F318875
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 209 | 136 | 209 | 254 |
Family's Representative Sequence
| Representative Sequence | 3300005614|Ga0068856_100016851|Ga0068856_1000168513 |
| Length | 260 |
| Sequence | MAIIKKSPAEIEQMAAAGDVLVRTMNLIAAKIRPGVTTLELDLAAEKFIRSQGCEPAFKGYRGFPGSICASPNSMIVHGIPGAYTLERGDILSVDIGVVKDGWVADAARTFPVGPVSPIAQKLLAVTEESLHLAVPQCVPGNHLGDIGHAIQRYVENENGFSIVRTLVGHGVGREMHEDPQVPNYGKAGSGVLLEAGMVLAVEPMVNVGKHQVRMADDNWSIFSADGSLAAHFEFTIAVTADGPRILTPWHEAKGGRAAA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300000546 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled | Metagenome | Rhizosphere |
| 2 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 4 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 5 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 8 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 9 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 10 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 12 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 13 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 14 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 15 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 16 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 17 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 19 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 20 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 22 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 23 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 24 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 25 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 26 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 27 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 28 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 29 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 30 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 31 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 32 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 33 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 34 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 35 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 36 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 37 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 38 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 39 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 40 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 41 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 42 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 43 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 44 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 45 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 46 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 49 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 51 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 52 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 53 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 54 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 55 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 56 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 57 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 58 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 59 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 60 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 61 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 62 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 63 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 64 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 65 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 66 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 67 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 68 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 69 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 70 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 71 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 72 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 73 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 74 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 75 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 76 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 77 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 78 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 79 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 80 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 81 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 82 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 83 