F316888

General Info

Members Datasets Scaffolds Average Seq Length
207 141 414 315

Family's Representative Sequence

Representative Sequence 3300046499|Ga0495594_0082866|Ga0495594_0082866_67_1098
Length 343
Sequence MVHLTRNGVAAHCPVWQGVRVPAAEPTPPVVEIADLTRVFPPAGRHAEPRTALDHVSLTIADGEVHGLLGPNGAGKTTLCKILSTVLLPTSGTAAIAGLDVVTETARVRPLIGIVFGGERGLYTRLTARQNLRYWAALYRVPNRLAKPRVESLLEQVGLADRADQRVETYSRGMKQRLHLARGLIGDPRVLFLDEPTTGMDPVAAHEFRALVRRQQANGTTILLTTHDMAEAEAVCDRVTLIDGGRLLRTESPRTIGGWISAHERIDARNVPTPVREELAAIAGVSEIEDLDSGGIRIHTNVEGATGAVLKTLVQHGITSITTGRPSLEEVYLHVIGARGLTV

Samples

Sample ID Description Type Environment
1 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
6 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
7 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
10 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
11 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
12 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
13 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
14 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
15 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
16 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
17 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
18 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
19 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
20 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
21 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
22 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
23 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
24 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
25 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
26 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
27 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
28 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
29 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
30 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
31 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
32 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
33 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
34 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
35 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
36 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
38 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
39 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
40 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
41 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
42 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
61 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
62 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
63 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
64 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
65 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
66 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
67 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
68 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
69 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
70 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
71 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
72 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
73 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
74 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
75 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
76 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
77 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
78 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
79 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
80 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
81 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
82 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
83 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
84 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
85 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
86 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
87 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
88 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
89 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
90 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
91 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
92 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
93 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
94 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
95 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
96 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
97 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
98 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
99 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
100 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
101 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
102 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
103 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
104 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
105 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
106 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
107 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
108 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
109 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
110 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
111 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
112 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
113 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
114 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
115 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
116 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
117 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
118 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
119 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
120 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
121 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
122 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
123 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
124 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
125 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
126 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
127 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
128 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
129 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
130 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
131 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
132 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
133 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
134 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
135 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
136 2643221566 Microbacterium sp. Root166 Isolate Unclassified
137 2751185734 Saccharothrix sp. NRRL B-16314 Isolate Rhizosphere
138 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere
139 2867346516 Streptomyces radicis AZ1-7 Isolate Unclassified
140 2870721527 Saccharothrix ecbatanensis DSM 45486 Isolate Rhizosphere
141 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.14
Metatranscriptomes 0
Isolates 3.86

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.48
Nodule 0
Rhizoplane 3.38
Rhizosphere 93.24
Stem 0
Stem Tuber 0
Unclassified 1.45

