F318191

General Info

Members Datasets Scaffolds Average Seq Length
208 163 416 356

Family's Representative Sequence

Representative Sequence 3300045976|Ga0466967_0112630|Ga0466967_0112630_388_1521
Length 377
Sequence MPAAAGARLARSGRAWETAPMADHPYRSLPDSAFWRRSVVAEGAAVDPVVGNFLTIARGDKIATAGSCFAQHVARHLAASGYDYLVTESAHPILAEAAARAAGYGVYSARYGNIYTTLQLVQLFDRAYGRFEPVEDVWAAPDGAGVVDPFRPTIQPGGFASEAEMRADRAQHFHRVREMFETLDILVFTLGLTEAWVSAIDGAAFPLCPGVAGGQFDPDRHVFRNLRVAEVRAQIGDFAERLRAVNPAARIVLTVSPVPLAATASGNHVLPAASYSKSVLRAAAQEAAEDLEGVFYFPSYEIVTGPQARGRFFADDLREVTEEGVEHVMRVFLRHAAGVESLPSAADKPSVRGDDFTARVSEWVETMCDEAMLDPDA

Samples

Sample ID Description Type Environment
1 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
7 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
8 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
9 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
10 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
11 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
12 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
13 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
14 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
15 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
16 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
17 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
18 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
19 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
43 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
46 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
47 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
49 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
50 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
51 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
56 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
57 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
58 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
59 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
60 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
61 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
62 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
63 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
64 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
65 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
66 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
67 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
68 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
69 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
70 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
71 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
72 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
73 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
74 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
76 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
78 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
116 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
117 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
118 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
119 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
120 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
121 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
122 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
123 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
124 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
125 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
126 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
127 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
128 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
129 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
130 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
131 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
132 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
133 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
134 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
135 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
136 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
137 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
138 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
139 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
140 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
141 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
142 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
143 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
144 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
145 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
146 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
147 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
148 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
149 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
150 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
151 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
152 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
153 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
154 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
155 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
156 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
157 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
158 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
159 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
160 2643221541 Sphingomonas sp. Root50 Isolate Unclassified
161 2643221606 Sphingomonas sp. Root720 Isolate Unclassified
162 2643221671 Sphingomonas sp. Root1294 Isolate Unclassified
163 2738541337 Pelomonas sp. BT06 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.08
Metatranscriptomes 0
Isolates 1.92

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.77
Nodule 0
Rhizoplane 0.96
Rhizosphere 82.69
Stem 0
Stem Tuber 0
Unclassified 9.62

