F317438

General Info

Members Datasets Scaffolds Average Seq Length
208 151 416 217

Family's Representative Sequence

Representative Sequence 3300005367|Ga0070667_100112574|Ga0070667_1001125742
Length 234
Sequence MTRVRINLFVSLDGFTSATDNSPDNPMGEDWGRLAAGHLATRTFREHVFGDTSGAGTTGVDDRYTAAFFEGVGAEIMGAAMFGLHAFPGDPEWKGWWGDRPPFGTPVYVLTNTLRRQDWSKPAPPGGYPHRVVPRPSIPMEGGTTFHFRSGAIEDVLAEATDAAGGLDVRVSGGVGTARAFLRAGLVDDLHLMVAPIVLGRGTRLWDDLGGLDLTHKVTTEAAESGTVHVTFTR

Samples

Sample ID Description Type Environment
1 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
6 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
7 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
8 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
9 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
10 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
25 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
26 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
27 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
28 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
29 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
30 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
31 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
32 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
33 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
34 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
35 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
36 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
37 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
39 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
40 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
41 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
42 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
43 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
44 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
45 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
46 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
47 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
48 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
49 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
50 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
51 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
52 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
53 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
54 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
80 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
81 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
82 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
83 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
84 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
85 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
86 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
87 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
88 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
89 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
90 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
91 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
92 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
93 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
94 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
95 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
96 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
97 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
98 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
99 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
100 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
101 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
102 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
103 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
104 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
105 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
106 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
107 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
108 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
109 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
110 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
111 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
112 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
113 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
114 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
115 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
116 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
117 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
118 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
119 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
120 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
121 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
122 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
123 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
124 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
125 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
126 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
127 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
128 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
129 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
130 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
131 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
132 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
133 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
134 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
135 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
136 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
137 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
138 2643221575 Microbacterium sp. Root61 Isolate Unclassified
139 2643221616 Leifsonia sp. Root227 Isolate Unclassified
140 2643221624 Phycicoccus sp. Root101 Isolate Unclassified
141 2643221961 Aeromicrobium sp. Root236 Isolate Unclassified
142 2643221962 Aeromicrobium sp. Root344 Isolate Unclassified
143 2731639228 Motilibacter peucedani DSM 45328 Isolate Rhizosphere
144 2738543005 Rhodococcus sp. OK519 Isolate Unclassified
145 2844841374 Leifsonia soli DSM 23871 Isolate Rhizosphere
146 2884763398 Leifsonia sp. PS1209 Isolate Stem Tuber
147 2919055335 Leifsonia sp. 1010 Isolate Rhizosphere
148 2919523602 Leifsonia shinshuensis 3821 Isolate Unclassified
149 2928153084 Leifsonia sp. 563 Isolate Unclassified
150 2984592036 Aeromicrobium sp. SORGH_AS981 Isolate Aerial Root
151 8045830549 Microbacterium yannicii DSM 23203 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 91.83
Metatranscriptomes 1.44
Isolates 6.73