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495594_0082866 3300046499 Bacteria 1792
2 Ga0070683_100018737 3300005329 Bacteria 6136
3 Ga0070683_100028115 3300005329 Bacteria 5079
4 Ga0070677_10145287 3300005333 Unclassified 1098
5 Ga0070682_100233718 3300005337 Bacteria 1316
6 Ga0070692_10193892 3300005345 Bacteria 1186
7 Ga0070668_100001313 3300005347 Bacteria 17804
8 Ga0070667_100056706 3300005367 Bacteria 3310
9 Ga0070714_100000002 3300005435 Bacteria 386673
10 Ga0070714_100177989 3300005435 Bacteria 1934
11 Ga0070705_100004831 3300005440 Bacteria 6557
12 Ga0070708_100001536 3300005445 Bacteria 17652
13 Ga0070708_100002168 3300005445 Bacteria 15160
14 Ga0070708_100197996 3300005445 Bacteria 1880
15 Ga0070681_10372498 3300005458 Bacteria 1338
16 Ga0070706_100000036 3300005467 Bacteria 151766
17 Ga0070706_100001058 3300005467 Bacteria 29860
18 Ga0070707_100000173 3300005468 Bacteria 62928
19 Ga0070707_100002080 3300005468 Bacteria 19196
20 Ga0070698_100010881 3300005471 Bacteria 9677
21 Ga0070698_100010915 3300005471 Bacteria 9663
22 Ga0070698_100025422 3300005471 Bacteria 6172
23 Ga0070699_100000086 3300005518 Bacteria 88406
24 Ga0070699_100001372 3300005518 Bacteria 22352
25 Ga0070699_100053251 3300005518 Bacteria 3503
26 Ga0070699_100110486 3300005518 Bacteria 2413
27 Ga0070679_100027984 3300005530 Bacteria 5554
28 Ga0070684_100046433 3300005535 Bacteria 3763
29 Ga0070697_100002987 3300005536 Bacteria 12990
30 Ga0070697_100005302 3300005536 Bacteria 9906
31 Ga0070697_100053238 3300005536 Bacteria 3289
32 Ga0070697_100060231 3300005536 Bacteria 3093
33 Ga0068853_100008957 3300005539 Bacteria 8059
34 Ga0070664_100014887 3300005564 Bacteria 6345
35 Ga0068857_100078680 3300005577 Bacteria 2943
36 Ga0068854_100063953 3300005578 Bacteria 2672
37 Ga0068860_100000801 3300005843 Bacteria 35303
38 Ga0068862_100088895 3300005844 Bacteria 2688
39 Ga0081538_10037165 3300005981 Bacteria 3165
40 Ga0070717_10004873 3300006028 Bacteria 9763
41 Ga0075428_100024466 3300006844 Bacteria 6682
42 Ga0075430_100005739 3300006846 Bacteria 10470
43 Ga0075431_100078392 3300006847 Bacteria 3410
44 Ga0075433_10055646 3300006852 Bacteria 3454
45 Ga0075429_100008533 3300006880 Bacteria 8914
46 Ga0075436_100000001 3300006914 Bacteria 622380
47 Ga0075436_100002156 3300006914 Bacteria 13572
48 Ga0075436_100005053 3300006914 Bacteria 9078
49 Ga0075436_100108082 3300006914 Bacteria 1940
50 Ga0075435_100055508 3300007076 Bacteria 3199
51 Ga0105245_10419188 3300009098 Bacteria 1341
52 Ga0105247_10094521 3300009101 Bacteria 1902
53 Ga0114129_10004817 3300009147 Bacteria 19072
54 Ga0105248_10105787 3300009177 Bacteria 3173
55 Ga0157369_10419420 3300013105 Bacteria 1387
56 Ga0157372_10108140 3300013307 Bacteria 3182
57 Ga0182008_10131551 3300014497 Bacteria 1247
58 Ga0207426_1001582 3300025302 Bacteria 18293
59 Ga0207684_10000020 3300025910 Bacteria 342787
60 Ga0207684_10000027 3300025910 Bacteria 313272
61 Ga0207707_10116392 3300025912 Bacteria 2336
62 Ga0207707_10168873 3300025912 Bacteria 1912
63 Ga0207657_10092873 3300025919 Bacteria 2514
64 Ga0207652_10291431 3300025921 Bacteria 1472
65 Ga0207646_10000021 3300025922 Bacteria 272003
66 Ga0207646_10000033 3300025922 Bacteria 213090
67 Ga0207646_10000814 3300025922 Bacteria 40565
68 Ga0207646_10022759 3300025922 Bacteria 5763
69 Ga0207650_10027578 3300025925 Bacteria 4067
70 Ga0207664_10000038 3300025929 Bacteria 166264
71 Ga0207664_10074456 3300025929 Bacteria 2744
72 Ga0207664_10222947 3300025929 Bacteria 1636
73 Ga0207664_10275649 3300025929 Unclassified 1475
74 Ga0207664_10281592 3300025929 Bacteria 1459
75 Ga0207665_10154734 3300025939 Bacteria 1645