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466967_0112630 3300045976 Unclassified 2502
2 JGI24740J21852_10012937 3300001979 Bacteria 3132
3 JGI24739J22299_10000748 3300001989 Bacteria 11823
4 JGI24737J22298_10009798 3300001990 Bacteria 3174
5 JGI24737J22298_10043598 3300001990 Unclassified 1373
6 JGI24735J21928_10004384 3300002067 Bacteria 4751
7 JGI24735J21928_10019245 3300002067 Bacteria 2099
8 JGI24738J21930_10015555 3300002075 Unclassified 1616
9 JGI24744J21845_10008673 3300002077 Bacteria 2090
10 JGI24751J29686_10000089 3300002459 Bacteria 50993
11 JGI25165J46597_1000100 3300003214 Bacteria 157712
12 rootH1_10040604 3300003316 Bacteria 5149
13 rootH2_10133331 3300003320 Bacteria 6822
14 rootH1_10136579 3300003323 Bacteria 4141
15 Ga0055542_1016799 3300003762 Unclassified 1144
16 Ga0055526_1000360 3300003771 Bacteria 36816
17 Ga0065707_10088185 3300005295 Bacteria 4747
18 Ga0070658_10005326 3300005327 Bacteria 10444
19 Ga0070658_10005484 3300005327 Bacteria 10289
20 Ga0070676_10006939 3300005328 Bacteria 6064
21 Ga0070670_100000028 3300005331 Bacteria 184816
22 Ga0068869_100000113 3300005334 Bacteria 38756
23 Ga0068868_100000003 3300005338 Bacteria 155611
24 Ga0070660_100000024 3300005339 Bacteria 94300
25 Ga0070660_100103351 3300005339 Bacteria 2260
26 Ga0070689_100178127 3300005340 Bacteria 1725
27 Ga0070668_100083398 3300005347 Bacteria 2509
28 Ga0070669_100000005 3300005353 Bacteria 309134
29 Ga0070675_100048253 3300005354 Bacteria 3491
30 Ga0070675_100243644 3300005354 Bacteria 1571
31 Ga0070671_100040259 3300005355 Bacteria 3881
32 Ga0070674_100066550 3300005356 Bacteria 2532
33 Ga0070673_100000012 3300005364 Bacteria 141279
34 Ga0070659_100089844 3300005366 Unclassified 2461
35 Ga0070659_100106079 3300005366 Bacteria 2265
36 Ga0070659_100160798 3300005366 Bacteria 1836
37 Ga0070667_100001055 3300005367 Bacteria 25176
38 Ga0070678_100026239 3300005456 Bacteria 3936
39 Ga0070662_100028850 3300005457 Unclassified 3867
40 Ga0068867_100000003 3300005459 Bacteria 217886
41 Ga0068853_100250778 3300005539 Bacteria 1624
42 Ga0068853_100383028 3300005539 Unclassified 1314
43 Ga0068855_100000213 3300005563 Bacteria 73664
44 Ga0068855_100070077 3300005563 Bacteria 4080
45 Ga0068857_100073851 3300005577 Bacteria 3039
46 Ga0068854_100000305 3300005578 Bacteria 32355
47 Ga0068854_100002226 3300005578 Bacteria 11930
48 Ga0068856_100083138 3300005614 Bacteria 3179
49 Ga0068852_100002024 3300005616 Bacteria 13807
50 Ga0068859_100075747 3300005617 Bacteria 3405
51 Ga0068864_100000336 3300005618 Bacteria 41315
52 Ga0068861_100297981 3300005719 Bacteria 1395
53 Ga0068851_10116453 3300005834 Unclassified 1432
54 Ga0068863_100035149 3300005841 Bacteria 4774
55 Ga0068862_100000005 3300005844 Bacteria 350713
56 Ga0075364_10040115 3300006051 Bacteria 3037
57 Ga0097621_100004905 3300006237 Bacteria 9385
58 Ga0075370_10009262 3300006353 Bacteria 5106
59 Ga0068871_100002511 3300006358 Bacteria 12518
60 Ga0075428_100143282 3300006844 Unclassified 2598
61 Ga0068865_100000002 3300006881 Bacteria 285745
62 Ga0097620_100075748 3300006931 Bacteria 3405
63 Ga0105240_10094965 3300009093 Bacteria 3636
64 Ga0111539_10039237 3300009094 Bacteria 5709
65 Ga0105245_10003109 3300009098 Bacteria 14848
66 Ga0105243_10001660 3300009148 Bacteria 19273
67 Ga0105241_10016864 3300009174 Bacteria 5361
68 Ga0105242_10000044 3300009176 Bacteria 85651
69 Ga0105248_10008855 3300009177 Bacteria 11057
70 Ga0105248_10024012 3300009177 Bacteria 6777
71 Ga0105239_10033368 3300010375 Bacteria 5654
72 Ga0105239_10142907 3300010375 Bacteria 2668
73 Ga0105246_10002323 3300011119 Bacteria 11486
74 Ga0157370_10000157 3300013104 Bacteria 84292
75 Ga0157370_10374172 3300013104 Bacteria 1312