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 84 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 85 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 86 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 87 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 88 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 89 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 90 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 91 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 92 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 93 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 94 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 95 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 96 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 97 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 98 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 99 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 100 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 101 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 102 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 103 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 104 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 105 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 106 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 107 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 108 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 109 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 110 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 111 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 112 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 113 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 114 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 115 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 116 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 117 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 118 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 119 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 120 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 121 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 122 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 123 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 124 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 125 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 126 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 127 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 128 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 133 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 134 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 135 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 136 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.04 |
| Metatranscriptomes | 0.96 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.78 |
| Nodule | 0 |
| Rhizoplane | 8.13 |
| Rhizosphere | 83.25 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.83 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | LJNas_1002420 | 3300000546 | Bacteria | 2248 |
| 2 | Ga0070658_10007473 | 3300005327 | Bacteria | 8820 |
| 3 | Ga0070691_10004069 | 3300005341 | Bacteria | 6629 |
| 4 | Ga0070691_10131806 | 3300005341 | Bacteria | 1267 |
| 5 | Ga0070713_100032492 | 3300005436 | Bacteria | 4169 |
| 6 | Ga0070713_100073714 | 3300005436 | Bacteria | 2890 |
| 7 | Ga0070711_100013725 | 3300005439 | Bacteria | 5092 |
| 8 | Ga0070711_100055655 | 3300005439 | Bacteria | 2733 |
| 9 | Ga0070684_100065586 | 3300005535 | Bacteria | 3187 |
| 10 | Ga0070697_100690842 | 3300005536 | Bacteria | 900 |
| 11 | Ga0070695_100210778 | 3300005545 | Bacteria | 1394 |
| 12 | Ga0070704_100089427 | 3300005549 | Bacteria | 2291 |
| 13 | Ga0070664_100085966 | 3300005564 | Bacteria | 2717 |
| 14 | Ga0068856_100016851 | 3300005614 | Bacteria | 7081 |
| 15 | Ga0068864_100140636 | 3300005618 | Bacteria | 2177 |
| 16 | Ga0068866_10010127 | 3300005718 | Bacteria | 4031 |
| 17 | Ga0081455_10030975 | 3300005937 | Bacteria | 4848 |
| 18 | Ga0081455_10045120 | 3300005937 | Bacteria | 3838 |
| 19 | Ga0081455_10128610 | 3300005937 | Bacteria | 1984 |
| 20 | Ga0081538_10000208 | 3300005981 | Bacteria | 65347 |
| 21 | Ga0081538_10012839 | 3300005981 | Bacteria | 6685 |
| 22 | Ga0081538_10099371 | 3300005981 | Bacteria | 1471 |
| 23 | Ga0081539_10000068 | 3300005985 | Bacteria | 240998 |
| 24 | Ga0081539_10009518 | 3300005985 | Bacteria | 8098 |
| 25 | Ga0081539_10019869 | 3300005985 | Bacteria | 4574 |
| 26 | Ga0070717_10204366 | 3300006028 | Bacteria | 1731 |
| 27 | Ga0075365_10090561 | 3300006038 | Bacteria | 2083 |
