F318266

General Info

Members Datasets Scaffolds Average Seq Length
208 160 167 154

Family's Representative Sequence

Representative Sequence 3300046539|Ga0495621_0063447|Ga0495621_0063447_602_1132
Length 176
Sequence MQSKASTVEEYLASLPEDRRIAISRVRDVILANLDKDYEEGMSYGMIGYYVPHRVFPAGYHCDPKQGLPFAGLASQKNHMSAYLMGLYCGCVEGVNDTALVRWFREAWAKSGKKKLDMGKSCIRFKKVDDLALDVLGEAIRRMPAKTYIDLYMKARRDIENAGGARKAAAKRRQLA

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2511231000 Chryseobacterium populi CF314 Isolate Rhizosphere
3 2523533629 Kaistella palustris DSM 21579 Isolate Rhizosphere
4 2582581278 Chryseobacterium sp. CF365 Isolate Rhizosphere
5 2582581281 Chryseobacterium sp. CF284 Isolate Rhizosphere
6 2582581282 Chryseobacterium sp. CF299 Isolate Rhizosphere
7 2582581873 Chryseobacterium sp. OV259 Isolate Rhizosphere
8 2585428045 Chryseobacterium sp. OV705 Isolate Rhizosphere
9 2585428060 Chryseobacterium sp. OV715 Isolate Rhizosphere
10 2585428061 Chryseobacterium sp. CF356 Isolate Rhizosphere
11 2585428095 Chryseobacterium sp. YR005 Isolate Rhizosphere
12 2585428115 Chryseobacterium sp. YR561 Isolate Rhizosphere
13 2585428182 Chryseobacterium sp. YR477 Isolate Rhizosphere
14 2585428183 Chryseobacterium sp. YR485 Isolate Rhizosphere
15 2585428184 Chryseobacterium sp. YR480 Isolate Rhizosphere
16 2585428185 Chryseobacterium sp. YR459 Isolate Rhizosphere
17 2585428187 Chryseobacterium sp. YR460 Isolate Rhizosphere
18 2588253712 Chryseobacterium sp. OV279 Isolate Rhizosphere
19 2588254255 Chryseobacterium sp. YR221 Isolate Rhizosphere
20 2588254257 Chryseobacterium sp. YR203 Isolate Rhizosphere
21 2728369107 Chryseobacterium kwangjuense KJ1R5 Isolate Unclassified
22 2738541273 Elizabethkingia sp. YR214 Isolate Unclassified
23 2738543014 Elizabethkingia sp. YR191 Isolate Unclassified
24 2739367874 Chryseobacterium sp. T16E-39 Isolate Unclassified
25 2751185877 Chryseobacterium artocarpi UTM-3 Isolate Rhizosphere
26 2765235839 Chryseobacterium indologenes AA5 Isolate Unclassified
27 2772190705 Chryseobacterium contaminans C-26 Isolate Rhizosphere
28 2775506739 Chryseobacterium sp. 1335 Isolate Unclassified
29 2816332188 Chryseobacterium aquifrigidense 110 (version 2) Isolate Unclassified
30 2842083920 Chryseobacterium lathyri KCTC 22544 Isolate Rhizosphere
31 2871720351 Chryseobacterium sp. KLBC 52 Isolate Nodule
32 2889290771 Chryseobacterium sp. PvR013 Isolate Rhizosphere
33 2905999023 Chryseobacterium elymi KCTC 22547 Isolate Rhizosphere
34 2919097161 Chryseobacterium ginsenosidimutans 1394 Isolate Rhizosphere
35 2919399522 Chryseobacterium sp. 2987 Isolate Unclassified
36 2945924605 Chryseobacterium ginsenosidimutans W1I9 Isolate Rhizosphere
37 2946019816 Chryseobacterium sp. W4I1 Isolate Rhizosphere
38 2977243572 Chryseobacterium sp. SORGH_AS 447 Isolate Unclassified
39 2984572630 Chryseobacterium sp. SORGH_AS909 Isolate Aerial Root
40 2984606641 Chryseobacterium sp. SORGH_AS1175 Isolate Aerial Root
41 2993372514 Chryseobacterium sp. SLBN-27 Isolate Rhizosphere
42 2993480792 Chryseobacterium nepalense SLBN-92 Isolate Rhizosphere
43 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
44 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
45 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
46 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
47 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
48 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
49 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
50 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
51 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
52 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
53 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
54 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
55 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
56 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
57 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
58 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
59 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
60 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
61 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
62 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
63 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
64 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
65 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
66 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
67 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
68 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
69 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
70 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
71 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
72 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
73 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
74 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
75 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
76 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
79 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
80 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
81 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
82 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
83 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
84 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
85 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
88 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
89 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
90 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
91 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
92 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
93 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
110 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
111 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
112 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
113 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
114 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
115 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
116 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
117 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
118 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
119 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
120 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
121 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
122 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
123 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
124 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
125 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
126 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
127 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
128 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
129 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
130 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
131 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
132 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
133 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
134 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
135 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
136 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
137 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
138 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
139 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
140 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
141 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
142 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
143 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
144 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
145 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
146 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
147 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
148 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
149 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
150 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
151 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
152 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
153 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
154 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
155 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
156 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
157 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
158 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
159 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
160 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 79.33
Metatranscriptomes 0.96
Isolates 19.71