76 Ga0157369_10023334 3300013105 Bacteria 6891
77 Ga0157374_10001873 3300013296 Bacteria 17691
78 Ga0157378_10003067 3300013297 Bacteria 14853
79 Ga0157372_10045060 3300013307 Bacteria 4890
80 Ga0157375_10001767 3300013308 Bacteria 18557
81 Ga0163163_10043187 3300014325 Bacteria 4419
82 Ga0157380_10000023 3300014326 Bacteria 113686
83 Ga0157377_10001899 3300014745 Bacteria 9151
84 Ga0157376_10000350 3300014969 Bacteria 30823
85 Ga0207427_100949 3300025231 Bacteria 12341
86 Ga0209026_1005203 3300025250 Bacteria 3571
87 Ga0209148_1000112 3300025254 Bacteria 197101
88 Ga0209148_1001483 3300025254 Bacteria 11745
89 Ga0209233_1000143 3300025261 Bacteria 191568
90 Ga0209455_1001160 3300025272 Bacteria 12681
91 Ga0209564_1000089 3300025295 Bacteria 249694
92 Ga0207647_10104243 3300025904 Bacteria 1681
93 Ga0207647_10116735 3300025904 Bacteria 1576
94 Ga0207645_10011376 3300025907 Bacteria 6080
95 Ga0207705_10000014 3300025909 Bacteria 434286
96 Ga0207705_10001079 3300025909 Bacteria 22139
97 Ga0207705_10026983 3300025909 Bacteria 4093
98 Ga0207695_10008867 3300025913 Bacteria 12524
99 Ga0207695_10104021 3300025913 Bacteria 2830
100 Ga0207657_10004705 3300025919 Bacteria 14405
101 Ga0207657_10007275 3300025919 Bacteria 11365
102 Ga0207657_10014046 3300025919 Bacteria 7834
103 Ga0207681_10000003 3300025923 Bacteria 713245
104 Ga0207681_10075107 3300025923 Bacteria 2370
105 Ga0207694_10057956 3300025924 Unclassified 3013
106 Ga0207650_10000012 3300025925 Bacteria 437889
107 Ga0207659_10083102 3300025926 Unclassified 2373
108 Ga0207687_10001158 3300025927 Bacteria 17981
109 Ga0207644_10031968 3300025931 Bacteria 3670
110 Ga0207690_10011073 3300025932 Bacteria 5379
111 Ga0207706_10001703 3300025933 Bacteria 21672
112 Ga0207706_10012729 3300025933 Bacteria 7658
113 Ga0207706_10147873 3300025933 Bacteria 2067
114 Ga0207686_10000417 3300025934 Bacteria 29017
115 Ga0207709_10000334 3300025935 Bacteria 49550
116 Ga0207669_10019220 3300025937 Unclassified 3552
117 Ga0207669_10051341 3300025937 Bacteria 2470
118 Ga0207704_10000003 3300025938 Bacteria 285808
119 Ga0207691_10118705 3300025940 Bacteria 2346
120 Ga0207711_10001223 3300025941 Bacteria 24321
121 Ga0207711_10050814 3300025941 Unclassified 3550
122 Ga0207689_10000335 3300025942 Bacteria 43825
123 Ga0207667_10000007 3300025949 Bacteria 630590
124 Ga0207667_10064071 3300025949 Bacteria 3839
125 Ga0207651_10000003 3300025960 Bacteria 308050
126 Ga0207668_10066937 3300025972 Bacteria 2548
127 Ga0207640_10000253 3300025981 Bacteria 36380
128 Ga0207640_10002766 3300025981 Bacteria 9391
129 Ga0207640_10078907 3300025981 Bacteria 2242
130 Ga0207658_10000892 3300025986 Bacteria 24842
131 Ga0207677_10000743 3300026023 Bacteria 18939
132 Ga0207639_10336148 3300026041 Bacteria 1345
133 Ga0207639_10373576 3300026041 Unclassified 1279
134 Ga0207678_10008525 3300026067 Bacteria 9032
135 Ga0207678_10103225 3300026067 Bacteria 2434
136 Ga0207702_10003300 3300026078 Bacteria 14867
137 Ga0207702_10018757 3300026078 Bacteria 5722
138 Ga0207641_10011843 3300026088 Bacteria 7157
139 Ga0207648_10000007 3300026089 Bacteria 217865
140 Ga0207676_10000009 3300026095 Bacteria 545256
141 Ga0207674_10065312 3300026116 Bacteria 3668
142 Ga0207674_10341021 3300026116 Bacteria 1449
143 Ga0207675_100000528 3300026118 Bacteria 37147
144 Ga0207683_10056677 3300026121 Bacteria 3438
145 Ga0207698_10000651 3300026142 Bacteria 20103
146 Ga0207698_10345240 3300026142 Bacteria 1404
147 Ga0268265_10000001 3300028380 Bacteria 1230727
148 Ga0307408_100387422 3300031548 Unclassified 1196
149 Ga0307405_10101713 3300031731 Unclassified 1929
150 Ga0307416_100445206 3300032002 Unclassified 1346
151 Ga0307411_10209837 3300032005 Unclassified 1503
