F318875

General Info

Members Datasets Scaffolds Average Seq Length
209 136 209 254

Family's Representative Sequence

Representative Sequence 3300005614|Ga0068856_100016851|Ga0068856_1000168513
Length 260
Sequence MAIIKKSPAEIEQMAAAGDVLVRTMNLIAAKIRPGVTTLELDLAAEKFIRSQGCEPAFKGYRGFPGSICASPNSMIVHGIPGAYTLERGDILSVDIGVVKDGWVADAARTFPVGPVSPIAQKLLAVTEESLHLAVPQCVPGNHLGDIGHAIQRYVENENGFSIVRTLVGHGVGREMHEDPQVPNYGKAGSGVLLEAGMVLAVEPMVNVGKHQVRMADDNWSIFSADGSLAAHFEFTIAVTADGPRILTPWHEAKGGRAAA

Samples

Sample ID Description Type Environment
1 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
4 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
5 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
6 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
7 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
8 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
9 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
10 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
11 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
12 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
13 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
14 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
15 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
16 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
17 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
18 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
19 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
20 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
21 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
22 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
23 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
24 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
25 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
26 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
27 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
28 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
29 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
30 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
31 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
32 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
33 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
34 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
49 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
51 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
52 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
53 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
54 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
55 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
56 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
57 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
58 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
59 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
60 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
61 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
62 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
63 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
64 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
65 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
66 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
67 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
68 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
69 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
70 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
71 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
72 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
73 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
74 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
75 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
76 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
77 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
78 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
79 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
80 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
81 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
82 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
83 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
84 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
85 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
86 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
87 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
88 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
89 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
90 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
91 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
92 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
93 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
94 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
95 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
96 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
97 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
98 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
99 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
100 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
101 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
102 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
103 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
104 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
105 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
106 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
107 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
108 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
109 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
110 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
111 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
112 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
113 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
114 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
115 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
116 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
117 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
118 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
119 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
120 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
121 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
122 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
123 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
124 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
125 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
126 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
127 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
128 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
129 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
130 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
131 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
132 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
133 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
134 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
135 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
136 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.04
Metatranscriptomes 0.96
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.78
Nodule 0
Rhizoplane 8.13
Rhizosphere 83.25
Stem 0
Stem Tuber 0
Unclassified 3.83