Biome Distribution

Category Percentage (%)
Aerial Root 0.96
Bulb 0
Endosphere 1.44
Nodule 0.48
Rhizoplane 0.96
Rhizosphere 79.33
Stem 0
Stem Tuber 0
Unclassified 16.83

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1753355 2162886007 Bacteria 2033
2 JGI24741J21665_1000682 3300001915 Bacteria 10247
3 rootL2_10078491 3300003322 Bacteria 9394
4 rootH1_10324669 3300003323 Bacteria 3172
5 Ga0006562J51391_1022128 3300003578 Bacteria 809
6 Ga0055534_1008046 3300003784 Bacteria 2432
7 Ga0065714_10066326 3300005288 Bacteria 7098
8 Ga0065714_10135890 3300005288 Bacteria 1210
9 Ga0065704_10083714 3300005289 Bacteria 3428
10 Ga0065704_10091276 3300005289 Bacteria 2728
11 Ga0065704_10238151 3300005289 Bacteria 1023
12 Ga0065707_10093922 3300005295 Bacteria 3563
13 Ga0070658_10584626 3300005327 Bacteria 967
14 Ga0070683_100010573 3300005329 Bacteria 7934
15 Ga0070683_100650495 3300005329 Bacteria 1009
16 Ga0070677_10183454 3300005333 Unclassified 998
17 Ga0070682_100000002 3300005337 Bacteria 506802
18 Ga0070682_100000561 3300005337 Bacteria 22887
19 Ga0070660_100170999 3300005339 Bacteria 1755
20 Ga0070661_100336118 3300005344 Unclassified 1182
21 Ga0070661_100418910 3300005344 Bacteria 1061
22 Ga0070668_100455647 3300005347 Bacteria 1100
23 Ga0070671_100775072 3300005355 Bacteria 834
24 Ga0070673_100366170 3300005364 Bacteria 1282
25 Ga0070663_100379195 3300005455 Bacteria 1151
26 Ga0070678_100253574 3300005456 Bacteria 1476
27 Ga0070684_100024072 3300005535 Bacteria 5104
28 Ga0070684_101173282 3300005535 Bacteria 722
29 Ga0070672_100931751 3300005543 Bacteria 768
30 Ga0070664_100146694 3300005564 Bacteria 2081
31 Ga0068857_100369330 3300005577 Bacteria 1331
32 Ga0068858_100830768 3300005842 Bacteria 902
33 Ga0068860_100178493 3300005843 Bacteria 2052
34 Ga0075428_100596166 3300006844 Unclassified 1180
35 Ga0075428_100987015 3300006844 Bacteria 892
36 Ga0075430_100599598 3300006846 Bacteria 909
37 Ga0075431_100602615 3300006847 Bacteria 1082
38 Ga0075433_10436007 3300006852 Bacteria 1155
39 Ga0075429_100503680 3300006880 Bacteria 1061
40 Ga0068865_100336789 3300006881 Bacteria 1218
41 Ga0105244_10000001 3300009036 Bacteria 1034899
42 Ga0105250_10004071 3300009092 Bacteria 6797
43 Ga0111539_10019611 3300009094 Bacteria 8343
44 Ga0111539_11760869 3300009094 Bacteria 718
45 Ga0114129_11321496 3300009147 Bacteria 893
46 Ga0105243_10000603 3300009148 Bacteria 35815
47 Ga0105242_11597931 3300009176 Unclassified 685
48 Ga0105249_10047393 3300009553 Bacteria 3916
49 Ga0157373_10000214 3300013100 Bacteria 47231
50 Ga0157373_10116486 3300013100 Bacteria 1878
51 Ga0157371_10000052 3300013102 Bacteria 179522
52 Ga0157371_10082165 3300013102 Bacteria 2281
53 Ga0157370_10022232 3300013104 Bacteria 6310
54 Ga0157370_10357424 3300013104 Bacteria 1346
55 Ga0157370_10908444 3300013104 Bacteria 799
56 Ga0157369_10653847 3300013105 Bacteria 1084
57 Ga0157378_10001092 3300013297 Bacteria 24799
58 Ga0157375_10000174 3300013308 Bacteria 59683
59 Ga0157380_10017196 3300014326 Bacteria 5348
60 Ga0182008_10000016 3300014497 Bacteria 241246
61 Ga0182006_1000003 3300015261 Bacteria 826681
62 Ga0182007_10043183 3300015262 Bacteria 1499
63 Ga0163161_10002859 3300017792 Bacteria 12239
64 Ga0163161_10031803 3300017792 Bacteria 3763
65 Ga0209675_1000077 3300025291 Bacteria 156212
66 Ga0207696_1019837 3300025711 Bacteria 2178
67 Ga0207655_1000018 3300025728 Bacteria 537129
68 Ga0207682_10301331 3300025893 Unclassified 751
69 Ga0207705_10478216 3300025909 Bacteria 967
70 Ga0207657_10166048 3300025919 Bacteria 1790
71 Ga0207649_10350901 3300025920 Bacteria 1092
72 Ga0207644_10531390 3300025931 Bacteria 972
73 Ga0207709_10000161 3300025935 Bacteria 91314
74 Ga0207669_11447406 3300025937 Bacteria 585
75 Ga0207691_10844191 3300025940 Bacteria 768
76 Ga0207661_10018434 3300025944 Bacteria 5185
77 Ga0207668_11259030 3300025972 Bacteria 665
78 Ga0207640_10217461 3300025981 Bacteria 1460
79 Ga0207678_10424308 3300026067 Bacteria 1153
80 Ga0207674_10015457 3300026116 Bacteria 8385
81 Ga0207683_10288191 3300026121 Bacteria 1501
82 Ga0207428_10027668 3300027907 Bacteria 4719