| 28 | Ga0075365_10121767 | 3300006038 | Bacteria | 1800 |
| 29 | Ga0075363_100181425 | 3300006048 | Bacteria | 1198 |
| 30 | Ga0070712_100373515 | 3300006175 | Bacteria | 1172 |
| 31 | Ga0075431_100111278 | 3300006847 | Bacteria | 2826 |
| 32 | Ga0075433_10000882 | 3300006852 | Bacteria | 21089 |
| 33 | Ga0075433_10264925 | 3300006852 | Bacteria | 1523 |
| 34 | Ga0075434_100004237 | 3300006871 | Bacteria | 12860 |
| 35 | Ga0075434_100023641 | 3300006871 | Bacteria | 5993 |
| 36 | Ga0075436_100110651 | 3300006914 | Bacteria | 1917 |
| 37 | Ga0075435_100005458 | 3300007076 | Bacteria | 8883 |
| 38 | Ga0075435_100147603 | 3300007076 | Bacteria | 1976 |
| 39 | Ga0105240_10006736 | 3300009093 | Bacteria | 16822 |
| 40 | Ga0111539_10025526 | 3300009094 | Bacteria | 7244 |
| 41 | Ga0111539_10109496 | 3300009094 | Bacteria | 3242 |
| 42 | Ga0111539_10299410 | 3300009094 | Bacteria | 1872 |
| 43 | Ga0105245_10177372 | 3300009098 | Bacteria | 2033 |
| 44 | Ga0105245_10205637 | 3300009098 | Bacteria | 1892 |
| 45 | Ga0105245_10235778 | 3300009098 | Bacteria | 1771 |
| 46 | Ga0114129_10007041 | 3300009147 | Bacteria | 16012 |
| 47 | Ga0114129_10041418 | 3300009147 | Bacteria | 6490 |
| 48 | Ga0157372_10206608 | 3300013307 | Bacteria | 2275 |
| 49 | Ga0206356_10449285 | 3300020070 | Bacteria | 3301 |
| 50 | Ga0206350_11531494 | 3300020080 | Bacteria | 1013 |
| 51 | Ga0213874_10000186 | 3300021377 | Bacteria | 11171 |
| 52 | Ga0207642_10007311 | 3300025899 | Bacteria | 3722 |
| 53 | Ga0207680_10010652 | 3300025903 | Bacteria | 4610 |
| 54 | Ga0207671_10007459 | 3300025914 | Bacteria | 9487 |
| 55 | Ga0207693_10064599 | 3300025915 | Bacteria | 2867 |
| 56 | Ga0207693_10339317 | 3300025915 | Bacteria | 1176 |
| 57 | Ga0207663_10005211 | 3300025916 | Bacteria | 6542 |
| 58 | Ga0207663_10031921 | 3300025916 | Bacteria | 3122 |
| 59 | Ga0207687_10168654 | 3300025927 | Bacteria | 1686 |
| 60 | Ga0207687_10472025 | 3300025927 | Bacteria | 1043 |
| 61 | Ga0207700_10011813 | 3300025928 | Bacteria | 5590 |
| 62 | Ga0207700_10125575 | 3300025928 | Bacteria | 2087 |
| 63 | Ga0207664_10016090 | 3300025929 | Bacteria | 5449 |
| 64 | Ga0207644_10428438 | 3300025931 | Bacteria | 1085 |
| 65 | Ga0207658_10109895 | 3300025986 | Bacteria | 2177 |
| 66 | Ga0207708_10276216 | 3300026075 | Bacteria | 1360 |
| 67 | Ga0207702_10012731 | 3300026078 | Bacteria | 7000 |
| 68 | Ga0207641_10550010 | 3300026088 | Bacteria | 1126 |
| 69 | Ga0207676_10055103 | 3300026095 | Bacteria | 3120 |
| 70 | Ga0207428_10055488 | 3300027907 | Bacteria | 3150 |
| 71 | Ga0207428_10078286 | 3300027907 | Bacteria | 2587 |
| 72 | Ga0207428_10298264 | 3300027907 | Bacteria | 1193 |
| 73 | Ga0268266_10001628 | 3300028379 | Bacteria | 26120 |
| 74 | Ga0265318_10011443 | 3300028577 | Bacteria | 3818 |
| 75 | Ga0265338_10053107 | 3300028800 | Bacteria | 3629 |
| 76 | Ga0265316_10156808 | 3300031344 | Bacteria | 1703 |
| 77 | Ga0265316_10398968 | 3300031344 | Bacteria | 991 |
| 78 | Ga0307513_10172474 | 3300031456 | Bacteria | 2039 |
| 79 | Ga0265314_10021282 | 3300031711 | Bacteria | 4991 |
| 80 | Ga0316576_10000715 | 3300031727 | Bacteria | 16385 |
| 81 | Ga0316577_10214013 | 3300031733 | Bacteria | 1089 |
| 82 | Ga0307410_10022163 | 3300031852 | Bacteria | 3920 |
| 83 | Ga0307409_100025652 | 3300031995 | Bacteria | 4139 |
| 84 | Ga0307416_100075990 | 3300032002 | Bacteria | 2813 |
| 85 | Ga0316584_0005866 | 3300036712 | Bacteria | 8290 |
| 86 | Ga0373925_0057756 | 3300037068 | Bacteria | 2908 |
| 87 | Ga0395900_0053956 | 3300037418 | Bacteria | 4138 |
| 88 | Ga0395900_0297033 | 3300037418 | Bacteria | 1603 |
| 89 | Ga0395898_0000942 | 3300037466 | Bacteria | 46333 |
| 90 | Ga0395898_0013971 | 3300037466 | Bacteria | 8251 |
| 91 | Ga0395898_0038575 | 3300037466 | Bacteria | 4734 |
| 92 | Ga0395898_0042397 | 3300037466 | Bacteria | 4490 |
| 93 | Ga0395898_0193205 | 3300037466 | Bacteria | 1945 |
| 94 | Ga0395898_0841329 | 3300037466 | Bacteria | 857 |
| 95 | Ga0395905_0213973 | 3300037471 | Bacteria | 1805 |
| 96 | Ga0395901_0043546 | 3300038443 | Bacteria | 4656 |
| 97 | Ga0395901_0058980 | 3300038443 | Bacteria | 3993 |
| 98 | Ga0395901_0558192 | 3300038443 | Bacteria | 1160 |
| 99 | Ga0436363_0136874 | 3300039450 | Bacteria | 50367 |
| 100 | Ga0436363_1591320 | 3300039450 | Bacteria | 1359 |
| 101 | Ga0451833_0880028 | 3300041491 | Bacteria | 1758 |
| 102 | Ga0466969_0004842 | 3300044656 | Bacteria | 7166 |
| 103 | Ga0466965_0041121 | 3300044683 | Bacteria | 2277 |
| 104 | Ga0466963_0153384 | 3300044694 | Bacteria | 1600 |
| 105 | Ga0466963_0211351 | 3300044694 | Bacteria | 1358 |
| 106 | Ga0466968_0067712 | 3300044735 | Bacteria | 1549 |
| 107 | Ga0466970_0044396 | 3300044765 | Bacteria | 2366 |
| 108 | Ga0466960_0106980 | 3300044901 | Bacteria | 1448 |