152 Ga0395899_0001186 3300037312 Bacteria 22976
153 Ga0395900_0196072 3300037418 Unclassified 2046
154 Ga0395905_0025763 3300037471 Bacteria 5545
155 Ga0395905_0396547 3300037471 Bacteria 1275
156 Ga0436364_1085455 3300037853 Bacteria 1654
157 Ga0395901_0058850 3300038443 Bacteria 3997
158 Ga0451797_1028277 3300041453 Bacteria 1479
159 Ga0439448_0001576 3300042005 Bacteria 5978
160 Ga0439448_0004635 3300042005 Bacteria 3887
161 Ga0439448_0009369 3300042005 Unclassified 2886
162 Ga0439450_003401 3300042008 Bacteria 2628
163 Ga0439455_0001422 3300042012 Bacteria 3996
164 Ga0439458_0000061 3300042157 Bacteria 18934
165 Ga0439458_0000771 3300042157 Bacteria 8210
166 Ga0466972_0004021 3300044658 Bacteria 7331
167 Ga0466961_0031783 3300044693 Bacteria 3394
168 Ga0466961_0075382 3300044693 Bacteria 2138
169 Ga0466963_0013900 3300044694 Bacteria 4956
170 Ga0466964_0022422 3300044706 Bacteria 2450
171 Ga0453684_0003135 3300044712 Bacteria 38072
172 Ga0453684_0031813 3300044712 Bacteria 7401
173 Ga0466971_0006548 3300044719 Bacteria 5062
174 Ga0466970_0012367 3300044765 Bacteria 4363
175 Ga0466957_0014404 3300044842 Bacteria 4605
176 Ga0466960_0066626 3300044901 Bacteria 1781
177 Ga0466958_0047900 3300045836 Bacteria 2581
178 Ga0466967_0060920 3300045976 Bacteria 3346
179 Ga0466967_0189225 3300045976 Bacteria 1945
180 Ga0495605_0000023 3300046474 Bacteria 236732
181 Ga0495643_0000269 3300046522 Bacteria 75478
182 Ga0495625_0028645 3300046660 Bacteria 4175
183 Ga0495672_0000379 3300047320 Bacteria 55067
184 Ga0495686_0000141 3300047472 Bacteria 144510
185 Ga0496111_0174801 3300048914 Bacteria 1596
186 Ga0496117_0029714 3300048920 Bacteria 4208
187 Ga0496118_0014306 3300048921 Bacteria 7440
188 Ga0496118_0049490 3300048921 Bacteria 3235
189 Ga0496119_0052533 3300048922 Bacteria 2495
190 Ga0496120_0040969 3300048923 Bacteria 2717
191 Ga0496121_0004546 3300048924 Bacteria 18544
192 Ga0496121_0088682 3300048924 Bacteria 2424
193 Ga0496122_0003611 3300048925 Bacteria 20144
194 Ga0496122_0015707 3300048925 Bacteria 7219
195 Ga0496123_0002776 3300048926 Bacteria 20871
196 Ga0496123_0024724 3300048926 Bacteria 4555
197 Ga0496124_0015274 3300048927 Bacteria 7367
198 Ga0496125_0058734 3300048928 Bacteria 3105
199 Ga0495678_000096 3300049459 Bacteria 109474
200 Ga0501070_0025549 3300049586 Bacteria 4954
201 Ga0501073_0038177 3300049589 Bacteria 3409
202 Ga0501044_0082731 3300049823 Bacteria 3247
203 nmdc:mga00v17_16339_c1 3300050491 Bacteria 4183
204 Ga0466962_0007200 3300061719 Bacteria 5328
205 2643729971 2643221541 Bacteria 5498788
206 2644045457 2643221606 Bacteria 5588032
207 2644392917 2643221671 Bacteria 5496681
208 2739054618 2738541337 Bacteria 6183410
209 Ga0466967_0112630
210 JGI24740J21852_10012937
211 JGI24739J22299_10000748
212 JGI24737J22298_10009798
213 JGI24737J22298_10043598
214 JGI24735J21928_10004384
215 JGI24735J21928_10019245
216 JGI24738J21930_10015555
217 JGI24744J21845_10008673
218 JGI24751J29686_10000089
219 JGI25165J46597_1000100
220 rootH1_10040604
221 rootH2_10133331
222 rootH1_10136579
223 Ga0055542_1016799
224 Ga0055526_1000360
225 Ga0065707_10088185
226 Ga0070658_10005326
227 Ga0070658_10005484
228 Ga0070676_10006939
229 Ga0070670_100000028
230 Ga0068869_100000113
231 Ga0068868_100000003
232 Ga0070660_100000024
233 Ga0070660_100103351
234 Ga0070689_100178127
235 Ga0070668_100083398
236 Ga0070669_100000005
237 Ga0070675_100048253
238 Ga0070675_100243644
239 Ga0070671_100040259
240 Ga0070674_100066550
241 Ga0070673_100000012
242 Ga0070659_100089844
243 Ga0070659_100106079
244 Ga0070659_100160798
245 Ga0070667_100001055
246 Ga0070678_100026239
247 Ga0070662_100028850
248 Ga0068867_100000003
249 Ga0068853_100250778
250 Ga0068853_100383028
251 Ga0068855_100000213