Biome Distribution

Category Percentage (%)
Aerial Root 0.48
Bulb 0
Endosphere 8.17
Nodule 0
Rhizoplane 14.9
Rhizosphere 62.98
Stem 0
Stem Tuber 0.48
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070667_100112574 3300005367 Bacteria 2361
2 JGI24739J22299_10091205 3300001989 Bacteria 928
3 JGI24737J22298_10003625 3300001990 Bacteria 5444
4 JGI24735J21928_10002576 3300002067 Bacteria 6274
5 JGI25162J39368_1008254 3300002737 Bacteria 1514
6 JGI25164J39214_1000876 3300002772 Bacteria 10214
7 JGI25406J46586_10022478 3300003203 Bacteria 2512
8 JGI25165J46597_1000002 3300003214 Bacteria 765387
9 Ga0006562J51391_1017569 3300003578 Bacteria 12910
10 Ga0006562J51391_1017570 3300003578 Bacteria 12798
11 Ga0055539_1000006 3300003752 Bacteria 580055
12 Ga0070658_10065477 3300005327 Bacteria 2966
13 Ga0070683_100587187 3300005329 Bacteria 1066
14 Ga0070680_100499314 3300005336 Bacteria 1041
15 Ga0070682_100481208 3300005337 Bacteria 958
16 Ga0070682_100755946 3300005337 Bacteria 785
17 Ga0068868_100105290 3300005338 Bacteria 2287
18 Ga0070661_100059098 3300005344 Bacteria 2810
19 Ga0070668_100063263 3300005347 Bacteria 2868
20 Ga0070659_100082170 3300005366 Bacteria 2574
21 Ga0070710_10311776 3300005437 Bacteria 1030
22 Ga0070711_100535045 3300005439 Bacteria 970
23 Ga0068867_100492552 3300005459 Bacteria 1052
24 Ga0070684_100166406 3300005535 Bacteria 2002
25 Ga0068855_100018738 3300005563 Bacteria 8322
26 Ga0068857_100152839 3300005577 Bacteria 2092
27 Ga0068856_100040224 3300005614 Bacteria 4591
28 Ga0068856_100220673 3300005614 Bacteria 1911
29 Ga0068856_100693603 3300005614 Bacteria 1039
30 Ga0068852_101256906 3300005616 Bacteria 762
31 Ga0068864_100185100 3300005618 Bacteria 1906
32 Ga0068864_100611163 3300005618 Bacteria 1059
33 Ga0068858_100071385 3300005842 Bacteria 3221
34 Ga0068858_100489062 3300005842 Bacteria 1188
35 Ga0068860_100000331 3300005843 Bacteria 64294
36 Ga0068860_100153031 3300005843 Bacteria 2222
37 Ga0068860_100179485 3300005843 Bacteria 2046
38 Ga0081539_10002881 3300005985 Bacteria 22815
39 Ga0081539_10123945 3300005985 Bacteria 1279
40 Ga0070717_10564697 3300006028 Bacteria 1031
41 Ga0075365_10018933 3300006038 Bacteria 4240
42 Ga0075363_100035036 3300006048 Bacteria 2624
43 Ga0075364_10010618 3300006051 Bacteria 5570
44 Ga0105240_10528009 3300009093 Bacteria 1309
45 Ga0105247_10038725 3300009101 Bacteria 2911
46 Ga0114129_10267734 3300009147 Bacteria 2287
47 Ga0105248_10222746 3300009177 Bacteria 2123
48 Ga0105237_10168690 3300009545 Bacteria 2188
49 Ga0105237_10452977 3300009545 Bacteria 1289
50 Ga0105238_10195698 3300009551 Bacteria 1997
51 Ga0105239_10180489 3300010375 Bacteria 2362
52 Ga0105239_11556635 3300010375 Bacteria 764
53 Ga0157370_10019192 3300013104 Bacteria 6871
54 Ga0157369_10088096 3300013105 Bacteria 3314
55 Ga0157369_10231759 3300013105 Bacteria 1931
56 Ga0157369_10278829 3300013105 Bacteria 1741
57 Ga0157369_10294570 3300013105 Bacteria 1689
58 Ga0163163_10050009 3300014325 Bacteria 4115
59 Ga0163163_10251254 3300014325 Bacteria 1819
60 Ga0163163_10271937 3300014325 Bacteria 1745
61 Ga0163163_11354978 3300014325 Bacteria 773
62 Ga0157380_11005527 3300014326 Bacteria 867
63 Ga0157379_10098339 3300014968 Bacteria 2627
64 Ga0163161_10347641 3300017792 Bacteria 1178
65 Ga0206354_11150593 3300020081 Bacteria 912
66 Ga0209563_100245 3300025230 Bacteria 25870
67 Ga0207427_100052 3300025231 Bacteria 218228
68 Ga0209437_100451 3300025233 Bacteria 33803
69 Ga0209233_1000001 3300025261 Bacteria 2992747
70 Ga0209455_1001526 3300025272 Bacteria 10326
71 Ga0207647_10090336 3300025904 Bacteria 1827
72 Ga0207643_10022333 3300025908 Bacteria 3482
73 Ga0207705_10007238 3300025909 Bacteria 8166