83 Ga0265760_10003228 3300031090 Bacteria 4777
84 Ga0307405_10338281 3300031731 Unclassified 1156
85 Ga0307405_10936452 3300031731 Unclassified 735
86 Ga0307413_10010650 3300031824 Bacteria 4475
87 Ga0307413_11059143 3300031824 Unclassified 698
88 Ga0307413_11525417 3300031824 Bacteria 591
89 Ga0307410_10079378 3300031852 Bacteria 2299
90 Ga0307410_10135158 3300031852 Bacteria 1817
91 Ga0307406_10404562 3300031901 Unclassified 1083
92 Ga0307406_11206322 3300031901 Unclassified 657
93 Ga0307407_10142997 3300031903 Bacteria 1546
94 Ga0307407_10146557 3300031903 Bacteria 1529
95 Ga0307407_10486304 3300031903 Bacteria 902
96 Ga0307412_10000101 3300031911 Bacteria 70644
97 Ga0307412_10003894 3300031911 Bacteria 8309
98 Ga0307412_10194684 3300031911 Bacteria 1535
99 Ga0307412_10408898 3300031911 Bacteria 1107
100 Ga0307409_100012777 3300031995 Bacteria 5366
101 Ga0307409_100155108 3300031995 Bacteria 1994
102 Ga0307409_100915096 3300031995 Bacteria 891
103 Ga0307416_100000013 3300032002 Bacteria 283585
104 Ga0307416_100599759 3300032002 Bacteria 1181
105 Ga0307416_101558455 3300032002 Bacteria 766
106 Ga0307414_10000004 3300032004 Bacteria 472218
107 Ga0307414_10255977 3300032004 Unclassified 1458
108 Ga0307414_10346662 3300032004 Bacteria 1273
109 Ga0307414_10456803 3300032004 Bacteria 1121
110 Ga0307411_10013078 3300032005 Bacteria 4561
111 Ga0307411_10422382 3300032005 Bacteria 1108
112 Ga0307415_100691190 3300032126 Bacteria 919
113 Ga0307415_101267191 3300032126 Unclassified 697
114 Ga0316574_0502497 3300035398 Bacteria 756
115 Ga0439465_0000065 3300041413 Bacteria 22866
116 Ga0451577_0007028 3300042876 Bacteria 11101
117 Ga0453684_0020889 3300044712 Bacteria 9826
118 Ga0466967_1455837 3300045976 Bacteria 682
119 Ga0495627_000068 3300046453 Bacteria 126904
120 Ga0495627_159802 3300046453 Bacteria 627
121 Ga0495590_0015255 3300046457 Bacteria 2791
122 Ga0495638_0132667 3300046460 Bacteria 1462
123 Ga0495596_0000866 3300046500 Bacteria 18212
124 Ga0495606_0028755 3300046507 Bacteria 3914
125 Ga0495610_0000006 3300046512 Bacteria 856822
126 Ga0495632_0002488 3300046519 Bacteria 13986
127 Ga0495643_0000140 3300046522 Bacteria 115947
128 Ga0495663_0000287 3300046525 Bacteria 19275
129 Ga0495654_0000017 3300046530 Bacteria 295999
130 Ga0495609_0000017 3300046538 Bacteria 306684
131 Ga0495621_0063447 3300046539 Bacteria 1346
132 Ga0495633_0000037 3300046558 Bacteria 184006
133 Ga0495633_0001355 3300046558 Bacteria 19200
134 Ga0495625_0001404 3300046660 Bacteria 29503
135 Ga0495636_0005702 3300047318 Bacteria 4881
136 Ga0495686_0007654 3300047472 Bacteria 8065
137 Ga0496102_0725941 3300048905 Bacteria 916
138 Ga0496103_0664616 3300048906 Bacteria 661
139 Ga0496116_0000052 3300048919 Bacteria 295469
140 Ga0496117_0000027 3300048920 Bacteria 412234
141 Ga0496117_0375361 3300048920 Bacteria 726
142 Ga0496118_0000375 3300048921 Bacteria 75195
143 Ga0496118_0153773 3300048921 Bacteria 1435
144 Ga0496119_0000006 3300048922 Bacteria 505999
145 Ga0496121_0304473 3300048924 Bacteria 1080
146 Ga0496122_0000229 3300048925 Bacteria 125600
147 Ga0496122_0000230 3300048925 Bacteria 125542
148 Ga0496122_0000397 3300048925 Bacteria 92511
149 Ga0496122_0007135 3300048925 Bacteria 12533
150 Ga0496122_0030400 3300048925 Bacteria 4525
151 Ga0496122_0461022 3300048925 Bacteria 628
152 Ga0496123_0001467 3300048926 Bacteria 32731
153 Ga0496123_0006791 3300048926 Bacteria 10989
154 Ga0496123_0070973 3300048926 Bacteria 2176
155 Ga0496124_0001244 3300048927 Bacteria 39137
156 Ga0496124_0102810 3300048927 Bacteria 2311
157 Ga0496125_0003946 3300048928 Bacteria 17507
158 Ga0496125_0014999 3300048928 Bacteria 7524
159 Ga0496125_0020161 3300048928 Bacteria 6267
160 Ga0496126_0002697 3300048929 Bacteria 23467
161 Ga0496126_0117345 3300048929 Bacteria 2312
162 Ga0501241_000003 3300049758 Bacteria 178857
163 Ga0501269_000053 3300049766 Bacteria 35616
164 nmdc:mga09592_1378538_c1 3300050508 Unclassified 577
165 nmdc:mga06r32_213084_c1 3300050510 Bacteria 1919
166 nmdc:mga08y16_19122_c1 3300050511 Bacteria 7217
167 Ga0500616_0000047 3300053153 Bacteria 322354