76 Ga0207711_10044883 3300025941 Bacteria 3775
77 Ga0207661_10006044 3300025944 Bacteria 8552
78 Ga0207661_10301529 3300025944 Bacteria 1436
79 Ga0207679_10038798 3300025945 Bacteria 3397
80 Ga0207668_10002289 3300025972 Bacteria 11181
81 Ga0207640_10037977 3300025981 Bacteria 3034
82 Ga0207658_10053420 3300025986 Bacteria 2985
83 Ga0207639_10065977 3300026041 Bacteria 2811
84 Ga0207674_10093533 3300026116 Bacteria 2994
85 Ga0207674_10166891 3300026116 Bacteria 2156
86 Ga0268265_10064410 3300028380 Bacteria 2823
87 Ga0268265_10243018 3300028380 Bacteria 1590
88 Ga0268264_10000897 3300028381 Bacteria 31365
89 Ga0265319_1018204 3300028563 Bacteria 2653
90 Ga0265334_10000451 3300028573 Bacteria 21405
91 Ga0265318_10000063 3300028577 Bacteria 105280
92 Ga0265324_10004305 3300029957 Bacteria 6493
93 Ga0307512_10027562 3300030522 Bacteria 4996
94 Ga0265332_10074595 3300031238 Bacteria 1442
95 Ga0265320_10000732 3300031240 Bacteria 25110
96 Ga0265325_10110941 3300031241 Bacteria 1333
97 Ga0265340_10001689 3300031247 Bacteria 12694
98 Ga0265331_10004671 3300031250 Bacteria 8481
99 Ga0265313_10000997 3300031595 Bacteria 27777
100 Ga0265314_10001173 3300031711 Bacteria 30109
101 Ga0307405_10010838 3300031731 Bacteria 4746
102 Ga0307406_10618131 3300031901 Bacteria 895
103 Ga0307409_100005379 3300031995 Bacteria 7355
104 Ga0307416_100002798 3300032002 Bacteria 10136
105 Ga0307414_10271764 3300032004 Bacteria 1420
106 Ga0307411_10192355 3300032005 Bacteria 1559
107 Ga0307411_10222644 3300032005 Bacteria 1465
108 Ga0307415_100000338 3300032126 Bacteria 20222
109 Ga0395900_0064874 3300037418 Bacteria 3751
110 Ga0395900_0179855 3300037418 Bacteria 2150
111 Ga0395898_0190735 3300037466 Bacteria 1958
112 Ga0395905_0180032 3300037471 Bacteria 1984
113 Ga0395901_0043065 3300038443 Bacteria 4682
114 Ga0466969_0002388 3300044656 Bacteria 10029
115 Ga0466969_0004481 3300044656 Bacteria 7436
116 Ga0466969_0006768 3300044656 Bacteria 6098
117 Ga0466969_0109939 3300044656 Bacteria 1291
118 Ga0466966_0001563 3300044684 Bacteria 14705
119 Ga0466966_0006018 3300044684 Bacteria 8008
120 Ga0466966_0034954 3300044684 Bacteria 3248
121 Ga0466966_0040430 3300044684 Bacteria 3001
122 Ga0466961_0001470 3300044693 Bacteria 14632
123 Ga0466961_0004096 3300044693 Bacteria 9104
124 Ga0466963_0007382 3300044694 Bacteria 6549
125 Ga0466963_0014466 3300044694 Bacteria 4865
126 Ga0466963_0036256 3300044694 Bacteria 3215
127 Ga0466963_0110401 3300044694 Bacteria 1887
128 Ga0466963_0160079 3300044694 Bacteria 1566
129 Ga0453684_0228813 3300044712 Bacteria 2148
130 Ga0466971_0063541 3300044719 Bacteria 1671
131 Ga0466968_0004973 3300044735 Bacteria 4980
132 Ga0466970_0026902 3300044765 Bacteria 3015
133 Ga0466970_0122591 3300044765 Bacteria 1424
134 Ga0466957_0020987 3300044842 Bacteria 3844
135 Ga0466957_0022872 3300044842 Bacteria 3691
136 Ga0466957_0055023 3300044842 Bacteria 2431
137 Ga0466957_0060915 3300044842 Bacteria 2315
138 Ga0466960_0004807 3300044901 Bacteria 5306
139 Ga0466959_0000831 3300045049 Bacteria 18229
140 Ga0466959_0003061 3300045049 Bacteria 10822
141 Ga0466959_0010318 3300045049 Bacteria 6670
142 Ga0466959_0204913 3300045049 Bacteria 1372
143 Ga0466958_0000860 3300045836 Bacteria 13532
144 Ga0466958_0002438 3300045836 Bacteria 9328
145 Ga0466958_0062900 3300045836 Bacteria 2263
146 Ga0466958_0183185 3300045836 Bacteria 1329
147 Ga0466958_0185585 3300045836 Bacteria 1320
148 Ga0466967_0027036 3300045976 Bacteria 4765
149 Ga0466967_0041278 3300045976 Bacteria 3977
150 Ga0466967_0101907 3300045976 Bacteria 2625
151 Ga0466967_0326410 3300045976 Bacteria 1481
152 Ga0466967_0601488 3300045976 Bacteria 1085
