ga0070707_100457768 Ga0070707_1004577682 242
81 3300005471 Ga0070698_100008108 Ga0070698_1000081085 242
82 3300005471 Ga0070698_100058370 Ga0070698_1000583702 242
83 3300005518 Ga0070699_100094460 Ga0070699_1000944601 242
84 3300005518 Ga0070699_100156386 Ga0070699_1001563863 242
85 3300005535 Ga0070684_100001343 Ga0070684_1000013439 242
86 3300005536 Ga0070697_100036847 Ga0070697_1000368476 242
87 3300005536 Ga0070697_100038707 Ga0070697_1000387073 242
88 3300005536 Ga0070697_100081780 Ga0070697_1000817803 242
89 3300005546 Ga0070696_100268883 Ga0070696_1002688832 242
90 3300005549 Ga0070704_100511951 Ga0070704_1005119511 242
91 3300005841 Ga0068863_100121957 Ga0068863_1001219573 242
92 3300005842 Ga0068858_100721933 Ga0068858_1007219332 242
93 3300005937 Ga0081455_10001860 Ga0081455_1000186021 242
94 3300005937 Ga0081455_10023060 Ga0081455_100230607 242
95 3300005981 Ga0081538_10008732 Ga0081538_1000873210 242
96 3300005981 Ga0081538_10031315 Ga0081538_100313153 242
97 3300005981 Ga0081538_10037778 Ga0081538_100377782 242
98 3300005981 Ga0081538_10076565 Ga0081538_100765651 242
99 3300005985 Ga0081539_10009656 Ga0081539_100096564 242
100 3300006028 Ga0070717_10078625 Ga0070717_100786252 242
101 3300006038 Ga0075365_10070132 Ga0075365_100701323 242
102 3300006051 Ga0075364_10050959 Ga0075364_100509593 242
103 3300006163 Ga0070715_10015120 Ga0070715_100151202 242
104 3300006173 Ga0070716_100013161 Ga0070716_1000131613 242
105 3300006173 Ga0070716_100028607 Ga0070716_1000286074 242
106 3300006175 Ga0070712_100012125 Ga0070712_1000121254 242
107 3300006175 Ga0070712_100138359 Ga0070712_1001383592 242
108 3300006194 Ga0075427_10007749 Ga0075427_100077492 242
109 3300006844 Ga0075428_100132704 Ga0075428_1001327043 242
110 3300006844 Ga0075428_100133810 Ga0075428_1001338104 242
111 3300006846 Ga0075430_100154208 Ga0075430_1001542083 242
112 3300006847 Ga0075431_100006794 Ga0075431_1000067942 242
113 3300006847 Ga0075431_100157927 Ga0075431_1001579273 242
114 3300006847 Ga0075431_100334484 Ga0075431_1003344841 242
115 3300006852 Ga0075433_10075200 Ga0075433_100752003 242
116 3300006852 Ga0075433_10336118 Ga0075433_103361182 242
117 3300006871 Ga0075434_100076558 Ga0075434_1000765584 242
118 3300006871 Ga0075434_100715388 Ga0075434_1007153881 242
119 3300006880 Ga0075429_100053165 Ga0075429_1000531654 242
120 3300007076 Ga0075435_100429260 Ga0075435_1004292601 242
121 3300007265 Ga0099794_10012485 Ga0099794_100124853 242
122 3300009093 Ga0105240_10099004 Ga0105240_100990042 242
123 3300009147 Ga0114129_10054021 Ga0114129_100540214 242
124 3300009147 Ga0114129_10363947 Ga0114129_103639472 242
125 3300009147 Ga0114129_10646272 Ga0114129_106462721 242
126 3300009177 Ga0105248_10331539 Ga0105248_103315392 242
127 3300013296 Ga0157374_10047438 Ga0157374_100474384 242
128 3300013306 Ga0163162_10070559 Ga0163162_100705591 242
129 3300013308 Ga0157375_10055320 Ga0157375_100553206 242
130 3300014325 Ga0163163_10003827 Ga0163163_100038279 242
131 3300014968 Ga0157379_10641991 Ga0157379_106419911 242
132 3300014969 Ga0157376_10080347 Ga0157376_100803472 242
133 3300021441 Ga0213871_10011401 Ga0213871_100114013 242
134 3300021441 Ga0213871_10043278 Ga0213871_100432781 242
135 3300025898 Ga0207692_10000821 Ga0207692_1000082110 242
136 3300025905 Ga0207685_10001017 Ga0207685_100010172 242
137 3300025910 Ga0207684_10062938 Ga0207684_100629384 242
138 3300025910 Ga0207684_10329223 Ga0207684_103292232 242
139 3300025915 Ga0207693_10008424 Ga0207693_100084249 242
140 3300025915 Ga0207693_10012052 Ga0207693_100120526 242
141 3300025915 Ga0207693_10017855 Ga0207693_100178556 242
142 3300025916 Ga0207663_10008722 Ga0207663_100087225 242
143 3300025916 Ga0207663_10155117 Ga0207663_101551172 242
144 3300025929 Ga0207664_10030030 Ga0207664_100300304 242
145 3300025929 Ga0207664_10337990 Ga0207664_103379901 242
146 3300025936 Ga0207670_10386375 Ga0207670_103863751 242
147 3300025939 Ga0207665_10025087 Ga0207665_100250873 242
148 3300025941 Ga0207711_10422168 Ga0207711_104221681 242
149 3300025944 Ga0207661_10003175 Ga0207661_1000317511 242