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005288 Ga0065714_10135890 Ga0065714_101358902 125
2 3300013104 Ga0157370_10908444 Ga0157370_109084441 125
3 3300046538 Ga0495609_0000017 Ga0495609_0000017_89642_90154 125
4 3300005288 Ga0065714_10066326 Ga0065714_100663262 134
5 3300049758 Ga0501241_000003 Ga0501241_000003_114482_114940 138
6 iso_pu_bacteria 2738541273 2738699856 145
7 iso_pu_bacteria 2738543014 2739253605 145
8 3300031731 Ga0307405_10338281 Ga0307405_103382811 146
9 3300031731 Ga0307405_10936452 Ga0307405_109364521 146
10 3300031824 Ga0307413_10010650 Ga0307413_100106501 146
11 3300031824 Ga0307413_11059143 Ga0307413_110591431 146
12 3300031852 Ga0307410_10079378 Ga0307410_100793783 146
13 3300031852 Ga0307410_10135158 Ga0307410_101351582 146
14 3300031901 Ga0307406_10404562 Ga0307406_104045621 146
15 3300031903 Ga0307407_10142997 Ga0307407_101429972 146
16 3300031911 Ga0307412_10408898 Ga0307412_104088981 146
17 3300031995 Ga0307409_100012777 Ga0307409_1000127775 146
18 3300031995 Ga0307409_100915096 Ga0307409_1009150962 146
19 3300032002 Ga0307416_100599759 Ga0307416_1005997592 146
20 3300032004 Ga0307414_10255977 Ga0307414_102559772 146
21 3300032005 Ga0307411_10013078 Ga0307411_100130783 146
22 3300032005 Ga0307411_10422382 Ga0307411_104223824 146
23 3300032126 Ga0307415_100691190 Ga0307415_1006911901 146
24 3300005344 Ga0070661_100336118 Ga0070661_1003361182 147
25 iso_pu_bacteria 2511231000 2511232278 147
26 iso_pu_bacteria 2523533629 2524006774 147
27 iso_pu_bacteria 2582581278 2585143780 147
28 iso_pu_bacteria 2582581281 2585158402 147
29 iso_pu_bacteria 2582581282 2585162613 147
30 iso_pu_bacteria 2582581873 2585426955 147
31 iso_pu_bacteria 2585428045 2587679441 147
32 iso_pu_bacteria 2585428060 2587747046 147
33 iso_pu_bacteria 2585428061 2587753367 147
34 iso_pu_bacteria 2585428095 2587867120 147
35 iso_pu_bacteria 2585428115 2587945213 147
36 iso_pu_bacteria 2585428182 2588210386 147
37 iso_pu_bacteria 2585428183 2588214370 147
38 iso_pu_bacteria 2585428184 2588217551 147
39 iso_pu_bacteria 2585428185 2588223183 147
40 iso_pu_bacteria 2585428187 2588232842 147
41 iso_pu_bacteria 2588253712 2588443943 147
42 iso_pu_bacteria 2588254255 2590601645 147
43 iso_pu_bacteria 2588254257 2590613648 147
44 iso_pu_bacteria 2728369107 2729200166 147
45 iso_pu_bacteria 2739367874 2740059154 147
46 iso_pu_bacteria 2751185877 2753673215 147
47 iso_pu_bacteria 2765235839 2765574319 147
48 iso_pu_bacteria 2772190705 2772603970 147
49 iso_pu_bacteria 2775506739 2775671875 147
50 iso_pu_bacteria 2816332188 2816874539 147
51 iso_pu_bacteria 2842083920 2842088111 147
52 iso_pu_bacteria 2871720351 2871724193 147
53 iso_pu_bacteria 2889290771 2889295167 147
54 iso_pu_bacteria 2905999023 2906002047 147
55 iso_pu_bacteria 2919097161 2919098685 147
56 iso_pu_bacteria 2919399522 2919402148 147
57 iso_pu_bacteria 2945924605 2945925937 147
58 iso_pu_bacteria 2946019816 2946022777 147
59 iso_pu_bacteria 2977243572 2977244867 147