| 109 | Ga0466959_0054989 | 3300045049 | Bacteria | 2907 |
| 110 | Ga0466959_0129202 | 3300045049 | Bacteria | 1791 |
| 111 | Ga0466959_0300949 | 3300045049 | Bacteria | 1098 |
| 112 | Ga0466958_0008849 | 3300045836 | Bacteria | 5595 |
| 113 | Ga0466958_0018330 | 3300045836 | Bacteria | 4062 |
| 114 | Ga0466958_0186730 | 3300045836 | Bacteria | 1316 |
| 115 | Ga0466958_0226250 | 3300045836 | Bacteria | 1194 |
| 116 | Ga0466967_0005406 | 3300045976 | Bacteria | 8846 |
| 117 | Ga0466967_0088671 | 3300045976 | Bacteria | 2808 |
| 118 | Ga0466967_0162915 | 3300045976 | Bacteria | 2094 |
| 119 | Ga0466967_0213157 | 3300045976 | Bacteria | 1832 |
| 120 | Ga0495653_0002457 | 3300046463 | Bacteria | 14725 |
| 121 | Ga0495653_0188069 | 3300046463 | Bacteria | 1411 |
| 122 | Ga0495664_0000007 | 3300046477 | Bacteria | 386710 |
| 123 | Ga0495618_0067584 | 3300046514 | Bacteria | 2273 |
| 124 | Ga0495618_0198853 | 3300046514 | Bacteria | 1269 |
| 125 | Ga0495652_0190543 | 3300046529 | Bacteria | 1565 |
| 126 | Ga0495587_0029873 | 3300046536 | Bacteria | 3307 |
| 127 | Ga0495621_0002562 | 3300046539 | Bacteria | 4903 |
| 128 | Ga0495645_0000033 | 3300046543 | Bacteria | 105930 |
| 129 | Ga0495645_0000159 | 3300046543 | Bacteria | 46648 |
| 130 | Ga0495634_0030858 | 3300046642 | Bacteria | 3696 |
| 131 | Ga0495658_0132308 | 3300046683 | Bacteria | 1519 |
| 132 | Ga0495669_0031979 | 3300046684 | Bacteria | 2311 |
| 133 | Ga0495600_0136165 | 3300046809 | Bacteria | 1595 |
| 134 | Ga0495581_0031097 | 3300047315 | Bacteria | 3093 |
| 135 | Ga0495604_0000218 | 3300047317 | Bacteria | 52385 |
| 136 | Ga0495674_0029830 | 3300047319 | Bacteria | 4963 |
| 137 | Ga0495676_0034901 | 3300047321 | Bacteria | 4214 |
| 138 | Ga0495680_0367092 | 3300047322 | Bacteria | 999 |
| 139 | Ga0496100_0061790 | 3300048903 | Bacteria | 2469 |
| 140 | Ga0496101_0200038 | 3300048904 | Bacteria | 1544 |
| 141 | Ga0496102_0000002 | 3300048905 | Bacteria | 814588 |
| 142 | Ga0496103_0000017 | 3300048906 | Bacteria | 244768 |
| 143 | Ga0496104_0000001 | 3300048907 | Bacteria | 711867 |
| 144 | Ga0496104_0056802 | 3300048907 | Bacteria | 3703 |
| 145 | Ga0496105_0034891 | 3300048908 | Bacteria | 4139 |
| 146 | Ga0496107_0133619 | 3300048910 | Bacteria | 1833 |
| 147 | Ga0496108_0280495 | 3300048911 | Bacteria | 1451 |
| 148 | Ga0496109_0043843 | 3300048912 | Bacteria | 4055 |
| 149 | Ga0496109_0406199 | 3300048912 | Bacteria | 1287 |
| 150 | Ga0496109_0533520 | 3300048912 | Bacteria | 1107 |
| 151 | Ga0496109_0680794 | 3300048912 | Bacteria | 966 |
| 152 | Ga0496110_0000152 | 3300048913 | Bacteria | 41561 |
| 153 | Ga0496110_0731652 | 3300048913 | Bacteria | 892 |
| 154 | Ga0496111_0000123 | 3300048914 | Bacteria | 33765 |
| 155 | Ga0496114_0247774 | 3300048917 | Bacteria | 1567 |
| 156 | Ga0496119_0015147 | 3300048922 | Bacteria | 5967 |
| 157 | Ga0496121_0029534 | 3300048924 | Bacteria | 5066 |
| 158 | Ga0496125_0038901 | 3300048928 | Bacteria | 4107 |
| 159 | Ga0501034_0106598 | 3300049571 | Bacteria | 2795 |
| 160 | Ga0501034_0313231 | 3300049571 | Bacteria | 1503 |
| 161 | Ga0501034_0318354 | 3300049571 | Bacteria | 1489 |
| 162 | Ga0501039_0174054 | 3300049575 | Bacteria | 1693 |
| 163 | Ga0501047_0049982 | 3300049581 | Bacteria | 4037 |
| 164 | Ga0501047_0231925 | 3300049581 | Bacteria | 1699 |
| 165 | Ga0501068_0218742 | 3300049584 | Bacteria | 1210 |
| 166 | Ga0501069_0083221 | 3300049585 | Bacteria | 1804 |
| 167 | Ga0501070_0028334 | 3300049586 | Bacteria | 4697 |
| 168 | Ga0501070_0520444 | 3300049586 | Bacteria | 954 |
| 169 | Ga0501074_0182700 | 3300049590 | Bacteria | 1496 |
| 170 | Ga0501079_0038343 | 3300049741 | Bacteria | 3695 |
| 171 | Ga0501079_0472736 | 3300049741 | Bacteria | 985 |
| 172 | Ga0501080_0247334 | 3300049742 | Bacteria | 1626 |
| 173 | Ga0501080_0259053 | 3300049742 | Bacteria | 1585 |
| 174 | Ga0501081_0434972 | 3300049743 | Bacteria | 973 |
| 175 | Ga0501035_0288247 | 3300049822 | Bacteria | 1386 |
| 176 | Ga0501035_0388573 | 3300049822 | Bacteria | 1163 |
| 177 | Ga0501044_0114101 | 3300049823 | Bacteria | 2708 |
| 178 | Ga0501044_0120027 | 3300049823 | Bacteria | 2631 |
| 179 | Ga0501044_0345540 | 3300049823 | Bacteria | 1408 |
| 180 | nmdc:mga0yw44_151825_c1 | 3300050492 | Bacteria | 1511 |
| 181 | nmdc:mga0yw44_264277_c1 | 3300050492 | Bacteria | 1147 |
| 182 | nmdc:mga0yw44_30849_c1 | 3300050492 | Bacteria | 3112 |
| 183 | nmdc:mga0yw44_374609_c1 | 3300050492 | Bacteria | 961 |
| 184 | nmdc:mga05p37_270980_c1 | 3300050507 | Bacteria | 2028 |
| 185 | nmdc:mga05p37_59170_c1 | 3300050507 | Bacteria | 4719 |
| 186 | nmdc:mga06r32_39377_c1 | 3300050510 | Bacteria | 4484 |
| 187 | nmdc:mga06r32_934434_c1 | 3300050510 | Bacteria | 822 |