252 Ga0068855_100070077
253 Ga0068857_100073851
254 Ga0068854_100000305
255 Ga0068854_100002226
256 Ga0068856_100083138
257 Ga0068852_100002024
258 Ga0068859_100075747
259 Ga0068864_100000336
260 Ga0068861_100297981
261 Ga0068851_10116453
262 Ga0068863_100035149
263 Ga0068862_100000005
264 Ga0075364_10040115
265 Ga0097621_100004905
266 Ga0075370_10009262
267 Ga0068871_100002511
268 Ga0075428_100143282
269 Ga0068865_100000002
270 Ga0097620_100075748
271 Ga0105240_10094965
272 Ga0111539_10039237
273 Ga0105245_10003109
274 Ga0105243_10001660
275 Ga0105241_10016864
276 Ga0105242_10000044
277 Ga0105248_10008855
278 Ga0105248_10024012
279 Ga0105239_10033368
280 Ga0105239_10142907
281 Ga0105246_10002323
282 Ga0157370_10000157
283 Ga0157370_10374172
284 Ga0157369_10023334
285 Ga0157374_10001873
286 Ga0157378_10003067
287 Ga0157372_10045060
288 Ga0157375_10001767
289 Ga0163163_10043187
290 Ga0157380_10000023
291 Ga0157377_10001899
292 Ga0157376_10000350
293 Ga0207427_100949
294 Ga0209026_1005203
295 Ga0209148_1000112
296 Ga0209148_1001483
297 Ga0209233_1000143
298 Ga0209455_1001160
299 Ga0209564_1000089
300 Ga0207647_10104243
301 Ga0207647_10116735
302 Ga0207645_10011376
303 Ga0207705_10000014
304 Ga0207705_10001079
305 Ga0207705_10026983
306 Ga0207695_10008867
307 Ga0207695_10104021
308 Ga0207657_10004705
309 Ga0207657_10007275
310 Ga0207657_10014046
311 Ga0207681_10000003
312 Ga0207681_10075107
313 Ga0207694_10057956
314 Ga0207650_10000012
315 Ga0207659_10083102
316 Ga0207687_10001158
317 Ga0207644_10031968
318 Ga0207690_10011073
319 Ga0207706_10001703
320 Ga0207706_10012729
321 Ga0207706_10147873
322 Ga0207686_10000417
323 Ga0207709_10000334
324 Ga0207669_10019220
325 Ga0207669_10051341
326 Ga0207704_10000003
327 Ga0207691_10118705
328 Ga0207711_10001223
329 Ga0207711_10050814
330 Ga0207689_10000335
331 Ga0207667_10000007
332 Ga0207667_10064071
333 Ga0207651_10000003
334 Ga0207668_10066937
335 Ga0207640_10000253
336 Ga0207640_10002766
337 Ga0207640_10078907
338 Ga0207658_10000892
339 Ga0207677_10000743
340 Ga0207639_10336148
341 Ga0207639_10373576
342 Ga0207678_10008525
343 Ga0207678_10103225
344 Ga0207702_10003300
345 Ga0207702_10018757
346 Ga0207641_10011843
347 Ga0207648_10000007
348 Ga0207676_10000009
349 Ga0207674_10065312
350 Ga0207674_10341021
351 Ga0207675_100000528
352 Ga0207683_10056677
353 Ga0207698_10000651
354 Ga0207698_10345240
355 Ga0268265_10000001
356 Ga0307408_100387422
357 Ga0307405_10101713
358 Ga0307416_100445206
359 Ga0307411_10209837
360 Ga0395899_0001186
361 Ga0395900_0196072
362 Ga0395905_0025763
363 Ga0395905_0396547
364 Ga0436364_1085455
365 Ga0395901_0058850
366 Ga0451797_1028277
367 Ga0439448_0001576
368 Ga0439448_0004635
369 Ga0439448_0009369
370 Ga0439450_003401
371 Ga0439455_0001422
372 Ga0439458_0000061
373 Ga0439458_0000771
374 Ga0466972_0004021
375 Ga0466961_0031783
376 Ga0466961_0075382
377 Ga0466963_0013900
378 Ga0466964_0022422
379 Ga0453684_0003135
380 Ga0453684_0031813
381 Ga0466971_0006548
382 Ga0466970_0012367
383 Ga0466957_0014404
384 Ga0466960_0066626
385 Ga0466958_0047900
386 Ga0466967_0060920
387 Ga0466967_0189225
388 Ga0495605_0000023
389 Ga0495643_0000269
390 Ga0495625_0028645
391 Ga0495672_0000379
392 Ga0495686_0000141
393 Ga0496111_0174801
394 Ga0496117_0029714
395 Ga0496118_0014306
396 Ga0496118_0049490
397 Ga0496119_0052533
398 Ga0496120_0040969
399 Ga0496121_0004546
400 Ga0496121_0088682
401 Ga0496122_0003611
402 Ga0496122_0015707
403 Ga0496123_0002776
404 Ga0496123_0024724
405 Ga0496124_0015274
406 Ga0496125_0058734
407 Ga0495678_000096
408 Ga0501070_0025549
409 Ga0501073_0038177
410 Ga0501044_0082731
411 nmdc:mga00v17_16339_c1
412 Ga0466962_0007200
413 2643729971
414 2644045457
415 2644392917
416 2739054618