74 Ga0207705_10061720 3300025909 Bacteria 2708
75 Ga0207671_10186571 3300025914 Bacteria 1616
76 Ga0207671_10580192 3300025914 Bacteria 894
77 Ga0207657_10514106 3300025919 Bacteria 937
78 Ga0207665_10574021 3300025939 Bacteria 878
79 Ga0207691_10081963 3300025940 Bacteria 2899
80 Ga0207711_10512813 3300025941 Bacteria 1118
81 Ga0207689_10351572 3300025942 Bacteria 1225
82 Ga0207661_10089282 3300025944 Bacteria 2564
83 Ga0207667_10004658 3300025949 Bacteria 16805
84 Ga0207667_10036680 3300025949 Bacteria 5250
85 Ga0207651_10210192 3300025960 Bacteria 1566
86 Ga0207668_10053813 3300025972 Bacteria 2791
87 Ga0207668_10367210 3300025972 Bacteria 1208
88 Ga0207658_10131733 3300025986 Bacteria 2010
89 Ga0207677_10586429 3300026023 Bacteria 976
90 Ga0207703_10136585 3300026035 Bacteria 2123
91 Ga0207703_10910183 3300026035 Bacteria 842
92 Ga0207702_10324944 3300026078 Bacteria 1466
93 Ga0207641_10289053 3300026088 Bacteria 1545
94 Ga0207641_10435676 3300026088 Bacteria 1264
95 Ga0207648_10340796 3300026089 Bacteria 1350
96 Ga0207676_10307980 3300026095 Bacteria 1449
97 Ga0207676_10397925 3300026095 Bacteria 1286
98 Ga0207674_10029759 3300026116 Bacteria 5746
99 Ga0207674_10301831 3300026116 Bacteria 1550
100 Ga0207675_100228834 3300026118 Bacteria 1793
101 Ga0207675_100591266 3300026118 Bacteria 1112
102 Ga0207698_10050410 3300026142 Bacteria 3175
103 Ga0207698_10994885 3300026142 Bacteria 849
104 Ga0268265_11006042 3300028380 Bacteria 824
105 Ga0268264_10000193 3300028381 Bacteria 126247
106 Ga0268264_10049759 3300028381 Bacteria 3488
107 Ga0268264_10147895 3300028381 Bacteria 2103
108 Ga0307515_10077622 3300028794 Bacteria 4384
109 Ga0307512_10004254 3300030522 Bacteria 15812
110 Ga0307513_10733120 3300031456 Bacteria 694
111 Ga0307405_10352534 3300031731 Bacteria 1136
112 Ga0307405_10516617 3300031731 Bacteria 960
113 Ga0307413_10783094 3300031824 Bacteria 800
114 Ga0326468_10000943 3300031889 Bacteria 2813
115 Ga0307406_10005914 3300031901 Bacteria 6710
116 Ga0307406_10062676 3300031901 Bacteria 2406
117 Ga0307416_100648272 3300032002 Bacteria 1140
118 Ga0307414_10647398 3300032004 Bacteria 952
119 Ga0307415_100131415 3300032126 Bacteria 1896
120 Ga0373951_0000052 3300035091 Bacteria 46256
121 Ga0373935_0002493 3300035692 Bacteria 10540
122 Ga0395898_0254694 3300037466 Bacteria 1674
123 Ga0395898_0259137 3300037466 Bacteria 1659
124 Ga0395901_0204823 3300038443 Bacteria 2067
125 Ga0451855_1314829 3300041511 Bacteria 879
126 Ga0439463_113639 3300042016 Bacteria 699
127 Ga0439458_0025098 3300042157 Bacteria 1397
128 Ga0439459_0035342 3300042438 Bacteria 1038
129 Ga0466972_0056424 3300044658 Bacteria 1888
130 Ga0466965_0069343 3300044683 Bacteria 1771
131 Ga0466965_0088906 3300044683 Bacteria 1569
132 Ga0466966_0098082 3300044684 Bacteria 1814
133 Ga0466961_0102834 3300044693 Bacteria 1799
134 Ga0466961_0117804 3300044693 Bacteria 1668
135 Ga0466961_0159981 3300044693 Bacteria 1404
136 Ga0466970_0008073 3300044765 Bacteria 5286
137 Ga0466970_0177458 3300044765 Bacteria 1181
138 Ga0466960_0024437 3300044901 Bacteria 2725
139 Ga0466959_0291560 3300045049 Bacteria 1118
140 Ga0466967_0540530 3300045976 Bacteria 1146
141 Ga0495594_0044171 3300046499 Bacteria 2444
142 Ga0495587_0375840 3300046536 Bacteria 791
143 Ga0495588_0251868 3300046674 Bacteria 931
144 Ga0495613_0298304 3300046689 Bacteria 1116
145 Ga0496100_0035727 3300048903 Bacteria 3128
146 Ga0496100_0716587 3300048903 Bacteria 781
147 Ga0496101_0046023 3300048904 Bacteria 3128
148 Ga0496101_0062555 3300048904 Bacteria 2706
149 Ga0496101_0118181 3300048904 Bacteria 2002
150 Ga0496102_0021204 3300048905 Bacteria 5746
151 Ga0496102_0025024 3300048905 Bacteria 5310
