F318468

General Info

Members Datasets Scaffolds Average Seq Length
208 149 416 404

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2508501039|2508671153
Length 466
Sequence PDSRHDGDVVALENLVGIFTRPAASSRSGHPPAAPPQPDWDRLATATATLDPPFAVVDLPALWANAADLVRRAAGKPIRVASKSVRSRAVLRAVLATDGFAGILAYTLPEAIWLAEEFPDVVVGYPTADRAALRTLVDHPFAASRVTLMIDSVEQLDLIDTVLGAARPQLRVCLDLDASLRLAAGRVHLGVRRSPVHSAEQAGELAEAIATRPGFALVGLMAYEAQIAGMGDAPPPPPLPSAAEPADGSGSGSGSGSGSGSAPRLEPARRAAASARAEAVRRMQARSRAELAERRAAAVAAVREVAPGLEFVNGGGTGSVHLTTAEPAVTEIAAGSGLYGPTLFDIYQAFTPAPAALFALPVVRRPAPGIVTVAGGGWIASGPAGPDRVPRPVHPAGLRMIGTEGAGEVQTPLRGPAADTLRIGDRVWFRHAKAGELCEHVNALHLVGADGSVQAVPTYRGEGRAF

Samples

Sample ID Description Type Environment
1 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
5 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
6 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
7 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
8 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
9 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
10 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
11 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
12 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
13 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
14 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
15 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
16 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
17 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
18 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
19 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
20 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
21 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
22 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
23 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
24 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
25 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
26 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
27 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
28 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
29 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
30 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
31 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
32 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
33 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
34 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
35 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
36 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
53 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
54 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
55 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
56 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
57 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
58 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
59 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
60 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
61 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
62 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
63 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
64 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
65 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
66 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
67 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
68 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
69 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
70 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
71 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
72 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
73 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
74 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
75 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
76 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
77 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
78 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
79 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
80 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
81 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
82 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
83 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
84 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
85 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
86 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
87 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
88 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
89 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
90 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
91 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
92 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
93 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
94 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
95 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
96 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
97 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
98 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
99 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
100 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
101 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
102 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
103 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
104 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
105 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
106 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
107 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
108 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
109 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
110 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
111 2508501039 Frankia saprophytica CN3 Isolate Nodule
112 2515154088 Salinispora arenicola CNT800 Isolate Rhizosphere
113 2515154129 Salinispora pacifica CNS103 Isolate Rhizosphere
114 2515154137 Salinispora arenicola CNX482 Isolate Rhizosphere
115 2515154202 Salinispora pacifica CNT084 Isolate Rhizosphere
116 2515154203 Salinispora arenicola CNR921 Isolate Rhizosphere
117 2582580736 Prauserella sp. Am3 Isolate Unclassified
118 2622736626 Micromonospora rhizosphaerae DSM 45431 Isolate Rhizosphere
119 2643221567 Phycicoccus sp. Root563 Isolate Unclassified
120 2643221624 Phycicoccus sp. Root101 Isolate Unclassified
121 2675902999 Frankia asymbiotica NRRL B-16386 Isolate Nodule
122 2675903059 Asanoa hainanensis CGMCC 4.5593 Isolate Rhizosphere
123 2687453737 Frankia sp. BMG5.36 Isolate Nodule
124 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
125 2772190715 Micromonospora chokoriensis NRRL B-24750 Isolate Unclassified
126 2773857921 Frankia asymbiotica NRRL B-16386 Isolate Nodule
127 2831935698 Jishengella sp. AZ1-13 Isolate Unclassified
128 2832004796 Micromonospora endophytica JCM 18317 Isolate Unclassified
129 2855670206 Micromonospora noduli Lupac 07 Isolate Nodule
130 2857737099 Lysinimonas sp. R-73066 Isolate Unclassified
131 2858902515 Micromonospora sp. MW-13 Isolate Rhizosphere
132 2862705112 Streptomyces triticirhizae NEAU-YY642 Isolate Rhizosphere
133 2866065130 Micromonospora endophytica DSM 45430 Isolate Unclassified
134 2867507094 Micromonospora zingiberis PLAI 1-1 Isolate Unclassified
135 2870622029 Conyzicola lurida DSM 105784 Isolate Unclassified
136 2880489317 Micromonospora ureilytica DSM 101692 Isolate Unclassified
137 2990044586 Streptomyces sedi JCM 16909 Isolate Unclassified
138 2995463766 Streptacidiphilus fuscans NEAU-YB345 Isolate Unclassified
139 8002775197 Frankia nepalensis CN7 Isolate Nodule
140 8002784119 Frankia sp. AgB1.9 Isolate Nodule
141 8002811521 Leucobacter chinensis NC76-1 Isolate Rhizosphere
142 8003830390 Micromonospora parastrephiae STR1_7 Isolate Rhizosphere
143 8003856774 Micromonospora echinofusca MPMI6 Isolate Unclassified
144 8003870546 Micromonospora tarensis STR1s_6 Isolate Rhizosphere
145 8008485437 Streptomyces mimosae 3MP-10 Isolate Unclassified
146 8025524527 Streptomyces sp. 3MP-14 Isolate Unclassified
147 8047710418 Umezawaea endophytica DSM 103496 Isolate Unclassified
148 8054727385 Micromonospora alfalfae MED01 Isolate Nodule
149 8055412473 Micromonospora phytophila DSM 105363 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 81.25
Metatranscriptomes 0
Isolates 18.75