60 iso_pu_bacteria 2984572630 2984573221 147
61 iso_pu_bacteria 2984606641 2984606652 147
62 iso_pu_bacteria 2993372514 2993374728 147
63 iso_pu_bacteria 2993480792 2993481593 147
64 3300005333 Ga0070677_10183454 Ga0070677_101834542 149
65 3300005337 Ga0070682_100000002 Ga0070682_100000002130 149
66 3300005577 Ga0068857_100369330 Ga0068857_1003693302 149
67 3300009553 Ga0105249_10047393 Ga0105249_100473934 149
68 3300025893 Ga0207682_10301331 Ga0207682_103013311 149
69 3300025981 Ga0207640_10217461 Ga0207640_102174612 149
70 3300026116 Ga0207674_10015457 Ga0207674_100154579 149
71 3300003322 rootL2_10078491 rootL2_100784915 150
72 3300005289 Ga0065704_10238151 Ga0065704_102381512 150
73 3300005295 Ga0065707_10093922 Ga0065707_100939222 150
74 3300005329 Ga0070683_100650495 Ga0070683_1006504951 150
75 3300005355 Ga0070671_100775072 Ga0070671_1007750721 150
76 3300005364 Ga0070673_100366170 Ga0070673_1003661702 150
77 3300005535 Ga0070684_101173282 Ga0070684_1011732821 150
78 3300005543 Ga0070672_100931751 Ga0070672_1009317511 150
79 3300005564 Ga0070664_100146694 Ga0070664_1001466941 150
80 3300005842 Ga0068858_100830768 Ga0068858_1008307681 150
81 3300005843 Ga0068860_100178493 Ga0068860_1001784932 150
82 3300006844 Ga0075428_100987015 Ga0075428_1009870152 150
83 3300006847 Ga0075431_100602615 Ga0075431_1006026152 150
84 3300006880 Ga0075429_100503680 Ga0075429_1005036802 150
85 3300006881 Ga0068865_100336789 Ga0068865_1003367892 150
86 3300009094 Ga0111539_10019611 Ga0111539_100196115 150
87 3300009094 Ga0111539_11760869 Ga0111539_117608692 150
88 3300009147 Ga0114129_11321496 Ga0114129_113214962 150
89 3300013297 Ga0157378_10001092 Ga0157378_100010928 150
90 3300014326 Ga0157380_10017196 Ga0157380_100171962 150
91 3300025931 Ga0207644_10531390 Ga0207644_105313901 150
92 3300025937 Ga0207669_11447406 Ga0207669_114474061 150
93 3300025940 Ga0207691_10844191 Ga0207691_108441911 150
94 3300027907 Ga0207428_10027668 Ga0207428_100276684 150
95 3300031090 Ga0265760_10003228 Ga0265760_100032284 150
96 3300031901 Ga0307406_11206322 Ga0307406_112063221 150
97 3300031903 Ga0307407_10146557 Ga0307407_101465572 150
98 3300031903 Ga0307407_10486304 Ga0307407_104863042 150
99 3300031911 Ga0307412_10194684 Ga0307412_101946842 150
100 3300031995 Ga0307409_100155108 Ga0307409_1001551083 150
101 3300032002 Ga0307416_101558455 Ga0307416_1015584551 150
102 3300032126 Ga0307415_101267191 Ga0307415_1012671911 150
103 3300042876 Ga0451577_0007028 Ga0451577_0007028_4704_5237 150
104 3300044712 Ga0453684_0020889 Ga0453684_0020889_7259_7792 150
105 3300045976 Ga0466967_1455837 Ga0466967_1455837_145_603 150
106 3300046522 Ga0495643_0000140 Ga0495643_0000140_56914_57429 150
107 3300047318 Ga0495636_0005702 Ga0495636_0005702_3633_4196 150
108 3300050510 nmdc:mga06r32_213084_c1 nmdc:mga06r32_213084_c1_1074_1571 150
109 3300050511 nmdc:mga08y16_19122_c1 nmdc:mga08y16_19122_c1_4357_4905 150
110 3300053153 Ga0500616_0000047 Ga0500616_0000047_65157_65624 150
111 2162886007 SwRhRL2b_contig_1753355 SwRhRL2b_0604.00004640 151