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJNas_1002420 3300000546 Bacteria 2248
2 Ga0070658_10007473 3300005327 Bacteria 8820
3 Ga0070691_10004069 3300005341 Bacteria 6629
4 Ga0070691_10131806 3300005341 Bacteria 1267
5 Ga0070713_100032492 3300005436 Bacteria 4169
6 Ga0070713_100073714 3300005436 Bacteria 2890
7 Ga0070711_100013725 3300005439 Bacteria 5092
8 Ga0070711_100055655 3300005439 Bacteria 2733
9 Ga0070684_100065586 3300005535 Bacteria 3187
10 Ga0070697_100690842 3300005536 Bacteria 900
11 Ga0070695_100210778 3300005545 Bacteria 1394
12 Ga0070704_100089427 3300005549 Bacteria 2291
13 Ga0070664_100085966 3300005564 Bacteria 2717
14 Ga0068856_100016851 3300005614 Bacteria 7081
15 Ga0068864_100140636 3300005618 Bacteria 2177
16 Ga0068866_10010127 3300005718 Bacteria 4031
17 Ga0081455_10030975 3300005937 Bacteria 4848
18 Ga0081455_10045120 3300005937 Bacteria 3838
19 Ga0081455_10128610 3300005937 Bacteria 1984
20 Ga0081538_10000208 3300005981 Bacteria 65347
21 Ga0081538_10012839 3300005981 Bacteria 6685
22 Ga0081538_10099371 3300005981 Bacteria 1471
23 Ga0081539_10000068 3300005985 Bacteria 240998
24 Ga0081539_10009518 3300005985 Bacteria 8098
25 Ga0081539_10019869 3300005985 Bacteria 4574
26 Ga0070717_10204366 3300006028 Bacteria 1731
27 Ga0075365_10090561 3300006038 Bacteria 2083
28 Ga0075365_10121767 3300006038 Bacteria 1800
29 Ga0075363_100181425 3300006048 Bacteria 1198
30 Ga0070712_100373515 3300006175 Bacteria 1172
31 Ga0075431_100111278 3300006847 Bacteria 2826
32 Ga0075433_10000882 3300006852 Bacteria 21089
33 Ga0075433_10264925 3300006852 Bacteria 1523
34 Ga0075434_100004237 3300006871 Bacteria 12860
35 Ga0075434_100023641 3300006871 Bacteria 5993
36 Ga0075436_100110651 3300006914 Bacteria 1917
37 Ga0075435_100005458 3300007076 Bacteria 8883
38 Ga0075435_100147603 3300007076 Bacteria 1976
39 Ga0105240_10006736 3300009093 Bacteria 16822
40 Ga0111539_10025526 3300009094 Bacteria 7244
41 Ga0111539_10109496 3300009094 Bacteria 3242
42 Ga0111539_10299410 3300009094 Bacteria 1872
43 Ga0105245_10177372 3300009098 Bacteria 2033
44 Ga0105245_10205637 3300009098 Bacteria 1892
45 Ga0105245_10235778 3300009098 Bacteria 1771
46 Ga0114129_10007041 3300009147 Bacteria 16012
47 Ga0114129_10041418 3300009147 Bacteria 6490
48 Ga0157372_10206608 3300013307 Bacteria 2275
49 Ga0206356_10449285 3300020070 Bacteria 3301
50 Ga0206350_11531494 3300020080 Bacteria 1013
51 Ga0213874_10000186 3300021377 Bacteria 11171
52 Ga0207642_10007311 3300025899 Bacteria 3722
53 Ga0207680_10010652 3300025903 Bacteria 4610
54 Ga0207671_10007459 3300025914 Bacteria 9487
55 Ga0207693_10064599 3300025915 Bacteria 2867
56 Ga0207693_10339317 3300025915 Bacteria 1176
57 Ga0207663_10005211 3300025916 Bacteria 6542
58 Ga0207663_10031921 3300025916 Bacteria 3122
59 Ga0207687_10168654 3300025927 Bacteria 1686
60 Ga0207687_10472025 3300025927 Bacteria 1043
61 Ga0207700_10011813 3300025928 Bacteria 5590
62 Ga0207700_10125575 3300025928 Bacteria 2087
63 Ga0207664_10016090 3300025929 Bacteria 5449
64 Ga0207644_10428438 3300025931 Bacteria 1085
65 Ga0207658_10109895 3300025986 Bacteria 2177
66 Ga0207708_10276216 3300026075 Bacteria 1360
67 Ga0207702_10012731 3300026078 Bacteria 7000
68 Ga0207641_10550010 3300026088 Bacteria 1126
69 Ga0207676_10055103 3300026095 Bacteria 3120