| 188 | nmdc:mga08y16_50545_c1 | 3300050511 | Bacteria | 4351 |
| 189 | nmdc:mga08y16_8814_c1 | 3300050511 | Bacteria | 10585 |
| 190 | nmdc:mga0n895_1768_c1 | 3300050512 | Bacteria | 16373 |
| 191 | nmdc:mga0n895_190136_c1 | 3300050512 | Bacteria | 2084 |
| 192 | nmdc:mga0rr50_116385_c1 | 3300050513 | Bacteria | 2122 |
| 193 | nmdc:mga0rr50_55828_c1 | 3300050513 | Bacteria | 2948 |
| 194 | nmdc:mga08x19_107450_c1 | 3300050514 | Bacteria | 1858 |
| 195 | nmdc:mga0a205_31967_c1 | 3300050515 | Bacteria | 5044 |
| 196 | nmdc:mga0a205_460_c1 | 3300050515 | Bacteria | 31634 |
| 197 | Ga0495601_0018061 | 3300053077 | Bacteria | 4288 |
| 198 | Ga0495601_0168879 | 3300053077 | Bacteria | 1430 |
| 199 | Ga0495601_0250656 | 3300053077 | Bacteria | 1156 |
| 200 | Ga0495612_0000233 | 3300053078 | Bacteria | 23563 |
| 201 | Ga0495612_0048344 | 3300053078 | Bacteria | 1744 |
| 202 | Ga0495595_0272479 | 3300053084 | Bacteria | 849 |
| 203 | Ga0495619_0015976 | 3300053085 | Bacteria | 4751 |
| 204 | Ga0495619_0158259 | 3300053085 | Bacteria | 1564 |
| 205 | Ga0500556_0000456 | 3300053104 | Bacteria | 28931 |
| 206 | Ga0500616_0003004 | 3300053153 | Bacteria | 13313 |
| 207 | Ga0500599_001705 | 3300053736 | Bacteria | 2564 |
| 208 | Ga0501084_0609814 | 3300054114 | Bacteria | 922 |
| 209 | Ga0501082_0150784 | 3300060353 | Bacteria | 2019 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300006852 | Ga0075433_10000882 | Ga0075433_100008824 | 221 |
| 2 | 3300006871 | Ga0075434_100023641 | Ga0075434_1000236418 | 221 |
| 3 | 3300006914 | Ga0075436_100110651 | Ga0075436_1001106513 | 221 |
| 4 | 3300007076 | Ga0075435_100005458 | Ga0075435_10000545813 | 221 |
| 5 | 3300050507 | nmdc:mga05p37_270980_c1 | nmdc:mga05p37_270980_c1_1180_1956 | 221 |
| 6 | 3300050510 | nmdc:mga06r32_934434_c1 | nmdc:mga06r32_934434_c1_22_798 | 221 |
| 7 | 3300050512 | nmdc:mga0n895_1768_c1 | nmdc:mga0n895_1768_c1_322_1098 | 221 |
| 8 | 3300050513 | nmdc:mga0rr50_55828_c1 | nmdc:mga0rr50_55828_c1_1617_2393 | 221 |
| 9 | 3300050514 | nmdc:mga08x19_107450_c1 | nmdc:mga08x19_107450_c1_527_1303 | 221 |
| 10 | 3300050515 | nmdc:mga0a205_460_c1 | nmdc:mga0a205_460_c1_28219_28995 | 221 |
| 11 | 3300050492 | nmdc:mga0yw44_30849_c1 | nmdc:mga0yw44_30849_c1_2411_3091 | 226 |
| 12 | 3300046514 | Ga0495618_0198853 | Ga0495618_0198853_23_706 | 227 |
| 13 | 3300009094 | Ga0111539_10109496 | Ga0111539_101094962 | 228 |
| 14 | 3300009147 | Ga0114129_10007041 | Ga0114129_100070416 | 228 |
| 15 | 3300027907 | Ga0207428_10078286 | Ga0207428_100782865 | 228 |
| 16 | 3300050507 | nmdc:mga05p37_59170_c1 | nmdc:mga05p37_59170_c1_3123_3824 | 228 |
| 17 | 3300050511 | nmdc:mga08y16_50545_c1 | nmdc:mga08y16_50545_c1_457_1158 | 228 |
| 18 | 3300049741 | Ga0501079_0472736 | Ga0501079_0472736_10_762 | 230 |
| 19 | 3300053078 | Ga0495612_0000233 | Ga0495612_0000233_21952_22758 | 233 |
| 20 | 3300005937 | Ga0081455_10128610 | Ga0081455_101286104 | 235 |
| 21 | 3300048910 | Ga0496107_0133619 | Ga0496107_0133619_69_797 | 235 |
| 22 | 3300046543 | Ga0495645_0000033 | Ga0495645_0000033_33859_34665 | 239 |
| 23 | 3300005436 | Ga0070713_100032492 | Ga0070713_1000324925 | 240 |
| 24 | 3300005439 | Ga0070711_100055655 | Ga0070711_1000556555 | 240 |
| 25 | 3300005536 | Ga0070697_100690842 | Ga0070697_1006908421 | 240 |
| 26 | 3300005549 | Ga0070704_100089427 | Ga0070704_1000894273 | 240 |
| 27 | 3300007076 | Ga0075435_100147603 | Ga0075435_1001476033 | 240 |
| 28 | 3300020070 | Ga0206356_10449285 | Ga0206356_104492852 | 240 |
| 29 | 3300021377 | Ga0213874_10000186 | Ga0213874_1000018617 | 240 |
| 30 | 3300025914 | Ga0207671_10007459 | Ga0207671_100074595 | 240 |
| 31 | 3300025915 | Ga0207693_10064599 | Ga0207693_100645993 | 240 |
| 32 | 3300025928 | Ga0207700_10011813 | Ga0207700_100118136 | 240 |
| 33 | 3300031344 | Ga0265316_10398968 | Ga0265316_103989681 | 240 |
| 34 | 3300044694 | Ga0466963_0153384 | Ga0466963_0153384_752_1513 | 246 |
| 35 | 3300044694 | Ga0466963_0211351 | Ga0466963_0211351_407_1168 | 246 |
| 36 | 3300046683 | Ga0495658_0132308 | Ga0495658_0132308_264_1028 | 246 |
| 37 | 3300047315 | Ga0495581_0031097 | Ga0495581_0031097_606_1370 | 246 |
| 38 | 3300009094 | Ga0111539_10299410 | Ga0111539_102994101 | 247 |
| 39 | 3300026088 | Ga0207641_10550010 | Ga0207641_105500102 | 247 |
| 40 | 3300027907 | Ga0207428_10298264 | Ga0207428_102982642 | 247 |
| 41 | 3300037466 | Ga0395898_0013971 | Ga0395898_0013971_1602_2366 | 247 |
| 42 | 3300037466 | Ga0395898_0841329 | Ga0395898_0841329_36_800 | 247 |
| 43 | 3300038443 | Ga0395901_0043546 | Ga0395901_0043546_722_1486 | 247 |
| 44 | 3300045976 | Ga0466967_0088671 | Ga0466967_0088671_944_1714 | 247 |
| 45 | 3300046514 | Ga0495618_0067584 | Ga0495618_0067584_522_1286 | 247 |