152 Ga0496102_0105560 3300048905 Bacteria 2621
153 Ga0496103_0054105 3300048906 Bacteria 2488
154 Ga0496104_0014167 3300048907 Bacteria 7194
155 Ga0496104_0434626 3300048907 Bacteria 1224
156 Ga0496105_0244185 3300048908 Bacteria 1456
157 Ga0496106_0023504 3300048909 Bacteria 4579
158 Ga0496107_0031997 3300048910 Bacteria 3757
159 Ga0496108_0143056 3300048911 Bacteria 2061
160 Ga0496109_0227270 3300048912 Bacteria 1755
161 Ga0496109_0292861 3300048912 Bacteria 1535
162 Ga0496109_0527623 3300048912 Bacteria 1114
163 Ga0496110_0035774 3300048913 Bacteria 4311
164 Ga0496110_0292693 3300048913 Bacteria 1483
165 Ga0496110_0363933 3300048913 Bacteria 1318
166 Ga0496112_0025848 3300048915 Bacteria 5642
167 Ga0496112_0080846 3300048915 Bacteria 3214
168 Ga0496113_0180972 3300048916 Bacteria 1671
169 Ga0496114_0001509 3300048917 Bacteria 17675
170 Ga0496114_0017036 3300048917 Bacteria 5860
171 Ga0496114_0061308 3300048917 Bacteria 3146
172 Ga0496114_0067572 3300048917 Bacteria 2999
173 Ga0496115_0002560 3300048918 Bacteria 13064
174 Ga0496115_0011725 3300048918 Bacteria 6582
175 Ga0496115_0131940 3300048918 Bacteria 2059
176 Ga0496117_0000738 3300048920 Bacteria 51389
177 Ga0496117_0007311 3300048920 Bacteria 10840
178 Ga0496118_0028690 3300048921 Bacteria 4681
179 Ga0496118_0042979 3300048921 Bacteria 3558
180 Ga0496119_0002264 3300048922 Bacteria 21392
181 Ga0496119_0003815 3300048922 Bacteria 15403
182 Ga0496120_0002693 3300048923 Bacteria 17433
183 Ga0496120_0014575 3300048923 Bacteria 5233
184 Ga0496123_0000009 3300048926 Bacteria 509486
185 Ga0496124_0004908 3300048927 Bacteria 15366
186 Ga0496126_0007850 3300048929 Bacteria 11626
187 Ga0496126_0402423 3300048929 Bacteria 1110
188 nmdc:mga00v17_89089_c1 3300050491 Bacteria 1936
189 nmdc:mga0yw44_608_c1 3300050492 Bacteria 12939
190 nmdc:mga05p37_229887_c1 3300050507 Bacteria 2235
191 nmdc:mga0sz30_5041_c1 3300050516 Bacteria 2595
192 Ga0495655_0034781 3300053083 Bacteria 1249
193 Ga0500655_000802 3300053133 Bacteria 6163
194 Ga0500616_0000319 3300053153 Bacteria 69060
195 2643887926 2643221575 Bacteria 4022601
196 2644098074 2643221616 Bacteria 4066575
197 2644136172 2643221624 Bacteria 4384879
198 2645719435 2643221961 Bacteria 3919167
199 2645726348 2643221962 Bacteria 3874254
200 2731906077 2731639228 Bacteria 4187555
201 2739203633 2738543005 Bacteria 5278128
202 2844844827 2844841374 Bacteria 3917147
203 2884765399 2884763398 Bacteria 4091164
204 2919056758 2919055335 Bacteria 3875751
205 2919526888 2919523602 Bacteria 3788128
206 2928155594 2928153084 Bacteria 4020257
207 2984594992 2984592036 Bacteria 3670284
208 8045832888 8045830549 Bacteria 4444727
209 Ga0070667_100112574
210 JGI24739J22299_10091205
211 JGI24737J22298_10003625
212 JGI24735J21928_10002576
213 JGI25162J39368_1008254
214 JGI25164J39214_1000876
215 JGI25406J46586_10022478
216 JGI25165J46597_1000002
217 Ga0006562J51391_1017569
218 Ga0006562J51391_1017570
219 Ga0055539_1000006
220 Ga0070658_10065477
221 Ga0070683_100587187
222 Ga0070680_100499314
223 Ga0070682_100481208
224 Ga0070682_100755946
225 Ga0068868_100105290
226 Ga0070661_100059098
227 Ga0070668_100063263
228 Ga0070659_100082170
229 Ga0070710_10311776
230 Ga0070711_100535045
231 Ga0068867_100492552
232 Ga0070684_100166406
233 Ga0068855_100018738
234 Ga0068857_100152839
235 Ga0068856_100040224
236 Ga0068856_100220673
237 Ga0068856_100693603
238 Ga0068852_101256906
239 Ga0068864_100185100
240 Ga0068864_100611163
241 Ga0068858_100071385
242 Ga0068858_100489062
243 Ga0068860_100000331
244 Ga0068860_100153031
245 Ga0068860_100179485
246 Ga0081539_10002881
247 Ga0081539_10123945
248 Ga0070717_10564697
249 Ga0075365_10018933