153 Ga0495629_0009134 3300046459 Bacteria 7261
154 Ga0495638_0000012 3300046460 Bacteria 435577
155 Ga0495662_0003920 3300046476 Bacteria 7505
156 Ga0495584_0041180 3300046491 Bacteria 2332
157 Ga0495583_0001198 3300046506 Bacteria 27870
158 Ga0495648_0000038 3300046524 Bacteria 191612
159 Ga0495621_0091274 3300046539 Unclassified 1148
160 Ga0495633_0011360 3300046558 Bacteria 4806
161 Ga0495656_0073115 3300046615 Bacteria 1528
162 Ga0495613_0019062 3300046689 Bacteria 5114
163 Ga0495671_0000034 3300046692 Bacteria 195385
164 Ga0495589_0057324 3300046794 Bacteria 1916
165 Ga0495673_0000013 3300047469 Bacteria 612902
166 Ga0496107_0056345 3300048910 Bacteria 2840
167 Ga0496110_0321447 3300048913 Bacteria 1410
168 Ga0496112_0000764 3300048915 Bacteria 22605
169 Ga0496112_0006741 3300048915 Bacteria 10117
170 Ga0496112_0044211 3300048915 Bacteria 4364
171 Ga0496113_0235506 3300048916 Bacteria 1460
172 Ga0496113_0262631 3300048916 Bacteria 1379
173 Ga0496118_0032232 3300048921 Bacteria 4323
174 Ga0496124_0000804 3300048927 Bacteria 50951
175 Ga0501031_0018126 3300049568 Bacteria 4581
176 Ga0501038_0002087 3300049574 Bacteria 18530
177 Ga0501040_0010783 3300049576 Bacteria 5973
178 Ga0501040_0332262 3300049576 Bacteria 1088
179 Ga0501046_0183605 3300049580 Bacteria 1563
180 Ga0501068_0098870 3300049584 Bacteria 1807
181 Ga0501074_0021634 3300049590 Bacteria 4670
182 Ga0501075_0114723 3300049591 Bacteria 2048
183 Ga0501077_0162926 3300049593 Bacteria 1416
184 Ga0501079_0091249 3300049741 Bacteria 2360
185 Ga0501081_0028466 3300049743 Bacteria 3771
186 Ga0501045_0000426 3300049824 Bacteria 25770
187 nmdc:mga05p37_10294_c1 3300050507 Bacteria 11107
188 nmdc:mga09592_18480_c1 3300050508 Bacteria 5717
189 nmdc:mga0qj67_5000_c1 3300050509 Bacteria 9635
190 nmdc:mga06r32_190383_c1 3300050510 Bacteria 2039
191 nmdc:mga0n895_108232_c1 3300050512 Bacteria 2794
192 nmdc:mga08x19_1107_c1 3300050514 Bacteria 16807
193 nmdc:mga08x19_1_c1 3300050514 Bacteria 2010344
194 nmdc:mga08x19_25399_c1 3300050514 Bacteria 3690
195 nmdc:mga08x19_34474_c1 3300050514 Bacteria 3200
196 nmdc:mga0a205_97933_c1 3300050515 Bacteria 2037
197 Ga0501084_0002672 3300054114 Bacteria 14347
198 Ga0501082_0032293 3300060353 Bacteria 4515
199 Ga0466962_0037681 3300061719 Bacteria 2316
200 2643848774 2643221566 Bacteria 3460379
201 2753071974 2751185734 Bacteria 8863695
202 2753072701 2751185734 Bacteria 8863695
203 2819741707 2818991472 Bacteria 10089953
204 2867352498 2867346516 Bacteria 7608576
205 2870722159 2870721527 Bacteria 9689237
206 2870722991 2870721527 Bacteria 9689237
207 8048410572 8048406513 Bacteria 8936924
208 Ga0495594_0082866
209 Ga0070683_100018737
210 Ga0070683_100028115
211 Ga0070677_10145287
212 Ga0070682_100233718
213 Ga0070692_10193892
214 Ga0070668_100001313
215 Ga0070667_100056706
216 Ga0070714_100000002
217 Ga0070714_100177989
218 Ga0070705_100004831
219 Ga0070708_100001536
220 Ga0070708_100002168
221 Ga0070708_100197996
222 Ga0070681_10372498
223 Ga0070706_100000036
224 Ga0070706_100001058
225 Ga0070707_100000173
226 Ga0070707_100002080
227 Ga0070698_100010881
228 Ga0070698_100010915
229 Ga0070698_100025422
230 Ga0070699_100000086
231 Ga0070699_100001372
232 Ga0070699_100053251
233 Ga0070699_100110486
234 Ga0070679_100027984
235 Ga0070684_100046433
236 Ga0070697_100002987
237 Ga0070697_100005302
238 Ga0070697_100053238
239 Ga0070697_100060231
240 Ga0068853_100008957
241 Ga0070664_100014887
242 Ga0068857_100078680
243 Ga0068854_100063953
244 Ga0068860_100000801
245 Ga0068862_100088895
246 Ga0081538_10037165
247 Ga0070717_10004873
248 Ga0075428_100024466
249 Ga0075430_100005739
250 Ga0075431_100078392
251 Ga0075433_10055646