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.62
Nodule 4.33
Rhizoplane 2.88
Rhizosphere 66.83
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10021945 3300003203 Bacteria 2554
2 Ga0070683_100011396 3300005329 Bacteria 7686
3 Ga0070670_100226920 3300005331 Bacteria 1625
4 Ga0070661_100065644 3300005344 Bacteria 2667
5 Ga0070668_100007771 3300005347 Bacteria 7962
6 Ga0070668_100039350 3300005347 Bacteria 3616
7 Ga0070659_100237144 3300005366 Bacteria 1508
8 Ga0070713_100123754 3300005436 Bacteria 2272
9 Ga0070662_100207723 3300005457 Bacteria 1557
10 Ga0070684_100065623 3300005535 Bacteria 3186
11 Ga0070672_100262774 3300005543 Bacteria 1456
12 Ga0070665_100029382 3300005548 Bacteria 5532
13 Ga0070664_100023794 3300005564 Bacteria 5060
14 Ga0068857_100116843 3300005577 Bacteria 2400
15 Ga0068859_100000421 3300005617 Bacteria 42369
16 Ga0068859_100094582 3300005617 Bacteria 3040
17 Ga0068859_100180465 3300005617 Bacteria 2194
18 Ga0068861_100128731 3300005719 Bacteria 2052
19 Ga0068863_100003561 3300005841 Bacteria 15368
20 Ga0068860_100367141 3300005843 Bacteria 1419
21 Ga0068862_100000433 3300005844 Bacteria 45464
22 Ga0068862_100041715 3300005844 Bacteria 3906
23 Ga0081455_10006802 3300005937 Bacteria 12189
24 Ga0081538_10000018 3300005981 Bacteria 143542
25 Ga0081539_10000543 3300005985 Bacteria 77988
26 Ga0081539_10001385 3300005985 Bacteria 41835
27 Ga0081539_10002545 3300005985 Bacteria 25328
28 Ga0075365_10006708 3300006038 Bacteria 6365
29 Ga0075365_10139050 3300006038 Bacteria 1685
30 Ga0075363_100048052 3300006048 Bacteria 2268
31 Ga0075364_10023467 3300006051 Bacteria 3905
32 Ga0070712_100153014 3300006175 Bacteria 1773
33 Ga0075428_100000242 3300006844 Bacteria 53310
34 Ga0075428_100023709 3300006844 Bacteria 6792
35 Ga0075430_100000211 3300006846 Bacteria 39886
36 Ga0075430_100013417 3300006846 Bacteria 6983
37 Ga0075430_100053910 3300006846 Bacteria 3385
38 Ga0075431_100013743 3300006847 Bacteria 8177
39 Ga0075431_100112869 3300006847 Bacteria 2805
40 Ga0075431_100286101 3300006847 Bacteria 1669
41 Ga0097620_100000421 3300006931 Bacteria 42369
42 Ga0097620_100094577 3300006931 Bacteria 3040
43 Ga0097620_100180468 3300006931 Bacteria 2194
44 Ga0114129_10000261 3300009147 Bacteria 59447
45 Ga0114129_10026252 3300009147 Bacteria 8249
46 Ga0105248_10000043 3300009177 Bacteria 167170
47 Ga0105249_10191851 3300009553 Bacteria 1995
48 Ga0105239_10376861 3300010375 Bacteria 1604
49 Ga0157372_10054195 3300013307 Bacteria 4472
50 Ga0163163_10004181 3300014325 Bacteria 12299
51 Ga0163163_10207937 3300014325 Bacteria 2006
52 Ga0207693_10163207 3300025915 Bacteria 1753
53 Ga0207657_10053599 3300025919 Bacteria 3493
54 Ga0207706_10155375 3300025933 Bacteria 2012
55 Ga0207669_10118099 3300025937 Bacteria 1794
56 Ga0207711_10000049 3300025941 Bacteria 147090
57 Ga0207689_10079711 3300025942 Bacteria 2691