70 Ga0207428_10055488 3300027907 Bacteria 3150
71 Ga0207428_10078286 3300027907 Bacteria 2587
72 Ga0207428_10298264 3300027907 Bacteria 1193
73 Ga0268266_10001628 3300028379 Bacteria 26120
74 Ga0265318_10011443 3300028577 Bacteria 3818
75 Ga0265338_10053107 3300028800 Bacteria 3629
76 Ga0265316_10156808 3300031344 Bacteria 1703
77 Ga0265316_10398968 3300031344 Bacteria 991
78 Ga0307513_10172474 3300031456 Bacteria 2039
79 Ga0265314_10021282 3300031711 Bacteria 4991
80 Ga0316576_10000715 3300031727 Bacteria 16385
81 Ga0316577_10214013 3300031733 Bacteria 1089
82 Ga0307410_10022163 3300031852 Bacteria 3920
83 Ga0307409_100025652 3300031995 Bacteria 4139
84 Ga0307416_100075990 3300032002 Bacteria 2813
85 Ga0316584_0005866 3300036712 Bacteria 8290
86 Ga0373925_0057756 3300037068 Bacteria 2908
87 Ga0395900_0053956 3300037418 Bacteria 4138
88 Ga0395900_0297033 3300037418 Bacteria 1603
89 Ga0395898_0000942 3300037466 Bacteria 46333
90 Ga0395898_0013971 3300037466 Bacteria 8251
91 Ga0395898_0038575 3300037466 Bacteria 4734
92 Ga0395898_0042397 3300037466 Bacteria 4490
93 Ga0395898_0193205 3300037466 Bacteria 1945
94 Ga0395898_0841329 3300037466 Bacteria 857
95 Ga0395905_0213973 3300037471 Bacteria 1805
96 Ga0395901_0043546 3300038443 Bacteria 4656
97 Ga0395901_0058980 3300038443 Bacteria 3993
98 Ga0395901_0558192 3300038443 Bacteria 1160
99 Ga0436363_0136874 3300039450 Bacteria 50367
100 Ga0436363_1591320 3300039450 Bacteria 1359
101 Ga0451833_0880028 3300041491 Bacteria 1758
102 Ga0466969_0004842 3300044656 Bacteria 7166
103 Ga0466965_0041121 3300044683 Bacteria 2277
104 Ga0466963_0153384 3300044694 Bacteria 1600
105 Ga0466963_0211351 3300044694 Bacteria 1358
106 Ga0466968_0067712 3300044735 Bacteria 1549
107 Ga0466970_0044396 3300044765 Bacteria 2366
108 Ga0466960_0106980 3300044901 Bacteria 1448
109 Ga0466959_0054989 3300045049 Bacteria 2907
110 Ga0466959_0129202 3300045049 Bacteria 1791
111 Ga0466959_0300949 3300045049 Bacteria 1098
112 Ga0466958_0008849 3300045836 Bacteria 5595
113 Ga0466958_0018330 3300045836 Bacteria 4062
114 Ga0466958_0186730 3300045836 Bacteria 1316
115 Ga0466958_0226250 3300045836 Bacteria 1194
116 Ga0466967_0005406 3300045976 Bacteria 8846
117 Ga0466967_0088671 3300045976 Bacteria 2808
118 Ga0466967_0162915 3300045976 Bacteria 2094
119 Ga0466967_0213157 3300045976 Bacteria 1832
120 Ga0495653_0002457 3300046463 Bacteria 14725
121 Ga0495653_0188069 3300046463 Bacteria 1411
122 Ga0495664_0000007 3300046477 Bacteria 386710
123 Ga0495618_0067584 3300046514 Bacteria 2273
124 Ga0495618_0198853 3300046514 Bacteria 1269
125 Ga0495652_0190543 3300046529 Bacteria 1565
126 Ga0495587_0029873 3300046536 Bacteria 3307
127 Ga0495621_0002562 3300046539 Bacteria 4903
128 Ga0495645_0000033 3300046543 Bacteria 105930
129 Ga0495645_0000159 3300046543 Bacteria 46648
130 Ga0495634_0030858 3300046642 Bacteria 3696
131 Ga0495658_0132308 3300046683 Bacteria 1519
132 Ga0495669_0031979 3300046684 Bacteria 2311
133 Ga0495600_0136165 3300046809 Bacteria 1595
134 Ga0495581_0031097 3300047315 Bacteria 3093
135 Ga0495604_0000218 3300047317 Bacteria 52385
136 Ga0495674_0029830 3300047319 Bacteria 4963
137 Ga0495676_0034901 3300047321 Bacteria 4214
138 Ga0495680_0367092 3300047322 Bacteria 999
139 Ga0496100_0061790 3300048903 Bacteria 2469
140 Ga0496101_0200038 3300048904 Bacteria 1544