252 Ga0075429_100008533
253 Ga0075436_100000001
254 Ga0075436_100002156
255 Ga0075436_100005053
256 Ga0075436_100108082
257 Ga0075435_100055508
258 Ga0105245_10419188
259 Ga0105247_10094521
260 Ga0114129_10004817
261 Ga0105248_10105787
262 Ga0157369_10419420
263 Ga0157372_10108140
264 Ga0182008_10131551
265 Ga0207426_1001582
266 Ga0207684_10000020
267 Ga0207684_10000027
268 Ga0207707_10116392
269 Ga0207707_10168873
270 Ga0207657_10092873
271 Ga0207652_10291431
272 Ga0207646_10000021
273 Ga0207646_10000033
274 Ga0207646_10000814
275 Ga0207646_10022759
276 Ga0207650_10027578
277 Ga0207664_10000038
278 Ga0207664_10074456
279 Ga0207664_10222947
280 Ga0207664_10275649
281 Ga0207664_10281592
282 Ga0207665_10154734
283 Ga0207711_10044883
284 Ga0207661_10006044
285 Ga0207661_10301529
286 Ga0207679_10038798
287 Ga0207668_10002289
288 Ga0207640_10037977
289 Ga0207658_10053420
290 Ga0207639_10065977
291 Ga0207674_10093533
292 Ga0207674_10166891
293 Ga0268265_10064410
294 Ga0268265_10243018
295 Ga0268264_10000897
296 Ga0265319_1018204
297 Ga0265334_10000451
298 Ga0265318_10000063
299 Ga0265324_10004305
300 Ga0307512_10027562
301 Ga0265332_10074595
302 Ga0265320_10000732
303 Ga0265325_10110941
304 Ga0265340_10001689
305 Ga0265331_10004671
306 Ga0265313_10000997
307 Ga0265314_10001173
308 Ga0307405_10010838
309 Ga0307406_10618131
310 Ga0307409_100005379
311 Ga0307416_100002798
312 Ga0307414_10271764
313 Ga0307411_10192355
314 Ga0307411_10222644
315 Ga0307415_100000338
316 Ga0395900_0064874
317 Ga0395900_0179855
318 Ga0395898_0190735
319 Ga0395905_0180032
320 Ga0395901_0043065
321 Ga0466969_0002388
322 Ga0466969_0004481
323 Ga0466969_0006768
324 Ga0466969_0109939
325 Ga0466966_0001563
326 Ga0466966_0006018
327 Ga0466966_0034954
328 Ga0466966_0040430
329 Ga0466961_0001470
330 Ga0466961_0004096
331 Ga0466963_0007382
332 Ga0466963_0014466
333 Ga0466963_0036256
334 Ga0466963_0110401
335 Ga0466963_0160079
336 Ga0453684_0228813
337 Ga0466971_0063541
338 Ga0466968_0004973
339 Ga0466970_0026902
340 Ga0466970_0122591
341 Ga0466957_0020987
342 Ga0466957_0022872
343 Ga0466957_0055023
344 Ga0466957_0060915
345 Ga0466960_0004807
346 Ga0466959_0000831
347 Ga0466959_0003061
348 Ga0466959_0010318
349 Ga0466959_0204913
350 Ga0466958_0000860
351 Ga0466958_0002438
352 Ga0466958_0062900
353 Ga0466958_0183185
354 Ga0466958_0185585
355 Ga0466967_0027036
356 Ga0466967_0041278
357 Ga0466967_0101907
358 Ga0466967_0326410
359 Ga0466967_0601488
360 Ga0495629_0009134
361 Ga0495638_0000012
362 Ga0495662_0003920
363 Ga0495584_0041180
364 Ga0495583_0001198
365 Ga0495648_0000038
366 Ga0495621_0091274
367 Ga0495633_0011360
368 Ga0495656_0073115
369 Ga0495613_0019062
370 Ga0495671_0000034
371 Ga0495589_0057324
372 Ga0495673_0000013
373 Ga0496107_0056345
374 Ga0496110_0321447
375 Ga0496112_0000764
376 Ga0496112_0006741
377 Ga0496112_0044211
378 Ga0496113_0235506
379 Ga0496113_0262631
380 Ga0496118_0032232
381 Ga0496124_0000804
382 Ga0501031_0018126
383 Ga0501038_0002087
384 Ga0501040_0010783
385 Ga0501040_0332262
386 Ga0501046_0183605
387 Ga0501068_0098870
388 Ga0501074_0021634
389 Ga0501075_0114723
390 Ga0501077_0162926
391 Ga0501079_0091249
392 Ga0501081_0028466
393 Ga0501045_0000426
394 nmdc:mga05p37_10294_c1
395 nmdc:mga09592_18480_c1
396 nmdc:mga0qj67_5000_c1
397 nmdc:mga06r32_190383_c1
398 nmdc:mga0n895_108232_c1
399 nmdc:mga08x19_1107_c1
400 nmdc:mga08x19_1_c1
401 nmdc:mga08x19_25399_c1
402 nmdc:mga08x19_34474_c1
403 nmdc:mga0a205_97933_c1
404 Ga0501084_0002672
405 Ga0501082_0032293
406 Ga0466962_0037681
407 2643848774
408 2753071974
409 2753072701
410 2819741707
411 2867352498
412 2870722159
413 2870722991
414 8048410572