58 Ga0207661_10005265 3300025944 Bacteria 9103
59 Ga0207679_10009991 3300025945 Bacteria 6098
60 Ga0207712_10121043 3300025961 Bacteria 1980
61 Ga0207668_10006722 3300025972 Bacteria 6804
62 Ga0207658_10047906 3300025986 Bacteria 3131
63 Ga0207641_10001325 3300026088 Bacteria 24525
64 Ga0207676_10278509 3300026095 Bacteria 1518
65 Ga0207674_10101980 3300026116 Bacteria 2850
66 Ga0268265_10000422 3300028380 Bacteria 45478
67 Ga0268265_10029461 3300028380 Bacteria 3940
68 Ga0268265_10056908 3300028380 Bacteria 2978
69 Ga0268264_10039281 3300028381 Bacteria 3910
70 Ga0307515_10000038 3300028794 Bacteria 331376
71 Ga0307515_10021111 3300028794 Bacteria 11563
72 Ga0307515_10122567 3300028794 Bacteria 2931
73 Ga0307513_10113921 3300031456 Bacteria 2691
74 Ga0307509_10003281 3300031507 Bacteria 24863
75 Ga0307408_100307195 3300031548 Bacteria 1331
76 Ga0307516_10008584 3300031730 Bacteria 11534
77 Ga0307516_10020624 3300031730 Bacteria 6806
78 Ga0307516_10107835 3300031730 Bacteria 2593
79 Ga0307413_10083476 3300031824 Bacteria 2056
80 Ga0307406_10012681 3300031901 Bacteria 4807
81 Ga0307406_10068806 3300031901 Bacteria 2313
82 Ga0307406_10161389 3300031901 Bacteria 1611
83 Ga0307407_10020713 3300031903 Bacteria 3375
84 Ga0307409_100000461 3300031995 Bacteria 17297
85 Ga0307409_100031624 3300031995 Bacteria 3823
86 Ga0307409_100154655 3300031995 Bacteria 1997
87 Ga0307409_100157863 3300031995 Bacteria 1979
88 Ga0307409_100335383 3300031995 Bacteria 1421
89 Ga0307416_100000640 3300032002 Bacteria 18061
90 Ga0307415_100000054 3300032126 Bacteria 49124
91 Ga0307415_100000349 3300032126 Bacteria 19837
92 Ga0307415_100034248 3300032126 Bacteria 3305
93 Ga0307415_100053108 3300032126 Bacteria 2759
94 Ga0307415_100093674 3300032126 Bacteria 2182
95 Ga0307507_10041570 3300033179 Bacteria 4597
96 Ga0373940_0002044 3300035088 Bacteria 3832
97 Ga0373951_0000252 3300035091 Bacteria 17713
98 Ga0373942_0001325 3300035207 Bacteria 6432
99 Ga0373935_0012448 3300035692 Bacteria 5118
100 Ga0395898_0004475 3300037466 Bacteria 15278
101 Ga0395898_0020866 3300037466 Bacteria 6648
102 Ga0395901_0014346 3300038443 Bacteria 8068
103 Ga0395901_0052020 3300038443 Bacteria 4258
104 Ga0451793_1086934 3300041452 Bacteria 3785
105 Ga0451793_1745265 3300041452 Bacteria 2661
106 Ga0451853_1053752 3300041512 Bacteria 5687
107 Ga0466967_0153004 3300045976 Bacteria 2158
108 Ga0466967_0324835 3300045976 Bacteria 1485
109 Ga0495590_0000772 3300046457 Bacteria 14521
110 Ga0495664_0000030 3300046477 Bacteria 95156
111 Ga0495594_0022353 3300046499 Bacteria 3383
112 Ga0495606_0000307 3300046507 Bacteria 84368
113 Ga0495668_0000563 3300046616 Bacteria 45601
114 Ga0495625_0000142 3300046660 Bacteria 110278
115 Ga0495600_0026117 3300046809 Bacteria 3767
116 Ga0495626_0000029 3300048091 Bacteria 202868
117 Ga0496102_0000091 3300048905 Bacteria 127153
118 Ga0496102_0015835 3300048905 Bacteria 6575