141 Ga0496102_0000002 3300048905 Bacteria 814588
142 Ga0496103_0000017 3300048906 Bacteria 244768
143 Ga0496104_0000001 3300048907 Bacteria 711867
144 Ga0496104_0056802 3300048907 Bacteria 3703
145 Ga0496105_0034891 3300048908 Bacteria 4139
146 Ga0496107_0133619 3300048910 Bacteria 1833
147 Ga0496108_0280495 3300048911 Bacteria 1451
148 Ga0496109_0043843 3300048912 Bacteria 4055
149 Ga0496109_0406199 3300048912 Bacteria 1287
150 Ga0496109_0533520 3300048912 Bacteria 1107
151 Ga0496109_0680794 3300048912 Bacteria 966
152 Ga0496110_0000152 3300048913 Bacteria 41561
153 Ga0496110_0731652 3300048913 Bacteria 892
154 Ga0496111_0000123 3300048914 Bacteria 33765
155 Ga0496114_0247774 3300048917 Bacteria 1567
156 Ga0496119_0015147 3300048922 Bacteria 5967
157 Ga0496121_0029534 3300048924 Bacteria 5066
158 Ga0496125_0038901 3300048928 Bacteria 4107
159 Ga0501034_0106598 3300049571 Bacteria 2795
160 Ga0501034_0313231 3300049571 Bacteria 1503
161 Ga0501034_0318354 3300049571 Bacteria 1489
162 Ga0501039_0174054 3300049575 Bacteria 1693
163 Ga0501047_0049982 3300049581 Bacteria 4037
164 Ga0501047_0231925 3300049581 Bacteria 1699
165 Ga0501068_0218742 3300049584 Bacteria 1210
166 Ga0501069_0083221 3300049585 Bacteria 1804
167 Ga0501070_0028334 3300049586 Bacteria 4697
168 Ga0501070_0520444 3300049586 Bacteria 954
169 Ga0501074_0182700 3300049590 Bacteria 1496
170 Ga0501079_0038343 3300049741 Bacteria 3695
171 Ga0501079_0472736 3300049741 Bacteria 985
172 Ga0501080_0247334 3300049742 Bacteria 1626
173 Ga0501080_0259053 3300049742 Bacteria 1585
174 Ga0501081_0434972 3300049743 Bacteria 973
175 Ga0501035_0288247 3300049822 Bacteria 1386
176 Ga0501035_0388573 3300049822 Bacteria 1163
177 Ga0501044_0114101 3300049823 Bacteria 2708
178 Ga0501044_0120027 3300049823 Bacteria 2631
179 Ga0501044_0345540 3300049823 Bacteria 1408
180 nmdc:mga0yw44_151825_c1 3300050492 Bacteria 1511
181 nmdc:mga0yw44_264277_c1 3300050492 Bacteria 1147
182 nmdc:mga0yw44_30849_c1 3300050492 Bacteria 3112
183 nmdc:mga0yw44_374609_c1 3300050492 Bacteria 961
184 nmdc:mga05p37_270980_c1 3300050507 Bacteria 2028
185 nmdc:mga05p37_59170_c1 3300050507 Bacteria 4719
186 nmdc:mga06r32_39377_c1 3300050510 Bacteria 4484
187 nmdc:mga06r32_934434_c1 3300050510 Bacteria 822
188 nmdc:mga08y16_50545_c1 3300050511 Bacteria 4351
189 nmdc:mga08y16_8814_c1 3300050511 Bacteria 10585
190 nmdc:mga0n895_1768_c1 3300050512 Bacteria 16373
191 nmdc:mga0n895_190136_c1 3300050512 Bacteria 2084
192 nmdc:mga0rr50_116385_c1 3300050513 Bacteria 2122
193 nmdc:mga0rr50_55828_c1 3300050513 Bacteria 2948
194 nmdc:mga08x19_107450_c1 3300050514 Bacteria 1858
195 nmdc:mga0a205_31967_c1 3300050515 Bacteria 5044
196 nmdc:mga0a205_460_c1 3300050515 Bacteria 31634
197 Ga0495601_0018061 3300053077 Bacteria 4288
198 Ga0495601_0168879 3300053077 Bacteria 1430
199 Ga0495601_0250656 3300053077 Bacteria 1156
200 Ga0495612_0000233 3300053078 Bacteria 23563
201 Ga0495612_0048344 3300053078 Bacteria 1744
202 Ga0495595_0272479 3300053084 Bacteria 849
203 Ga0495619_0015976 3300053085 Bacteria 4751
204 Ga0495619_0158259 3300053085 Bacteria 1564
205 Ga0500556_0000456 3300053104 Bacteria 28931
206 Ga0500616_0003004 3300053153 Bacteria 13313
207 Ga0500599_001705 3300053736 Bacteria 2564
208 Ga0501084_0609814 3300054114 Bacteria 922
209 Ga0501082_0150784 3300060353 Bacteria 2019