| 46 | 3300047319 | Ga0495674_0029830 | Ga0495674_0029830_2811_3575 | 247 |
| 47 | 3300048903 | Ga0496100_0061790 | Ga0496100_0061790_852_1616 | 247 |
| 48 | 3300048904 | Ga0496101_0200038 | Ga0496101_0200038_25_789 | 247 |
| 49 | 3300048917 | Ga0496114_0247774 | Ga0496114_0247774_707_1471 | 247 |
| 50 | 3300049585 | Ga0501069_0083221 | Ga0501069_0083221_705_1469 | 247 |
| 51 | 3300049586 | Ga0501070_0028334 | Ga0501070_0028334_843_1607 | 247 |
| 52 | 3300049590 | Ga0501074_0182700 | Ga0501074_0182700_106_873 | 247 |
| 53 | 3300049742 | Ga0501080_0247334 | Ga0501080_0247334_573_1337 | 247 |
| 54 | 3300049742 | Ga0501080_0259053 | Ga0501080_0259053_641_1405 | 247 |
| 55 | 3300049823 | Ga0501044_0120027 | Ga0501044_0120027_649_1413 | 247 |
| 56 | 3300053077 | Ga0495601_0018061 | Ga0495601_0018061_2988_3752 | 247 |
| 57 | 3300053078 | Ga0495612_0048344 | Ga0495612_0048344_160_924 | 247 |
| 58 | 3300048912 | Ga0496109_0406199 | Ga0496109_0406199_362_1129 | 248 |
| 59 | 3300049571 | Ga0501034_0318354 | Ga0501034_0318354_304_1074 | 248 |
| 60 | 3300049575 | Ga0501039_0174054 | Ga0501039_0174054_593_1363 | 248 |
| 61 | 3300049581 | Ga0501047_0049982 | Ga0501047_0049982_3048_3818 | 248 |
| 62 | 3300049584 | Ga0501068_0218742 | Ga0501068_0218742_298_1068 | 248 |
| 63 | 3300049586 | Ga0501070_0520444 | Ga0501070_0520444_28_798 | 248 |
| 64 | 3300049822 | Ga0501035_0288247 | Ga0501035_0288247_543_1313 | 248 |
| 65 | 3300053077 | Ga0495601_0168879 | Ga0495601_0168879_261_1028 | 248 |
| 66 | 3300053084 | Ga0495595_0272479 | Ga0495595_0272479_33_800 | 248 |
| 67 | 3300005985 | Ga0081539_10019869 | Ga0081539_100198692 | 249 |
| 68 | 3300009098 | Ga0105245_10205637 | Ga0105245_102056373 | 249 |
| 69 | 3300005981 | Ga0081538_10012839 | Ga0081538_1001283911 | 250 |
| 70 | 3300005985 | Ga0081539_10000068 | Ga0081539_10000068245 | 250 |
| 71 | 3300006175 | Ga0070712_100373515 | Ga0070712_1003735152 | 250 |
| 72 | 3300025915 | Ga0207693_10339317 | Ga0207693_103393172 | 250 |
| 73 | 3300049571 | Ga0501034_0106598 | Ga0501034_0106598_612_1364 | 250 |
| 74 | 3300049822 | Ga0501035_0388573 | Ga0501035_0388573_273_1025 | 250 |
| 75 | 3300049823 | Ga0501044_0114101 | Ga0501044_0114101_579_1331 | 250 |
| 76 | 3300005327 | Ga0070658_10007473 | Ga0070658_1000747311 | 251 |
| 77 | 3300005985 | Ga0081539_10009518 | Ga0081539_100095188 | 251 |
| 78 | 3300006038 | Ga0075365_10090561 | Ga0075365_100905613 | 251 |
| 79 | 3300006038 | Ga0075365_10121767 | Ga0075365_101217671 | 251 |
| 80 | 3300006048 | Ga0075363_100181425 | Ga0075363_1001814251 | 251 |
| 81 | 3300006847 | Ga0075431_100111278 | Ga0075431_1001112782 | 251 |
| 82 | 3300006852 | Ga0075433_10264925 | Ga0075433_102649252 | 251 |
| 83 | 3300006871 | Ga0075434_100004237 | Ga0075434_1000042374 | 251 |
| 84 | 3300009094 | Ga0111539_10025526 | Ga0111539_100255269 | 251 |
| 85 | 3300009147 | Ga0114129_10041418 | Ga0114129_100414186 | 251 |
| 86 | 3300025931 | Ga0207644_10428438 | Ga0207644_104284382 | 251 |
| 87 | 3300027907 | Ga0207428_10055488 | Ga0207428_100554882 | 251 |
| 88 | 3300031727 | Ga0316576_10000715 | Ga0316576_100007157 | 251 |
| 89 | 3300031733 | Ga0316577_10214013 | Ga0316577_102140131 | 251 |
| 90 | 3300036712 | Ga0316584_0005866 | Ga0316584_0005866_4133_4888 | 251 |
| 91 | 3300037466 | Ga0395898_0042397 | Ga0395898_0042397_2900_3655 | 251 |
| 92 | 3300037471 | Ga0395905_0213973 | Ga0395905_0213973_12_767 | 251 |
| 93 | 3300050492 | nmdc:mga0yw44_264277_c1 | nmdc:mga0yw44_264277_c1_102_857 | 251 |
| 94 | 3300050492 | nmdc:mga0yw44_374609_c1 | nmdc:mga0yw44_374609_c1_151_906 | 251 |
| 95 | 3300050510 | nmdc:mga06r32_39377_c1 | nmdc:mga06r32_39377_c1_455_1210 | 251 |
| 96 | 3300050511 | nmdc:mga08y16_8814_c1 | nmdc:mga08y16_8814_c1_4591_5346 | 251 |
| 97 | 3300050512 | nmdc:mga0n895_190136_c1 | nmdc:mga0n895_190136_c1_699_1454 | 251 |
| 98 | 3300050515 | nmdc:mga0a205_31967_c1 | nmdc:mga0a205_31967_c1_293_1048 | 251 |
| 99 | 3300005341 | Ga0070691_10004069 | Ga0070691_1000406911 | 252 |
| 100 | 3300005341 | Ga0070691_10131806 | Ga0070691_101318062 | 252 |
| 101 | 3300005436 | Ga0070713_100073714 | Ga0070713_1000737141 | 252 |
| 102 | 3300005545 | Ga0070695_100210778 | Ga0070695_1002107782 | 252 |
| 103 | 3300005618 | Ga0068864_100140636 | Ga0068864_1001406364 | 252 |
| 104 | 3300005718 | Ga0068866_10010127 | Ga0068866_100101273 | 252 |
| 105 | 3300005937 | Ga0081455_10030975 | Ga0081455_100309753 | 252 |
| 106 | 3300006028 | Ga0070717_10204366 | Ga0070717_102043662 | 252 |
| 107 | 3300009093 | Ga0105240_10006736 | Ga0105240_100067364 | 252 |
| 108 | 3300009098 | Ga0105245_10235778 | Ga0105245_102357783 | 252 |
| 109 | 3300013307 | Ga0157372_10206608 | Ga0157372_102066083 | 252 |
| 110 | 3300020080 | Ga0206350_11531494 | Ga0206350_115314941 | 252 |