119 Ga0496102_0203359 3300048905 Bacteria 1867
120 Ga0496103_0000016 3300048906 Bacteria 266127
121 Ga0496116_0000136 3300048919 Bacteria 153155
122 Ga0496118_0003286 3300048921 Bacteria 20575
123 Ga0496118_0008741 3300048921 Bacteria 10394
124 Ga0496119_0018949 3300048922 Bacteria 5096
125 Ga0496126_0001422 3300048929 Bacteria 37787
126 Ga0496126_0094955 3300048929 Bacteria 2616
127 Ga0496126_0235266 3300048929 Bacteria 1533
128 Ga0501031_0046648 3300049568 Bacteria 2825
129 Ga0501031_0111213 3300049568 Bacteria 1789
130 Ga0501032_0075782 3300049569 Bacteria 2240
131 Ga0501032_0080652 3300049569 Bacteria 2165
132 Ga0501034_0080024 3300049571 Bacteria 3271
133 Ga0501034_0084969 3300049571 Bacteria 3166
134 Ga0501034_0231609 3300049571 Bacteria 1796
135 Ga0501034_0384215 3300049571 Bacteria 1328
136 Ga0501037_0037812 3300049573 Bacteria 3558
137 Ga0501037_0139233 3300049573 Bacteria 1737
138 Ga0501038_0001945 3300049574 Bacteria 19054
139 Ga0501038_0044539 3300049574 Bacteria 3853
140 Ga0501038_0132861 3300049574 Bacteria 2041
141 Ga0501039_0238511 3300049575 Bacteria 1430
142 Ga0501047_0010204 3300049581 Bacteria 8884
143 Ga0501047_0032341 3300049581 Bacteria 5049
144 Ga0501073_0000038 3300049589 Bacteria 86286
145 Ga0501080_0036259 3300049742 Bacteria 4604
146 Ga0501044_0005490 3300049823 Bacteria 14085
147 Ga0501044_0094839 3300049823 Bacteria 3007
148 nmdc:mga0yw44_3751_c1 3300050492 Bacteria 6809
149 nmdc:mga05p37_131590_c1 3300050507 Bacteria 3070
150 nmdc:mga09592_4954_c1 3300050508 Bacteria 10790
151 nmdc:mga0qj67_1266_c1 3300050509 Bacteria 17723
152 nmdc:mga0qj67_643_c1 3300050509 Bacteria 24061
153 nmdc:mga06r32_16604_c1 3300050510 Bacteria 6711
154 Ga0500650_0006694 3300053098 Bacteria 4422
155 Ga0500556_0000169 3300053104 Bacteria 53730
156 Ga0500562_002417 3300053108 Bacteria 4686
157 Ga0500593_002689 3300053117 Bacteria 6574
158 Ga0500559_0000296 3300053136 Bacteria 38451
159 Ga0500559_0000886 3300053136 Bacteria 19162
160 Ga0500559_0024062 3300053136 Bacteria 2588
161 Ga0500568_0000164 3300053139 Bacteria 57135
162 Ga0500573_0000018 3300053140 Bacteria 177945
163 Ga0500573_0013104 3300053140 Bacteria 4664
164 Ga0500573_0062335 3300053140 Bacteria 2135
165 Ga0500573_0099473 3300053140 Bacteria 1638
166 Ga0500577_0002314 3300053142 Bacteria 4853
167 Ga0500577_0005235 3300053142 Bacteria 3482
168 Ga0500577_0027881 3300053142 Bacteria 1939
169 Ga0466962_0103284 3300061719 Bacteria 1369
170 2508671153 2508501039 Bacteria 9978592
171 2515497846 2515154088 Bacteria 5526283
172 2515720830 2515154129 Bacteria 5584369
173 2515759567 2515154137 Bacteria 5711575
174 2516085767 2515154202 Bacteria 5471270
175 2516090635 2515154203 Bacteria 5458536
176 2583152542 2582580736 Bacteria 5325865
177 2623586212 2622736626 Bacteria 7181580
178 2643851294 2643221567 Bacteria 4163945
179 2644138165 2643221624 Bacteria 4384879