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006852 Ga0075433_10000882 Ga0075433_100008824 221
2 3300006871 Ga0075434_100023641 Ga0075434_1000236418 221
3 3300006914 Ga0075436_100110651 Ga0075436_1001106513 221
4 3300007076 Ga0075435_100005458 Ga0075435_10000545813 221
5 3300050507 nmdc:mga05p37_270980_c1 nmdc:mga05p37_270980_c1_1180_1956 221
6 3300050510 nmdc:mga06r32_934434_c1 nmdc:mga06r32_934434_c1_22_798 221
7 3300050512 nmdc:mga0n895_1768_c1 nmdc:mga0n895_1768_c1_322_1098 221
8 3300050513 nmdc:mga0rr50_55828_c1 nmdc:mga0rr50_55828_c1_1617_2393 221
9 3300050514 nmdc:mga08x19_107450_c1 nmdc:mga08x19_107450_c1_527_1303 221
10 3300050515 nmdc:mga0a205_460_c1 nmdc:mga0a205_460_c1_28219_28995 221
11 3300050492 nmdc:mga0yw44_30849_c1 nmdc:mga0yw44_30849_c1_2411_3091 226
12 3300046514 Ga0495618_0198853 Ga0495618_0198853_23_706 227
13 3300009094 Ga0111539_10109496 Ga0111539_101094962 228
14 3300009147 Ga0114129_10007041 Ga0114129_100070416 228
15 3300027907 Ga0207428_10078286 Ga0207428_100782865 228
16 3300050507 nmdc:mga05p37_59170_c1 nmdc:mga05p37_59170_c1_3123_3824 228
17 3300050511 nmdc:mga08y16_50545_c1 nmdc:mga08y16_50545_c1_457_1158 228
18 3300049741 Ga0501079_0472736 Ga0501079_0472736_10_762 230
19 3300053078 Ga0495612_0000233 Ga0495612_0000233_21952_22758 233
20 3300005937 Ga0081455_10128610 Ga0081455_101286104 235
21 3300048910 Ga0496107_0133619 Ga0496107_0133619_69_797 235
22 3300046543 Ga0495645_0000033 Ga0495645_0000033_33859_34665 239
23 3300005436 Ga0070713_100032492 Ga0070713_1000324925 240
24 3300005439 Ga0070711_100055655 Ga0070711_1000556555 240
25 3300005536 Ga0070697_100690842 Ga0070697_1006908421 240
26 3300005549 Ga0070704_100089427 Ga0070704_1000894273 240
27 3300007076 Ga0075435_100147603 Ga0075435_1001476033 240
28 3300020070 Ga0206356_10449285 Ga0206356_104492852 240
29 3300021377 Ga0213874_10000186 Ga0213874_1000018617 240
30 3300025914 Ga0207671_10007459 Ga0207671_100074595 240
31 3300025915 Ga0207693_10064599 Ga0207693_100645993 240
32 3300025928 Ga0207700_10011813 Ga0207700_100118136 240
33 3300031344 Ga0265316_10398968 Ga0265316_103989681 240
34 3300044694 Ga0466963_0153384 Ga0466963_0153384_752_1513 246
35 3300044694 Ga0466963_0211351 Ga0466963_0211351_407_1168 246
36 3300046683 Ga0495658_0132308 Ga0495658_0132308_264_1028 246
37 3300047315 Ga0495581_0031097 Ga0495581_0031097_606_1370 246
38 3300009094 Ga0111539_10299410 Ga0111539_102994101 247
39 3300026088 Ga0207641_10550010 Ga0207641_105500102 247
40 3300027907 Ga0207428_10298264 Ga0207428_102982642 247
41 3300037466 Ga0395898_0013971 Ga0395898_0013971_1602_2366 247
42 3300037466 Ga0395898_0841329 Ga0395898_0841329_36_800 247
43 3300038443 Ga0395901_0043546 Ga0395901_0043546_722_1486 247
44 3300045976 Ga0466967_0088671 Ga0466967_0088671_944_1714 247
45 3300046514 Ga0495618_0067584 Ga0495618_0067584_522_1286 247
46 3300047319 Ga0495674_0029830 Ga0495674_0029830_2811_3575 247
47 3300048903 Ga0496100_0061790 Ga0496100_0061790_852_1616 247
48 3300048904 Ga0496101_0200038 Ga0496101_0200038_25_789 247
49 3300048917 Ga0496114_0247774 Ga0496114_0247774_707_1471 247
50 3300049585 Ga0501069_0083221 Ga0501069_0083221_705_1469 247
51 3300049586 Ga0501070_0028334 Ga0501070_0028334_843_1607 247
52 3300049590 Ga0501074_0182700 Ga0501074_0182700_106_873 247
53 3300049742 Ga0501080_0247334 Ga0501080_0247334_573_1337 247
54 3300049742 Ga0501080_0259053 Ga0501080_0259053_641_1405 247
55 3300049823 Ga0501044_0120027 Ga0501044_0120027_649_1413 247
56 3300053077 Ga0495601_0018061 Ga0495601_0018061_2988_3752 247
57 3300053078 Ga0495612_0048344 Ga0495612_0048344_160_924 247
58 3300048912 Ga0496109_0406199 Ga0496109_0406199_362_1129 248
59 3300049571 Ga0501034_0318354 Ga0501034_0318354_304_1074 248
60 3300049575 Ga0501039_0174054 Ga0501039_0174054_593_1363 248
61 3300049581 Ga0501047_0049982 Ga0501047_0049982_3048_3818 248
62 3300049584 Ga0501068_0218742 Ga0501068_0218742_298_1068 248
63 3300049586 Ga0501070_0520444 Ga0501070_0520444_28_798 248
64 3300049822 Ga0501035_0288247 Ga0501035_0288247_543_1313 248
65 3300053077 Ga0495601_0168879 Ga0495601_0168879_261_1028 248
66 3300053084 Ga0495595_0272479 Ga0495595_0272479_33_800 248
67 3300005985 Ga0081539_10019869 Ga0081539_100198692 249
68 3300009098 Ga0105245_10205637 Ga0105245_102056373 249
69 3300005981 Ga0081538_10012839 Ga0081538_1001283911 250