112 3300001915 JGI24741J21665_1000682 JGI24741J21665_10006823 151
113 3300003323 rootH1_10324669 rootH1_103246693 151
114 3300003578 Ga0006562J51391_1022128 Ga0006562J51391_10221281 151
115 3300003784 Ga0055534_1008046 Ga0055534_10080462 151
116 3300005289 Ga0065704_10083714 Ga0065704_100837142 151
117 3300005289 Ga0065704_10091276 Ga0065704_100912762 151
118 3300005327 Ga0070658_10584626 Ga0070658_105846262 151
119 3300005329 Ga0070683_100010573 Ga0070683_1000105737 151
120 3300005337 Ga0070682_100000561 Ga0070682_10000056113 151
121 3300005339 Ga0070660_100170999 Ga0070660_1001709993 151
122 3300005344 Ga0070661_100418910 Ga0070661_1004189102 151
123 3300005347 Ga0070668_100455647 Ga0070668_1004556472 151
124 3300005455 Ga0070663_100379195 Ga0070663_1003791952 151
125 3300005456 Ga0070678_100253574 Ga0070678_1002535742 151
126 3300005535 Ga0070684_100024072 Ga0070684_1000240722 151
127 3300006844 Ga0075428_100596166 Ga0075428_1005961662 151
128 3300006846 Ga0075430_100599598 Ga0075430_1005995982 151
129 3300006852 Ga0075433_10436007 Ga0075433_104360072 151
130 3300009036 Ga0105244_10000001 Ga0105244_10000001491 151
131 3300009092 Ga0105250_10004071 Ga0105250_100040715 151
132 3300009148 Ga0105243_10000603 Ga0105243_1000060321 151
133 3300009176 Ga0105242_11597931 Ga0105242_115979311 151
134 3300013100 Ga0157373_10000214 Ga0157373_1000021411 151
135 3300013100 Ga0157373_10116486 Ga0157373_101164862 151
136 3300013102 Ga0157371_10000052 Ga0157371_100000524 151
137 3300013102 Ga0157371_10082165 Ga0157371_100821652 151
138 3300013104 Ga0157370_10022232 Ga0157370_100222323 151
139 3300013104 Ga0157370_10357424 Ga0157370_103574242 151
140 3300013105 Ga0157369_10653847 Ga0157369_106538472 151
141 3300013308 Ga0157375_10000174 Ga0157375_1000017414 151
142 3300014497 Ga0182008_10000016 Ga0182008_10000016108 151
143 3300015261 Ga0182006_1000003 Ga0182006_1000003423 151
144 3300015262 Ga0182007_10043183 Ga0182007_100431832 151
145 3300017792 Ga0163161_10002859 Ga0163161_100028598 151
146 3300017792 Ga0163161_10031803 Ga0163161_100318035 151
147 3300025291 Ga0209675_1000077 Ga0209675_100007772 151
148 3300025711 Ga0207696_1019837 Ga0207696_10198372 151
149 3300025728 Ga0207655_1000018 Ga0207655_100001821 151
150 3300025909 Ga0207705_10478216 Ga0207705_104782162 151
151 3300025919 Ga0207657_10166048 Ga0207657_101660482 151
152 3300025920 Ga0207649_10350901 Ga0207649_103509011 151
153 3300025935 Ga0207709_10000161 Ga0207709_1000016122 151
154 3300025944 Ga0207661_10018434 Ga0207661_100184343 151
155 3300025972 Ga0207668_11259030 Ga0207668_112590301 151
156 3300026067 Ga0207678_10424308 Ga0207678_104243082 151
157 3300026121 Ga0207683_10288191 Ga0207683_102881913 151
158 3300031824 Ga0307413_11525417 Ga0307413_115254171 151
159 3300031911 Ga0307412_10000101 Ga0307412_1000010113 151
160 3300031911 Ga0307412_10003894 Ga0307412_100038944 151
161 3300032002 Ga0307416_100000013 Ga0307416_100000013256 151
162 3300032004 Ga0307414_10000004 Ga0307414_1000000462 151