150 3300026035 Ga0207703_10535602 Ga0207703_105356021 242
151 3300031903 Ga0307407_10286647 Ga0307407_102866471 242
152 3300032002 Ga0307416_101183596 Ga0307416_1011835961 242
153 3300032004 Ga0307414_10227046 Ga0307414_102270462 242
154 3300032004 Ga0307414_10301902 Ga0307414_103019022 242
155 3300032005 Ga0307411_10439274 Ga0307411_104392741 242
156 3300033442 Ga0315911_1000027 Ga0315911_100002773 242
157 3300035113 Ga0373936_0210521 Ga0373936_0210521_93_821 242
158 3300035398 Ga0316574_0031246 Ga0316574_0031246_171_899 242
159 3300035398 Ga0316574_0115960 Ga0316574_0115960_959_1702 242
160 3300036647 Ga0316582_0165331 Ga0316582_0165331_302_1045 242
161 3300037466 Ga0395898_0079619 Ga0395898_0079619_184_912 242
162 3300037471 Ga0395905_0060317 Ga0395905_0060317_2474_3202 242
163 3300039438 Ga0436360_0610807 Ga0436360_0610807_671_1399 242
164 3300039438 Ga0436360_0615488 Ga0436360_0615488_2839_3567 242
165 3300039447 Ga0436361_0011160 Ga0436361_0011160_47_775 242
166 3300039447 Ga0436361_0939444 Ga0436361_0939444_158_886 242
167 3300039447 Ga0436361_1126581 Ga0436361_1126581_1693_2421 242
168 3300039450 Ga0436363_0913728 Ga0436363_0913728_54_782 242
169 3300039453 Ga0436362_0048844 Ga0436362_0048844_675_1418 242
170 3300042436 Ga0439435_0109535 Ga0439435_0109535_34_762 242
171 3300045051 Ga0451576_0142039 Ga0451576_0142039_722_1465 242
172 3300046472 Ga0495580_0147628 Ga0495580_0147628_25_753 242
173 3300048907 Ga0496104_0019424 Ga0496104_0019424_741_1469 242
174 3300048908 Ga0496105_0182361 Ga0496105_0182361_287_1015 242
175 3300048908 Ga0496105_0242307 Ga0496105_0242307_449_1177 242
176 3300048909 Ga0496106_0013966 Ga0496106_0013966_1355_2083 242
177 3300048910 Ga0496107_0179683 Ga0496107_0179683_47_775 242
178 3300048912 Ga0496109_0038622 Ga0496109_0038622_300_1028 242
179 3300048913 Ga0496110_0125968 Ga0496110_0125968_1217_1945 242
180 3300048913 Ga0496110_0271907 Ga0496110_0271907_84_812 242
181 3300048915 Ga0496112_0172920 Ga0496112_0172920_1219_1947 242
182 3300048918 Ga0496115_0029355 Ga0496115_0029355_1441_2169 242
183 3300048918 Ga0496115_0630216 Ga0496115_0630216_74_802 242
184 3300050491 nmdc:mga00v17_14463_c1 nmdc:mga00v17_14463_c1_948_1703 242
185 3300050492 nmdc:mga0yw44_13908_c1 nmdc:mga0yw44_13908_c1_284_1039 242
186 3300050492 nmdc:mga0yw44_82320_c1 nmdc:mga0yw44_82320_c1_300_1055 242
187 3300050507 nmdc:mga05p37_325435_c1 nmdc:mga05p37_325435_c1_422_1150 242
188 3300050507 nmdc:mga05p37_460541_c1 nmdc:mga05p37_460541_c1_580_1308 242
189 3300050507 nmdc:mga05p37_48845_c1 nmdc:mga05p37_48845_c1_3563_4291 242
190 3300050507 nmdc:mga05p37_91597_c2 nmdc:mga05p37_91597_c2_1969_2697 242
191 3300050508 nmdc:mga09592_176678_c1 nmdc:mga09592_176678_c1_219_947 242
192 3300050509 nmdc:mga0qj67_101820_c1 nmdc:mga0qj67_101820_c1_242_970 242
193 3300050510 nmdc:mga06r32_160033_c1 nmdc:mga06r32_160033_c1_172_900 242
194 3300050510 nmdc:mga06r32_219557_c1 nmdc:mga06r32_219557_c1_253_981 242
195 3300050510 nmdc:mga06r32_223763_c1 nmdc:mga06r32_223763_c1_855_1583 242
196 3300050510 nmdc:mga06r32_237407_c1 nmdc:mga06r32_237407_c1_925_1653 242
197 3300050511 nmdc:mga08y16_156150_c1 nmdc:mga08y16_156150_c1_1479_2207 242
198 3300050511 nmdc:mga08y16_333874_c1 nmdc:mga08y16_333874_c1_495_1223 242
199 3300050511 nmdc:mga08y16_43445_c1 nmdc:mga08y16_43445_c1_1564_2292 242
200 3300050512 nmdc:mga0n895_385567_c1 nmdc:mga0n895_385567_c1_571_1299 242
201 3300050512 nmdc:mga0n895_44346_c1 nmdc:mga0n895_44346_c1_1873_2601 242
202 3300050513 nmdc:mga0rr50_53038_c1 nmdc:mga0rr50_53038_c1_2184_2912 242
203 3300050513 nmdc:mga0rr50_8822_c1 nmdc:mga0rr50_8822_c1_2036_2764 242
204 3300050514 nmdc:mga08x19_453597_c1 nmdc:mga08x19_453597_c1_98_826 242
205 3300050515 nmdc:mga0a205_120429_c1 nmdc:mga0a205_120429_c1_1461_2189 242
206 3300050515 nmdc:mga0a205_226519_c1 nmdc:mga0a205_226519_c1_1001_1732 242
207 3300050515 nmdc:mga0a205_546036_c1 nmdc:mga0a205_546036_c1_214_942 242
208 3300053086 Ga0500578_0145344 Ga0500578_0145344_310_1038 242
209 3300053731 Ga0500609_001402 Ga0500609_001402_416_1144 242