70 3300005985 Ga0081539_10000068 Ga0081539_10000068245 250
71 3300006175 Ga0070712_100373515 Ga0070712_1003735152 250
72 3300025915 Ga0207693_10339317 Ga0207693_103393172 250
73 3300049571 Ga0501034_0106598 Ga0501034_0106598_612_1364 250
74 3300049822 Ga0501035_0388573 Ga0501035_0388573_273_1025 250
75 3300049823 Ga0501044_0114101 Ga0501044_0114101_579_1331 250
76 3300005327 Ga0070658_10007473 Ga0070658_1000747311 251
77 3300005985 Ga0081539_10009518 Ga0081539_100095188 251
78 3300006038 Ga0075365_10090561 Ga0075365_100905613 251
79 3300006038 Ga0075365_10121767 Ga0075365_101217671 251
80 3300006048 Ga0075363_100181425 Ga0075363_1001814251 251
81 3300006847 Ga0075431_100111278 Ga0075431_1001112782 251
82 3300006852 Ga0075433_10264925 Ga0075433_102649252 251
83 3300006871 Ga0075434_100004237 Ga0075434_1000042374 251
84 3300009094 Ga0111539_10025526 Ga0111539_100255269 251
85 3300009147 Ga0114129_10041418 Ga0114129_100414186 251
86 3300025931 Ga0207644_10428438 Ga0207644_104284382 251
87 3300027907 Ga0207428_10055488 Ga0207428_100554882 251
88 3300031727 Ga0316576_10000715 Ga0316576_100007157 251
89 3300031733 Ga0316577_10214013 Ga0316577_102140131 251
90 3300036712 Ga0316584_0005866 Ga0316584_0005866_4133_4888 251
91 3300037466 Ga0395898_0042397 Ga0395898_0042397_2900_3655 251
92 3300037471 Ga0395905_0213973 Ga0395905_0213973_12_767 251
93 3300050492 nmdc:mga0yw44_264277_c1 nmdc:mga0yw44_264277_c1_102_857 251
94 3300050492 nmdc:mga0yw44_374609_c1 nmdc:mga0yw44_374609_c1_151_906 251
95 3300050510 nmdc:mga06r32_39377_c1 nmdc:mga06r32_39377_c1_455_1210 251
96 3300050511 nmdc:mga08y16_8814_c1 nmdc:mga08y16_8814_c1_4591_5346 251
97 3300050512 nmdc:mga0n895_190136_c1 nmdc:mga0n895_190136_c1_699_1454 251
98 3300050515 nmdc:mga0a205_31967_c1 nmdc:mga0a205_31967_c1_293_1048 251
99 3300005341 Ga0070691_10004069 Ga0070691_1000406911 252
100 3300005341 Ga0070691_10131806 Ga0070691_101318062 252
101 3300005436 Ga0070713_100073714 Ga0070713_1000737141 252
102 3300005545 Ga0070695_100210778 Ga0070695_1002107782 252
103 3300005618 Ga0068864_100140636 Ga0068864_1001406364 252
104 3300005718 Ga0068866_10010127 Ga0068866_100101273 252
105 3300005937 Ga0081455_10030975 Ga0081455_100309753 252
106 3300006028 Ga0070717_10204366 Ga0070717_102043662 252
107 3300009093 Ga0105240_10006736 Ga0105240_100067364 252
108 3300009098 Ga0105245_10235778 Ga0105245_102357783 252
109 3300013307 Ga0157372_10206608 Ga0157372_102066083 252
110 3300020080 Ga0206350_11531494 Ga0206350_115314941 252
111 3300025899 Ga0207642_10007311 Ga0207642_100073113 252
112 3300025903 Ga0207680_10010652 Ga0207680_100106522 252
113 3300025916 Ga0207663_10031921 Ga0207663_100319214 252
114 3300025927 Ga0207687_10472025 Ga0207687_104720252 252
115 3300025928 Ga0207700_10125575 Ga0207700_101255752 252
116 3300025929 Ga0207664_10016090 Ga0207664_100160903 252
117 3300025986 Ga0207658_10109895 Ga0207658_101098953 252
118 3300026075 Ga0207708_10276216 Ga0207708_102762161 252
119 3300026095 Ga0207676_10055103 Ga0207676_100551033 252
120 3300028379 Ga0268266_10001628 Ga0268266_1000162811 252
121 3300028577 Ga0265318_10011443 Ga0265318_100114432 252
122 3300028800 Ga0265338_10053107 Ga0265338_100531072 252
123 3300031344 Ga0265316_10156808 Ga0265316_101568082 252
124 3300031711 Ga0265314_10021282 Ga0265314_100212824 252
125 3300037068 Ga0373925_0057756 Ga0373925_0057756_372_1178 252
126 3300037418 Ga0395900_0297033 Ga0395900_0297033_108_866 252
127 3300038443 Ga0395901_0558192 Ga0395901_0558192_263_1021 252
128 3300039450 Ga0436363_0136874 Ga0436363_0136874_7872_8648 252
129 3300039450 Ga0436363_1591320 Ga0436363_1591320_345_1151 252
130 3300044683 Ga0466965_0041121 Ga0466965_0041121_27_803 252
131 3300044735 Ga0466968_0067712 Ga0466968_0067712_102_878 252
132 3300044765 Ga0466970_0044396 Ga0466970_0044396_858_1637 252
133 3300045049 Ga0466959_0129202 Ga0466959_0129202_606_1382 252
134 3300045049 Ga0466959_0300949 Ga0466959_0300949_283_1059 252
135 3300045836 Ga0466958_0008849 Ga0466958_0008849_1527_2303 252
136 3300045836 Ga0466958_0018330 Ga0466958_0018330_1262_2038 252
137 3300045836 Ga0466958_0186730 Ga0466958_0186730_439_1215 252
138 3300045836 Ga0466958_0226250 Ga0466958_0226250_255_1031 252
139 3300045976 Ga0466967_0005406 Ga0466967_0005406_4332_5108 252
140 3300045976 Ga0466967_0162915 Ga0466967_0162915_61_840 252