180 2676203384 2675902999 Bacteria 9438463
181 2676484111 2675903059 Bacteria 8644972
182 2689964217 2687453737 Bacteria 11203906
183 2753269604 2751185782 Bacteria 11227053
184 2772641402 2772190715 Bacteria 6959372
185 2774847960 2773857921 Bacteria 9435764
186 2831937211 2831935698 Bacteria 5963223
187 2832009772 2832004796 Bacteria 6538017
188 2855676620 2855670206 Bacteria 7120389
189 2857738400 2857737099 Bacteria 3104305
190 2858905357 2858902515 Bacteria 7086037
191 2862706946 2862705112 Bacteria 6563286
192 2866066770 2866065130 Bacteria 6518152
193 2867509642 2867507094 Bacteria 6506033
194 2870622649 2870622029 Bacteria 3643329
195 2880494043 2880489317 Bacteria 7096270
196 2990045115 2990044586 Bacteria 6603797
197 2995469257 2995463766 Bacteria 8577691
198 8002777041 8002775197 Bacteria 10728764
199 8002790825 8002784119 Bacteria 9788632
200 8002813786 8002811521 Bacteria 2942897
201 8003834548 8003830390 Bacteria 6541657
202 8003860306 8003856774 Bacteria 7675274
203 8003872462 8003870546 Bacteria 7396674
204 8008486232 8008485437 Bacteria 7198341
205 8025528011 8025524527 Bacteria 7197316
206 8047717514 8047710418 Bacteria 11023148
207 8054728219 8054727385 Bacteria 7558670
208 8055414597 8055412473 Bacteria 6257500
209 JGI25406J46586_10021945
210 Ga0070683_100011396
211 Ga0070670_100226920
212 Ga0070661_100065644
213 Ga0070668_100007771
214 Ga0070668_100039350
215 Ga0070659_100237144
216 Ga0070713_100123754
217 Ga0070662_100207723
218 Ga0070684_100065623
219 Ga0070672_100262774
220 Ga0070665_100029382
221 Ga0070664_100023794
222 Ga0068857_100116843
223 Ga0068859_100000421
224 Ga0068859_100094582
225 Ga0068859_100180465
226 Ga0068861_100128731
227 Ga0068863_100003561
228 Ga0068860_100367141
229 Ga0068862_100000433
230 Ga0068862_100041715
231 Ga0081455_10006802
232 Ga0081538_10000018
233 Ga0081539_10000543
234 Ga0081539_10001385
235 Ga0081539_10002545
236 Ga0075365_10006708
237 Ga0075365_10139050
238 Ga0075363_100048052
239 Ga0075364_10023467
240 Ga0070712_100153014
241 Ga0075428_100000242
242 Ga0075428_100023709
243 Ga0075430_100000211
244 Ga0075430_100013417
245 Ga0075430_100053910
246 Ga0075431_100013743
247 Ga0075431_100112869
248 Ga0075431_100286101
249 Ga0097620_100000421
250 Ga0097620_100094577
251 Ga0097620_100180468
252 Ga0114129_10000261
253 Ga0114129_10026252
254 Ga0105248_10000043
255 Ga0105249_10191851
256 Ga0105239_10376861
257 Ga0157372_10054195
258 Ga0163163_10004181
259 Ga0163163_10207937
260 Ga0207693_10163207
261 Ga0207657_10053599
262 Ga0207706_10155375
263 Ga0207669_10118099
264 Ga0207711_10000049
265 Ga0207689_10079711
266 Ga0207661_10005265
267 Ga0207679_10009991
268 Ga0207712_10121043
269 Ga0207668_10006722
270 Ga0207658_10047906
271 Ga0207641_10001325
272 Ga0207676_10278509
273 Ga0207674_10101980
274 Ga0268265_10000422
275 Ga0268265_10029461
276 Ga0268265_10056908