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01887

SAM_HAT_N

SAM hydroxide adenosyltransferase N-terminal domain

18

159

0.95

PF20257

SAM_HAT_C

SAM hydroxide adenosyltransferase C-terminal domain

176

255

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
2zbu-assembly1.cif.gz_A crystal structure of uncharacterized conserved protein from thermotoga maritima 0.8908 1 242
2zbv-assembly1.cif.gz_C crystal structure of uncharacterized conserved protein from thermotoga maritima 0.889 1 241
2zbu-assembly1.cif.gz_A crystal structure of uncharacterized conserved protein from thermotoga maritima 0.8874 1 242
1wu8-assembly1.cif.gz_A crystal structure of project ph0463 from pyrococcus horikoshii ot3 0.8869 1 241
2zbv-assembly1.cif.gz_C crystal structure of uncharacterized conserved protein from thermotoga maritima 0.8821 1 241
ID Description Score Start End Superfamily
2q6oA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;S-adenosyl-l-methionine hydroxide adenosyltransferase, N-terminal 0.9307 2 152 3.40.50.10790
1rqpB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;S-adenosyl-l-methionine hydroxide adenosyltransferase, N-terminal 0.9271 2 152 3.40.50.10790
2zbvA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;S-adenosyl-l-methionine hydroxide adenosyltransferase, N-terminal 0.9242 1 147 3.40.50.10790
af_Q2FUT0_2_166_3.40.50.10790 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;S-adenosyl-l-methionine hydroxide adenosyltransferase, N-terminal 0.9226 2 151 3.40.50.10790
2cw5B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;S-adenosyl-l-methionine hydroxide adenosyltransferase, N-terminal 0.908 2 152 3.40.50.10790
ID Description Score Start End GO Terms
AF-A0A7C0VU24-F1-model_v4 S-adenosyl-l-methionine hydroxide adenosyltransferase N-terminal domain-containing protein 0.9917 1 143
AF-A0A529IUA0-F1-model_v4 deleted 0.9911 1 126
AF-A0A529IUA0-F1-model_v4 deleted 0.9833 1 126
AF-A0A4R8IF80-F1-model_v4 SAM-dependent chlorinase/fluorinase 0.9827 1 242
AF-A0A450TIN1-F1-model_v4 Adenosyl-chloride synthase 0.9813 1 241

Feature Viewer

pLDDT pTM Quality
93.83 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map