141 3300045976 Ga0466967_0213157 Ga0466967_0213157_958_1734 252
142 3300046463 Ga0495653_0188069 Ga0495653_0188069_454_1260 252
143 3300046477 Ga0495664_0000007 Ga0495664_0000007_135059_135883 252
144 3300046529 Ga0495652_0190543 Ga0495652_0190543_301_1077 252
145 3300046536 Ga0495587_0029873 Ga0495587_0029873_795_1553 252
146 3300046539 Ga0495621_0002562 Ga0495621_0002562_1330_2088 252
147 3300046543 Ga0495645_0000159 Ga0495645_0000159_26642_27463 252
148 3300046642 Ga0495634_0030858 Ga0495634_0030858_704_1462 252
149 3300046684 Ga0495669_0031979 Ga0495669_0031979_390_1148 252
150 3300046809 Ga0495600_0136165 Ga0495600_0136165_179_985 252
151 3300047321 Ga0495676_0034901 Ga0495676_0034901_1085_1843 252
152 3300047322 Ga0495680_0367092 Ga0495680_0367092_43_822 252
153 3300048905 Ga0496102_0000002 Ga0496102_0000002_635804_636610 252
154 3300048906 Ga0496103_0000017 Ga0496103_0000017_229021_229827 252
155 3300048907 Ga0496104_0056802 Ga0496104_0056802_2090_2848 252
156 3300048908 Ga0496105_0034891 Ga0496105_0034891_3258_4016 252
157 3300048911 Ga0496108_0280495 Ga0496108_0280495_493_1266 252
158 3300048912 Ga0496109_0043843 Ga0496109_0043843_168_941 252
159 3300048912 Ga0496109_0680794 Ga0496109_0680794_27_833 252
160 3300048922 Ga0496119_0015147 Ga0496119_0015147_1905_2663 252
161 3300048924 Ga0496121_0029534 Ga0496121_0029534_3025_3783 252
162 3300048928 Ga0496125_0038901 Ga0496125_0038901_246_1004 252
163 3300049571 Ga0501034_0313231 Ga0501034_0313231_659_1417 252
164 3300049581 Ga0501047_0231925 Ga0501047_0231925_734_1492 252
165 3300049741 Ga0501079_0038343 Ga0501079_0038343_2167_2955 252
166 3300049743 Ga0501081_0434972 Ga0501081_0434972_31_819 252
167 3300049823 Ga0501044_0345540 Ga0501044_0345540_80_838 252
168 3300050492 nmdc:mga0yw44_151825_c1 nmdc:mga0yw44_151825_c1_266_1024 252
169 3300050513 nmdc:mga0rr50_116385_c1 nmdc:mga0rr50_116385_c1_759_1553 252
170 3300053077 Ga0495601_0250656 Ga0495601_0250656_269_1090 252
171 3300053085 Ga0495619_0015976 Ga0495619_0015976_1776_2576 252
172 3300053085 Ga0495619_0158259 Ga0495619_0158259_684_1499 252
173 3300053104 Ga0500556_0000456 Ga0500556_0000456_7394_8167 252
174 3300053153 Ga0500616_0003004 Ga0500616_0003004_7284_8057 252
175 3300053736 Ga0500599_001705 Ga0500599_001705_233_1006 252
176 3300060353 Ga0501082_0150784 Ga0501082_0150784_913_1701 252
177 3300005614 Ga0068856_100016851 Ga0068856_1000168513 253
178 3300026078 Ga0207702_10012731 Ga0207702_100127319 253
179 3300037418 Ga0395900_0053956 Ga0395900_0053956_881_1663 253
180 3300037466 Ga0395898_0000942 Ga0395898_0000942_6322_7104 253
181 3300041491 Ga0451833_0880028 Ga0451833_0880028_723_1484 253
182 3300044656 Ga0466969_0004842 Ga0466969_0004842_1762_2544 253
183 3300045049 Ga0466959_0054989 Ga0466959_0054989_212_994 253
184 3300047317 Ga0495604_0000218 Ga0495604_0000218_35172_35990 253
185 3300048907 Ga0496104_0000001 Ga0496104_0000001_331757_332596 253
186 3300048913 Ga0496110_0000152 Ga0496110_0000152_31596_32435 253
187 3300048914 Ga0496111_0000123 Ga0496111_0000123_6240_7079 253
188 3300046463 Ga0495653_0002457 Ga0495653_0002457_10927_11739 254
189 3300054114 Ga0501084_0609814 Ga0501084_0609814_28_792 254
190 3300005439 Ga0070711_100013725 Ga0070711_1000137252 255
191 3300005535 Ga0070684_100065586 Ga0070684_1000655863 255
192 3300005564 Ga0070664_100085966 Ga0070664_1000859663 255
193 3300005937 Ga0081455_10045120 Ga0081455_100451202 255
194 3300005981 Ga0081538_10000208 Ga0081538_1000020843 255
195 3300005981 Ga0081538_10099371 Ga0081538_100993712 255
196 3300009098 Ga0105245_10177372 Ga0105245_101773722 255
197 3300025916 Ga0207663_10005211 Ga0207663_100052112 255
198 3300025927 Ga0207687_10168654 Ga0207687_101686542 255
199 3300031456 Ga0307513_10172474 Ga0307513_101724742 255
200 3300031852 Ga0307410_10022163 Ga0307410_100221632 255
201 3300031995 Ga0307409_100025652 Ga0307409_1000256522 255
202 3300032002 Ga0307416_100075990 Ga0307416_1000759903 255
203 3300037466 Ga0395898_0038575 Ga0395898_0038575_2632_3399 255
204 3300037466 Ga0395898_0193205 Ga0395898_0193205_511_1278 255
205 3300038443 Ga0395901_0058980 Ga0395901_0058980_1753_2520 255
206 3300044901 Ga0466960_0106980 Ga0466960_0106980_129_896 255
207 3300048912 Ga0496109_0533520 Ga0496109_0533520_185_952 255
208 3300048913 Ga0496110_0731652 Ga0496110_0731652_72_839 255
209 3300000546 LJNas_1002420 LJNas_10024202 257