163 3300032004 Ga0307414_10346662 Ga0307414_103466622 151
164 3300032004 Ga0307414_10456803 Ga0307414_104568032 151
165 3300035398 Ga0316574_0502497 Ga0316574_0502497_149_604 151
166 3300041413 Ga0439465_0000065 Ga0439465_0000065_4555_5010 151
167 3300046453 Ga0495627_000068 Ga0495627_000068_18067_18522 151
168 3300046453 Ga0495627_159802 Ga0495627_159802_136_591 151
169 3300046457 Ga0495590_0015255 Ga0495590_0015255_424_879 151
170 3300046460 Ga0495638_0132667 Ga0495638_0132667_380_835 151
171 3300046500 Ga0495596_0000866 Ga0495596_0000866_15443_15898 151
172 3300046507 Ga0495606_0028755 Ga0495606_0028755_3126_3581 151
173 3300046512 Ga0495610_0000006 Ga0495610_0000006_422590_423072 151
174 3300046519 Ga0495632_0002488 Ga0495632_0002488_7680_8138 151
175 3300046525 Ga0495663_0000287 Ga0495663_0000287_18022_18477 151
176 3300046530 Ga0495654_0000017 Ga0495654_0000017_34191_34646 151
177 3300046539 Ga0495621_0063447 Ga0495621_0063447_602_1132 151
178 3300046558 Ga0495633_0000037 Ga0495633_0000037_35388_35843 151
179 3300046558 Ga0495633_0001355 Ga0495633_0001355_7403_7861 151
180 3300046660 Ga0495625_0001404 Ga0495625_0001404_5688_6146 151
181 3300047472 Ga0495686_0007654 Ga0495686_0007654_13_468 151
182 3300048905 Ga0496102_0725941 Ga0496102_0725941_293_748 151
183 3300048906 Ga0496103_0664616 Ga0496103_0664616_195_650 151
184 3300048919 Ga0496116_0000052 Ga0496116_0000052_35928_36383 151
185 3300048920 Ga0496117_0000027 Ga0496117_0000027_391322_391777 151
186 3300048920 Ga0496117_0375361 Ga0496117_0375361_166_621 151
187 3300048921 Ga0496118_0000375 Ga0496118_0000375_47819_48274 151
188 3300048921 Ga0496118_0153773 Ga0496118_0153773_353_808 151
189 3300048922 Ga0496119_0000006 Ga0496119_0000006_198317_198772 151
190 3300048924 Ga0496121_0304473 Ga0496121_0304473_109_564 151
191 3300048925 Ga0496122_0000229 Ga0496122_0000229_16899_17354 151
192 3300048925 Ga0496122_0000230 Ga0496122_0000230_8616_9071 151
193 3300048925 Ga0496122_0000397 Ga0496122_0000397_19323_19778 151
194 3300048925 Ga0496122_0007135 Ga0496122_0007135_8050_8505 151
195 3300048925 Ga0496122_0030400 Ga0496122_0030400_3768_4250 151
196 3300048925 Ga0496122_0461022 Ga0496122_0461022_53_508 151
197 3300048926 Ga0496123_0001467 Ga0496123_0001467_21335_21790 151
198 3300048926 Ga0496123_0006791 Ga0496123_0006791_3024_3479 151
199 3300048926 Ga0496123_0070973 Ga0496123_0070973_143_598 151
200 3300048927 Ga0496124_0001244 Ga0496124_0001244_34537_34992 151
201 3300048927 Ga0496124_0102810 Ga0496124_0102810_400_855 151
202 3300048928 Ga0496125_0003946 Ga0496125_0003946_8465_8920 151
203 3300048928 Ga0496125_0014999 Ga0496125_0014999_4050_4505 151
204 3300048928 Ga0496125_0020161 Ga0496125_0020161_4951_5406 151
205 3300048929 Ga0496126_0002697 Ga0496126_0002697_8944_9399 151
206 3300048929 Ga0496126_0117345 Ga0496126_0117345_1084_1539 151
207 3300049766 Ga0501269_000053 Ga0501269_000053_20975_21430 151
208 3300050508 nmdc:mga09592_1378538_c1 nmdc:mga09592_1378538_c1_34_519 151