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

53

198

0.97

PF13304

AAA_21

AAA domain, putative AbiEii toxin, Type IV TA system

124

233

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
5x40-assembly1.cif.gz_B structure of a cbio dimer bound with amppcp 0.9352 3 229
8bms-assembly1.cif.gz_B cryo-em structure of the mutant solitary ecf module 2eq in msp2n2 lipid nanodiscs in the atpase closed and atp-bound conformation 0.9285 3 230
5x41-assembly1.cif.gz_B 3.5a resolution structure of a cobalt energy-coupling factor transporter using lcp method-cbimqo 0.9257 3 229
8bmq-assembly1.cif.gz_B cryo-em structure of the folate-specific ecf transporter complex in msp2n2 lipid nanodiscs bound to amp-pnp 0.924 3 230
4p33-assembly1.cif.gz_A crystal structure of e. coli lptb-e163q in complex with atp-sodium 0.9207 4 228
ID Description Score Start End Superfamily
af_P36879_1_236_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9746 2 224 3.40.50.300
af_P0A9U1_321_563_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9706 1 232 3.40.50.300
af_A1ZBS3_1241_1472_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9652 4 231 3.40.50.300
af_Q58429_1_224_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9644 1 224 3.40.50.300
af_Q8T6J5_1286_1532_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.962 3 231 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A520NVZ7-F1-model_v4 ABC transporter ATP-binding protein 0.9703 2 228 GO:0005524
GO:0016887
AF-A0A0D1P4L1-F1-model_v4 deleted 0.9585 1 231
AF-X1DWV4-F1-model_v4 ABC transporter domain-containing protein 0.9555 2 173 GO:0005524
GO:0016887
AF-A0A352UF74-F1-model_v4 ABC transporter domain-containing protein 0.9552 2 175 GO:0005524
GO:0016887
AF-A0A2D4CKI9-F1-model_v4 deleted 0.9495 2 231

Map