277 Ga0268264_10039281
278 Ga0307515_10000038
279 Ga0307515_10021111
280 Ga0307515_10122567
281 Ga0307513_10113921
282 Ga0307509_10003281
283 Ga0307408_100307195
284 Ga0307516_10008584
285 Ga0307516_10020624
286 Ga0307516_10107835
287 Ga0307413_10083476
288 Ga0307406_10012681
289 Ga0307406_10068806
290 Ga0307406_10161389
291 Ga0307407_10020713
292 Ga0307409_100000461
293 Ga0307409_100031624
294 Ga0307409_100154655
295 Ga0307409_100157863
296 Ga0307409_100335383
297 Ga0307416_100000640
298 Ga0307415_100000054
299 Ga0307415_100000349
300 Ga0307415_100034248
301 Ga0307415_100053108
302 Ga0307415_100093674
303 Ga0307507_10041570
304 Ga0373940_0002044
305 Ga0373951_0000252
306 Ga0373942_0001325
307 Ga0373935_0012448
308 Ga0395898_0004475
309 Ga0395898_0020866
310 Ga0395901_0014346
311 Ga0395901_0052020
312 Ga0451793_1086934
313 Ga0451793_1745265
314 Ga0451853_1053752
315 Ga0466967_0153004
316 Ga0466967_0324835
317 Ga0495590_0000772
318 Ga0495664_0000030
319 Ga0495594_0022353
320 Ga0495606_0000307
321 Ga0495668_0000563
322 Ga0495625_0000142
323 Ga0495600_0026117
324 Ga0495626_0000029
325 Ga0496102_0000091
326 Ga0496102_0015835
327 Ga0496102_0203359
328 Ga0496103_0000016
329 Ga0496116_0000136
330 Ga0496118_0003286
331 Ga0496118_0008741
332 Ga0496119_0018949
333 Ga0496126_0001422
334 Ga0496126_0094955
335 Ga0496126_0235266
336 Ga0501031_0046648
337 Ga0501031_0111213
338 Ga0501032_0075782
339 Ga0501032_0080652
340 Ga0501034_0080024
341 Ga0501034_0084969
342 Ga0501034_0231609
343 Ga0501034_0384215
344 Ga0501037_0037812
345 Ga0501037_0139233
346 Ga0501038_0001945
347 Ga0501038_0044539
348 Ga0501038_0132861
349 Ga0501039_0238511
350 Ga0501047_0010204
351 Ga0501047_0032341
352 Ga0501073_0000038
353 Ga0501080_0036259
354 Ga0501044_0005490
355 Ga0501044_0094839
356 nmdc:mga0yw44_3751_c1
357 nmdc:mga05p37_131590_c1
358 nmdc:mga09592_4954_c1
359 nmdc:mga0qj67_1266_c1
360 nmdc:mga0qj67_643_c1
361 nmdc:mga06r32_16604_c1
362 Ga0500650_0006694
363 Ga0500556_0000169
364 Ga0500562_002417
365 Ga0500593_002689
366 Ga0500559_0000296
367 Ga0500559_0000886
368 Ga0500559_0024062
369 Ga0500568_0000164
370 Ga0500573_0000018
371 Ga0500573_0013104
372 Ga0500573_0062335
373 Ga0500573_0099473
374 Ga0500577_0002314
375 Ga0500577_0005235
376 Ga0500577_0027881
377 Ga0466962_0103284
378 2508671153
379 2515497846
380 2515720830
381 2515759567
382 2516085767
383 2516090635
384 2583152542
385 2623586212
386 2643851294
387 2644138165
388 2676203384
389 2676484111
390 2689964217
391 2753269604
392 2772641402
393 2774847960
394 2831937211
395 2832009772
396 2855676620
397 2857738400
398 2858905357
399 2862706946
400 2866066770
401 2867509642
402 2870622649
403 2880494043
404 2990045115
405 2995469257
406 8002777041
407 8002790825
408 8002813786
409 8003834548
410 8003860306
411 8003872462
412 8008486232
413 8025528011
414 8047717514
415 8054728219
416 8055414597