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08818

DUF1801

Domain of unknown function (DU1801)

19

143

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
2oc6-assembly2.cif.gz_B crystal structure of a protein from the duf1801 family (ydhg, bsu05750) from bacillus subtilis at 1.75 a resolution 0.7228 9 149
2oc6-assembly2.cif.gz_B crystal structure of a protein from the duf1801 family (ydhg, bsu05750) from bacillus subtilis at 1.75 a resolution 0.6564 9 149
3ntj-assembly2.cif.gz_D redox regulation of plasmodium falciparum ornithine delta-aminotransferase 0.5435 21 135
3ntj-assembly1.cif.gz_A redox regulation of plasmodium falciparum ornithine delta-aminotransferase 0.5323 9 135
5viu-assembly1.cif.gz_A crystal structure of acetylornithine aminotransferase from elizabethkingia anophelis 0.5247 9 136
ID Description Score Start End Superfamily
2oc6B01 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.7772 9 132 3.90.1150.200
3amkA03 Mainly Beta;Sandwich;Immunoglobulin-like;Golgi alpha-mannosidase II 0.7723 71 85 2.60.40.1180
af_Q41740_657_772_2.60.40.1180 Mainly Beta;Sandwich;Immunoglobulin-like;Golgi alpha-mannosidase II 0.7658 71 85 2.60.40.1180
af_Q5JKZ9_674_781_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.7633 71 85 2.60.40.10
2oc6B01 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.7002 9 132 3.90.1150.200
ID Description Score Start End GO Terms
AF-A0A1H6KKG0-F1-model_v4 YdhG-like domain-containing protein 0.994 1 151
AF-A0A099W6L0-F1-model_v4 YdhG-like domain-containing protein 0.9848 7 151
AF-A0A1H3AA24-F1-model_v4 YdhG-like domain-containing protein 0.9833 1 151
AF-A0A1R3XH17-F1-model_v4 YdhG-like domain-containing protein 0.9775 1 151
AF-A0A5F2D5S1-F1-model_v4 deleted 0.9774 4 148

Feature Viewer

pLDDT pTM Quality
93.02 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map