250 Ga0075363_100035036
251 Ga0075364_10010618
252 Ga0105240_10528009
253 Ga0105247_10038725
254 Ga0114129_10267734
255 Ga0105248_10222746
256 Ga0105237_10168690
257 Ga0105237_10452977
258 Ga0105238_10195698
259 Ga0105239_10180489
260 Ga0105239_11556635
261 Ga0157370_10019192
262 Ga0157369_10088096
263 Ga0157369_10231759
264 Ga0157369_10278829
265 Ga0157369_10294570
266 Ga0163163_10050009
267 Ga0163163_10251254
268 Ga0163163_10271937
269 Ga0163163_11354978
270 Ga0157380_11005527
271 Ga0157379_10098339
272 Ga0163161_10347641
273 Ga0206354_11150593
274 Ga0209563_100245
275 Ga0207427_100052
276 Ga0209437_100451
277 Ga0209233_1000001
278 Ga0209455_1001526
279 Ga0207647_10090336
280 Ga0207643_10022333
281 Ga0207705_10007238
282 Ga0207705_10061720
283 Ga0207671_10186571
284 Ga0207671_10580192
285 Ga0207657_10514106
286 Ga0207665_10574021
287 Ga0207691_10081963
288 Ga0207711_10512813
289 Ga0207689_10351572
290 Ga0207661_10089282
291 Ga0207667_10004658
292 Ga0207667_10036680
293 Ga0207651_10210192
294 Ga0207668_10053813
295 Ga0207668_10367210
296 Ga0207658_10131733
297 Ga0207677_10586429
298 Ga0207703_10136585
299 Ga0207703_10910183
300 Ga0207702_10324944
301 Ga0207641_10289053
302 Ga0207641_10435676
303 Ga0207648_10340796
304 Ga0207676_10307980
305 Ga0207676_10397925
306 Ga0207674_10029759
307 Ga0207674_10301831
308 Ga0207675_100228834
309 Ga0207675_100591266
310 Ga0207698_10050410
311 Ga0207698_10994885
312 Ga0268265_11006042
313 Ga0268264_10000193
314 Ga0268264_10049759
315 Ga0268264_10147895
316 Ga0307515_10077622
317 Ga0307512_10004254
318 Ga0307513_10733120
319 Ga0307405_10352534
320 Ga0307405_10516617
321 Ga0307413_10783094
322 Ga0326468_10000943
323 Ga0307406_10005914
324 Ga0307406_10062676
325 Ga0307416_100648272
326 Ga0307414_10647398
327 Ga0307415_100131415
328 Ga0373951_0000052
329 Ga0373935_0002493
330 Ga0395898_0254694
331 Ga0395898_0259137
332 Ga0395901_0204823
333 Ga0451855_1314829
334 Ga0439463_113639
335 Ga0439458_0025098
336 Ga0439459_0035342
337 Ga0466972_0056424
338 Ga0466965_0069343
339 Ga0466965_0088906
340 Ga0466966_0098082
341 Ga0466961_0102834
342 Ga0466961_0117804
343 Ga0466961_0159981
344 Ga0466970_0008073
345 Ga0466970_0177458
346 Ga0466960_0024437
347 Ga0466959_0291560
348 Ga0466967_0540530
349 Ga0495594_0044171
350 Ga0495587_0375840
351 Ga0495588_0251868
352 Ga0495613_0298304
353 Ga0496100_0035727
354 Ga0496100_0716587
355 Ga0496101_0046023
356 Ga0496101_0062555
357 Ga0496101_0118181
358 Ga0496102_0021204
359 Ga0496102_0025024
360 Ga0496102_0105560
361 Ga0496103_0054105
362 Ga0496104_0014167
363 Ga0496104_0434626
364 Ga0496105_0244185
365 Ga0496106_0023504
366 Ga0496107_0031997
367 Ga0496108_0143056
368 Ga0496109_0227270
369 Ga0496109_0292861
370 Ga0496109_0527623
371 Ga0496110_0035774
372 Ga0496110_0292693
373 Ga0496110_0363933
374 Ga0496112_0025848
375 Ga0496112_0080846
376 Ga0496113_0180972
377 Ga0496114_0001509
378 Ga0496114_0017036
379 Ga0496114_0061308
380 Ga0496114_0067572
381 Ga0496115_0002560
382 Ga0496115_0011725
383 Ga0496115_0131940
384 Ga0496117_0000738
385 Ga0496117_0007311
386 Ga0496118_0028690
387 Ga0496118_0042979
388 Ga0496119_0002264
389 Ga0496119_0003815
390 Ga0496120_0002693
391 Ga0496120_0014575
392 Ga0496123_0000009
393 Ga0496124_0004908
394 Ga0496126_0007850
395 Ga0496126_0402423
396 nmdc:mga00v17_89089_c1
397 nmdc:mga0yw44_608_c1
398 nmdc:mga05p37_229887_c1
399 nmdc:mga0sz30_5041_c1
400 Ga0495655_0034781
401 Ga0500655_000802
402 Ga0500616_0000319
403 2643887926
404 2644098074
405 2644136172
406 2645719435
407 2645726348
408 2731906077
409 2739203633
410 2844844827
411 2884765399
412 2919056758
413 2919526888
414 2928155594
415 2984594992
416 8045832888