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08885

GSCFA

GSCFA family

61

332

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
4h08-assembly1.cif.gz_A-2 crystal structure of a putative hydrolase (bt3161) from bacteroides thetaiotaomicron vpi-5482 at 1.80 a resolution 0.6844 154 314
3mt5-assembly1.cif.gz_A crystal structure of the human bk gating apparatus 0.6808 156 235
4xvh-assembly1.cif.gz_A crystal structure of a corynascus thermopiles (myceliophthora fergusii) carbohydrate esterase family 2 (ce2) enzyme plus carbohydrate binding domain (cbd) 0.6804 163 278
4hpf-assembly1.cif.gz_A structure of the human slo3 gating ring 0.6678 156 234
6c87-assembly1.cif.gz_A crystal structure of rab gdp dissociation inhibitor alpha from naegleria fowleri 0.6581 33 65
ID Description Score Start End Superfamily
af_P9WK25_11_262_3.40.50.10380 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Malic enzyme, N-terminal domain 0.724 205 275 3.40.50.10380
af_P9WP43_3_216_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7155 208 237 3.40.50.1820
af_Q54H99_9_164_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.7053 38 65 3.50.50.60
4h08A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;SGNH hydrolase 0.6855 154 314 3.40.50.1110
4xvhA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;SGNH hydrolase 0.6804 163 278 3.40.50.1110
ID Description Score Start End GO Terms
AF-A0A7Y6ZEK4-F1-model_v4 GSCFA domain-containing protein 0.9375 5 315
AF-A0A4Q3UW97-F1-model_v4 GSCFA family protein 0.9336 5 278
AF-A0A354AWK0-F1-model_v4 GSCFA family protein 0.9224 1 314
AF-A0A6B8LZL9-F1-model_v4 deleted 0.9195 5 345
AF-A0A7X6EJI6-F1-model_v4 deleted 0.9172 83 285

Map