| 111 | 3300025899 | Ga0207642_10007311 | Ga0207642_100073113 | 252 |
| 112 | 3300025903 | Ga0207680_10010652 | Ga0207680_100106522 | 252 |
| 113 | 3300025916 | Ga0207663_10031921 | Ga0207663_100319214 | 252 |
| 114 | 3300025927 | Ga0207687_10472025 | Ga0207687_104720252 | 252 |
| 115 | 3300025928 | Ga0207700_10125575 | Ga0207700_101255752 | 252 |
| 116 | 3300025929 | Ga0207664_10016090 | Ga0207664_100160903 | 252 |
| 117 | 3300025986 | Ga0207658_10109895 | Ga0207658_101098953 | 252 |
| 118 | 3300026075 | Ga0207708_10276216 | Ga0207708_102762161 | 252 |
| 119 | 3300026095 | Ga0207676_10055103 | Ga0207676_100551033 | 252 |
| 120 | 3300028379 | Ga0268266_10001628 | Ga0268266_1000162811 | 252 |
| 121 | 3300028577 | Ga0265318_10011443 | Ga0265318_100114432 | 252 |
| 122 | 3300028800 | Ga0265338_10053107 | Ga0265338_100531072 | 252 |
| 123 | 3300031344 | Ga0265316_10156808 | Ga0265316_101568082 | 252 |
| 124 | 3300031711 | Ga0265314_10021282 | Ga0265314_100212824 | 252 |
| 125 | 3300037068 | Ga0373925_0057756 | Ga0373925_0057756_372_1178 | 252 |
| 126 | 3300037418 | Ga0395900_0297033 | Ga0395900_0297033_108_866 | 252 |
| 127 | 3300038443 | Ga0395901_0558192 | Ga0395901_0558192_263_1021 | 252 |
| 128 | 3300039450 | Ga0436363_0136874 | Ga0436363_0136874_7872_8648 | 252 |
| 129 | 3300039450 | Ga0436363_1591320 | Ga0436363_1591320_345_1151 | 252 |
| 130 | 3300044683 | Ga0466965_0041121 | Ga0466965_0041121_27_803 | 252 |
| 131 | 3300044735 | Ga0466968_0067712 | Ga0466968_0067712_102_878 | 252 |
| 132 | 3300044765 | Ga0466970_0044396 | Ga0466970_0044396_858_1637 | 252 |
| 133 | 3300045049 | Ga0466959_0129202 | Ga0466959_0129202_606_1382 | 252 |
| 134 | 3300045049 | Ga0466959_0300949 | Ga0466959_0300949_283_1059 | 252 |
| 135 | 3300045836 | Ga0466958_0008849 | Ga0466958_0008849_1527_2303 | 252 |
| 136 | 3300045836 | Ga0466958_0018330 | Ga0466958_0018330_1262_2038 | 252 |
| 137 | 3300045836 | Ga0466958_0186730 | Ga0466958_0186730_439_1215 | 252 |
| 138 | 3300045836 | Ga0466958_0226250 | Ga0466958_0226250_255_1031 | 252 |
| 139 | 3300045976 | Ga0466967_0005406 | Ga0466967_0005406_4332_5108 | 252 |
| 140 | 3300045976 | Ga0466967_0162915 | Ga0466967_0162915_61_840 | 252 |
| 141 | 3300045976 | Ga0466967_0213157 | Ga0466967_0213157_958_1734 | 252 |
| 142 | 3300046463 | Ga0495653_0188069 | Ga0495653_0188069_454_1260 | 252 |
| 143 | 3300046477 | Ga0495664_0000007 | Ga0495664_0000007_135059_135883 | 252 |
| 144 | 3300046529 | Ga0495652_0190543 | Ga0495652_0190543_301_1077 | 252 |
| 145 | 3300046536 | Ga0495587_0029873 | Ga0495587_0029873_795_1553 | 252 |
| 146 | 3300046539 | Ga0495621_0002562 | Ga0495621_0002562_1330_2088 | 252 |
| 147 | 3300046543 | Ga0495645_0000159 | Ga0495645_0000159_26642_27463 | 252 |
| 148 | 3300046642 | Ga0495634_0030858 | Ga0495634_0030858_704_1462 | 252 |
| 149 | 3300046684 | Ga0495669_0031979 | Ga0495669_0031979_390_1148 | 252 |
| 150 | 3300046809 | Ga0495600_0136165 | Ga0495600_0136165_179_985 | 252 |
| 151 | 3300047321 | Ga0495676_0034901 | Ga0495676_0034901_1085_1843 | 252 |
| 152 | 3300047322 | Ga0495680_0367092 | Ga0495680_0367092_43_822 | 252 |
| 153 | 3300048905 | Ga0496102_0000002 | Ga0496102_0000002_635804_636610 | 252 |
| 154 | 3300048906 | Ga0496103_0000017 | Ga0496103_0000017_229021_229827 | 252 |
| 155 | 3300048907 | Ga0496104_0056802 | Ga0496104_0056802_2090_2848 | 252 |
| 156 | 3300048908 | Ga0496105_0034891 | Ga0496105_0034891_3258_4016 | 252 |
| 157 | 3300048911 | Ga0496108_0280495 | Ga0496108_0280495_493_1266 | 252 |
| 158 | 3300048912 | Ga0496109_0043843 | Ga0496109_0043843_168_941 | 252 |
| 159 | 3300048912 | Ga0496109_0680794 | Ga0496109_0680794_27_833 | 252 |
| 160 | 3300048922 | Ga0496119_0015147 | Ga0496119_0015147_1905_2663 | 252 |
| 161 | 3300048924 | Ga0496121_0029534 | Ga0496121_0029534_3025_3783 | 252 |
| 162 | 3300048928 | Ga0496125_0038901 | Ga0496125_0038901_246_1004 | 252 |
| 163 | 3300049571 | Ga0501034_0313231 | Ga0501034_0313231_659_1417 | 252 |
| 164 | 3300049581 | Ga0501047_0231925 | Ga0501047_0231925_734_1492 | 252 |
| 165 | 3300049741 | Ga0501079_0038343 | Ga0501079_0038343_2167_2955 | 252 |
| 166 | 3300049743 | Ga0501081_0434972 | Ga0501081_0434972_31_819 | 252 |
| 167 | 3300049823 | Ga0501044_0345540 | Ga0501044_0345540_80_838 | 252 |
| 168 | 3300050492 | nmdc:mga0yw44_151825_c1 | nmdc:mga0yw44_151825_c1_266_1024 | 252 |
| 169 | 3300050513 | nmdc:mga0rr50_116385_c1 | nmdc:mga0rr50_116385_c1_759_1553 | 252 |
| 170 | 3300053077 | Ga0495601_0250656 | Ga0495601_0250656_269_1090 | 252 |
| 171 | 3300053085 | Ga0495619_0015976 | Ga0495619_0015976_1776_2576 | 252 |
| 172 | 3300053085 | Ga0495619_0158259 | Ga0495619_0158259_684_1499 | 252 |
| 173 | 3300053104 | Ga0500556_0000456 | Ga0500556_0000456_7394_8167 | 252 |