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01168

Ala_racemase_N

Alanine racemase, N-terminal domain

57

239

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
4v15-assembly1.cif.gz_B crystal structure of d-threonine aldolase from alcaligenes xylosoxidans 0.8589 20 394
6qkb-assembly1.cif.gz_B crystal structure of the beta-hydroxyaspartate aldolase of paracoccus denitrificans 0.8511 19 395
7dib-assembly1.cif.gz_B crystal structure of d-threonine aldolase from filomicrobium marinum 0.8334 19 395
7dib-assembly1.cif.gz_A crystal structure of d-threonine aldolase from filomicrobium marinum 0.8266 20 392
4v15-assembly1.cif.gz_B crystal structure of d-threonine aldolase from alcaligenes xylosoxidans 0.8137 20 394
ID Description Score Start End Superfamily
af_O06802_287_414_2.40.37.20 Mainly Beta;Beta Barrel;Lyase, Ornithine Decarboxylase; Chain A, domain 1;D-serine dehydratase-like domain 0.9838 273 398 2.40.37.20
af_O06802_287_414_2.40.37.20 Mainly Beta;Beta Barrel;Lyase, Ornithine Decarboxylase; Chain A, domain 1;D-serine dehydratase-like domain 0.9612 273 398 2.40.37.20
af_O06802_42_286_3.20.20.10 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Alanine racemase 0.9328 29 271 3.20.20.10
af_O06802_42_286_3.20.20.10 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Alanine racemase 0.9217 29 271 3.20.20.10
4v15B02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Alanine racemase 0.8283 29 268 3.20.20.10
ID Description Score Start End GO Terms
AF-A0A2T0PWF5-F1-model_v4 D-serine deaminase-like pyridoxal phosphate-dependent protein 0.9905 5 398 GO:0008721
GO:0036088
AF-A0A7Y6INW0-F1-model_v4 Amino acid deaminase/aldolase 0.986 10 398 GO:0008721
GO:0036088
AF-A0A545AW41-F1-model_v4 Amino acid deaminase/aldolase 0.9844 1 397 GO:0008721
GO:0036088
AF-S2ZHY4-F1-model_v4 Alanine racemase N-terminal domain-containing protein 0.9829 1 398 GO:0008721
GO:0036088
AF-L1KQQ0-F1-model_v4 Alanine racemase N-terminal domain-containing protein 0.9823 3 398 GO:0008721
GO:0036088

Map