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01872

RibD_C

RibD C-terminal domain

2

229

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
5xcc-assembly2.cif.gz_B x-ray structure of clostridium perfringens pili protein cppa 0.8541 196 213
2bol-assembly1.cif.gz_A crystal structure and assembly of tsp36, a metazoan small heat shock protein 0.8431 198 213
2wj5-assembly1.cif.gz_A rat alpha crystallin domain 0.825 198 213
3kgy-assembly1.cif.gz_B crystal structure of putative dihydrofolate reductase (yp_001636057.1) from chloroflexus aurantiacus j-10-fl at 1.50 a resolution 0.8215 1 214
2dia-assembly1.cif.gz_A solution structure of the 10th filamin domain from human filamin-b 0.8127 196 213
ID Description Score Start End Superfamily
af_Q9VSA9_43_139_2.60.40.790 Mainly Beta;Sandwich;Immunoglobulin-like; 0.8499 198 213 2.60.40.790
af_A2BHS1_88_182_2.60.40.790 Mainly Beta;Sandwich;Immunoglobulin-like; 0.8266 197 214 2.60.40.790
af_P41217_144_233_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.8265 196 212 2.60.40.10
af_D4AAV6_123_220_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.8259 196 214 2.60.40.10
3kgyB00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.8236 2 214 3.40.430.10
ID Description Score Start End GO Terms
AF-D0LET3-F1-model_v4 Bifunctional deaminase-reductase domain protein 0.9607 1 214 GO:0008703
GO:0009231
AF-A0A259STM9-F1-model_v4 Deaminase 0.9595 62 214 GO:0008703
GO:0009231
AF-D0LET3-F1-model_v4 Bifunctional deaminase-reductase domain protein 0.9564 1 214 GO:0008703
GO:0009231
AF-A0A6P0DTV9-F1-model_v4 Deaminase 0.9515 8 108
AF-A0A259STM9-F1-model_v4 Deaminase 0.9475 62 214 GO:0008703
GO:0009231

Map