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00557

Peptidase_M24

Metallopeptidase family M24

12

241

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
3mr1-assembly2.cif.gz_B crystal structure of methionine aminopeptidase from rickettsia prowazekii 0.991 5 251
3tb5-assembly2.cif.gz_B crystal structure of the enterococcus faecalis methionine aminopeptidase apo form 0.9872 5 253
3mr1-assembly2.cif.gz_B crystal structure of methionine aminopeptidase from rickettsia prowazekii 0.9831 5 251
1o0x-assembly1.cif.gz_A crystal structure of methionine aminopeptidase (tm1478) from thermotoga maritima at 1.90 a resolution 0.9809 5 251
4juq-assembly1.cif.gz_A pseudomonas aeruginosa metap t2n mutant, in mn form 0.9799 5 257
ID Description Score Start End Superfamily
af_Q6Z3V9_1_121_3.90.230.10 Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily 0.9931 17 128 3.90.230.10
4juqD00 Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily 0.9864 5 251 3.90.230.10
af_I1J6Q1_1_201_3.90.230.10 Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily 0.9831 52 251 3.90.230.10
1o0xA00 Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily 0.9809 5 251 3.90.230.10
af_P9WK19_6_284_3.90.230.10 Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily 0.9804 8 251 3.90.230.10
ID Description Score Start End GO Terms
AF-A0A7X7PQL7-F1-model_v4 Methionine aminopeptidase (MAP) (MetAP) (EC 3.4.11.18) (Peptidase M) 0.9994 5 251 GO:0004239
GO:0005829
GO:0006508
GO:0046872
GO:0070006
AF-A0A7C7DIY6-F1-model_v4 Methionine aminopeptidase (MAP) (MetAP) (EC 3.4.11.18) (Peptidase M) 0.9973 5 251 GO:0004239
GO:0005829
GO:0006508
GO:0046872
GO:0070006
AF-A0A537JHA6-F1-model_v4 M24 family metallopeptidase 0.9968 118 251 GO:0005829
GO:0006508
GO:0070006
AF-A0A661YHV2-F1-model_v4 deleted 0.9967 5 226
AF-A0A853KEB0-F1-model_v4 Methionine aminopeptidase (MAP) (MetAP) (EC 3.4.11.18) (Peptidase M) 0.9963 5 251 GO:0004239
GO:0005829
GO:0006508
GO:0046872
GO:0070006

Feature Viewer

pLDDT pTM Quality
95.57 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map