| 174 | 3300053153 | Ga0500616_0003004 | Ga0500616_0003004_7284_8057 | 252 |
| 175 | 3300053736 | Ga0500599_001705 | Ga0500599_001705_233_1006 | 252 |
| 176 | 3300060353 | Ga0501082_0150784 | Ga0501082_0150784_913_1701 | 252 |
| 177 | 3300005614 | Ga0068856_100016851 | Ga0068856_1000168513 | 253 |
| 178 | 3300026078 | Ga0207702_10012731 | Ga0207702_100127319 | 253 |
| 179 | 3300037418 | Ga0395900_0053956 | Ga0395900_0053956_881_1663 | 253 |
| 180 | 3300037466 | Ga0395898_0000942 | Ga0395898_0000942_6322_7104 | 253 |
| 181 | 3300041491 | Ga0451833_0880028 | Ga0451833_0880028_723_1484 | 253 |
| 182 | 3300044656 | Ga0466969_0004842 | Ga0466969_0004842_1762_2544 | 253 |
| 183 | 3300045049 | Ga0466959_0054989 | Ga0466959_0054989_212_994 | 253 |
| 184 | 3300047317 | Ga0495604_0000218 | Ga0495604_0000218_35172_35990 | 253 |
| 185 | 3300048907 | Ga0496104_0000001 | Ga0496104_0000001_331757_332596 | 253 |
| 186 | 3300048913 | Ga0496110_0000152 | Ga0496110_0000152_31596_32435 | 253 |
| 187 | 3300048914 | Ga0496111_0000123 | Ga0496111_0000123_6240_7079 | 253 |
| 188 | 3300046463 | Ga0495653_0002457 | Ga0495653_0002457_10927_11739 | 254 |
| 189 | 3300054114 | Ga0501084_0609814 | Ga0501084_0609814_28_792 | 254 |
| 190 | 3300005439 | Ga0070711_100013725 | Ga0070711_1000137252 | 255 |
| 191 | 3300005535 | Ga0070684_100065586 | Ga0070684_1000655863 | 255 |
| 192 | 3300005564 | Ga0070664_100085966 | Ga0070664_1000859663 | 255 |
| 193 | 3300005937 | Ga0081455_10045120 | Ga0081455_100451202 | 255 |
| 194 | 3300005981 | Ga0081538_10000208 | Ga0081538_1000020843 | 255 |
| 195 | 3300005981 | Ga0081538_10099371 | Ga0081538_100993712 | 255 |
| 196 | 3300009098 | Ga0105245_10177372 | Ga0105245_101773722 | 255 |
| 197 | 3300025916 | Ga0207663_10005211 | Ga0207663_100052112 | 255 |
| 198 | 3300025927 | Ga0207687_10168654 | Ga0207687_101686542 | 255 |
| 199 | 3300031456 | Ga0307513_10172474 | Ga0307513_101724742 | 255 |
| 200 | 3300031852 | Ga0307410_10022163 | Ga0307410_100221632 | 255 |
| 201 | 3300031995 | Ga0307409_100025652 | Ga0307409_1000256522 | 255 |
| 202 | 3300032002 | Ga0307416_100075990 | Ga0307416_1000759903 | 255 |
| 203 | 3300037466 | Ga0395898_0038575 | Ga0395898_0038575_2632_3399 | 255 |
| 204 | 3300037466 | Ga0395898_0193205 | Ga0395898_0193205_511_1278 | 255 |
| 205 | 3300038443 | Ga0395901_0058980 | Ga0395901_0058980_1753_2520 | 255 |
| 206 | 3300044901 | Ga0466960_0106980 | Ga0466960_0106980_129_896 | 255 |
| 207 | 3300048912 | Ga0496109_0533520 | Ga0496109_0533520_185_952 | 255 |
| 208 | 3300048913 | Ga0496110_0731652 | Ga0496110_0731652_72_839 | 255 |
| 209 | 3300000546 | LJNas_1002420 | LJNas_10024202 | 257 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3mr1-assembly2.cif.gz_B | crystal structure of methionine aminopeptidase from rickettsia prowazekii | 0.991 | 5 | 251 |
| 3tb5-assembly2.cif.gz_B | crystal structure of the enterococcus faecalis methionine aminopeptidase apo form | 0.9872 | 5 | 253 |
| 3mr1-assembly2.cif.gz_B | crystal structure of methionine aminopeptidase from rickettsia prowazekii | 0.9831 | 5 | 251 |
| 1o0x-assembly1.cif.gz_A | crystal structure of methionine aminopeptidase (tm1478) from thermotoga maritima at 1.90 a resolution | 0.9809 | 5 | 251 |
| 4juq-assembly1.cif.gz_A | pseudomonas aeruginosa metap t2n mutant, in mn form | 0.9799 | 5 | 257 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q6Z3V9_1_121_3.90.230.10 | Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily | 0.9931 | 17 | 128 | 3.90.230.10 |
| 4juqD00 | Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily | 0.9864 | 5 | 251 | 3.90.230.10 |
| af_I1J6Q1_1_201_3.90.230.10 | Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily | 0.9831 | 52 | 251 | 3.90.230.10 |
| 1o0xA00 | Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily | 0.9809 | 5 | 251 | 3.90.230.10 |
| af_P9WK19_6_284_3.90.230.10 | Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily | 0.9804 | 8 | 251 | 3.90.230.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7X7PQL7-F1-model_v4 | Methionine aminopeptidase (MAP) (MetAP) (EC 3.4.11.18) (Peptidase M) | 0.9994 | 5 | 251 |
GO:0004239
GO:0005829 GO:0006508 GO:0046872 GO:0070006 |
| AF-A0A7C7DIY6-F1-model_v4 | Methionine aminopeptidase (MAP) (MetAP) (EC 3.4.11.18) (Peptidase M) | 0.9973 | 5 | 251 |
GO:0004239
GO:0005829 GO:0006508 GO:0046872 GO:0070006 |
| AF-A0A537JHA6-F1-model_v4 | M24 family metallopeptidase | 0.9968 | 118 | 251 |
GO:0005829
GO:0006508 GO:0070006 |
| AF-A0A661YHV2-F1-model_v4 | deleted | 0.9967 | 5 | 226 |
|
| AF-A0A853KEB0-F1-model_v4 | Methionine aminopeptidase (MAP) (MetAP) (EC 3.4.11.18) (Peptidase M) | 0.9963 | 5 | 251 |
GO:0004239
GO:0005829 GO:0006508 GO:0046872 GO:0070006 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar