F316833

General Info

Members Datasets Scaffolds Average Seq Length
207 146 414 280

Family's Representative Sequence

Representative Sequence 3300044694|Ga0466963_0377479|Ga0466963_0377479_50_964
Length 304
Sequence VTRPSSLRTNLVGRPRPQYTADRLTVHRDPAALRRVTKALRGGGRRVTLVPTMGALHEGHRELMRRARGIPGSTTVVSIFVNPRQFGPGEDFERYPRAFEGDLEMCREEGVELVFAPDVEDMYPPGFATSVHPGPLGDELEGAVRPGHFAGVLTVVNKLFAIALPDVAFFGEKDYQQLTLIRRMVRDLDIDLHVVGVPTVREQDGLALSSRNAYLSDDDRAAAVALSAALAAGQYAGEHGPTAVLDAARAVLDAEPRLEVDYLELRDEDLGPTPEIGPARLLVAARAGATRLIDNAAVSLVRRV

Samples

Sample ID Description Type Environment
1 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
17 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
18 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
19 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
27 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
28 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
29 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
30 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
31 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
32 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
33 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
34 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
35 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
36 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
37 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
38 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
39 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
40 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
41 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
43 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
45 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
46 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
48 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
49 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
50 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
51 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
52 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
53 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
54 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
55 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
56 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
77 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
79 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
80 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
81 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
82 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
83 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
84 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
85 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
86 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
87 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
88 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
89 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
90 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
91 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
92 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
93 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
94 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
95 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
96 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
97 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
98 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
99 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
100 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
101 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
102 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
103 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
104 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
105 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
106 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
107 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
108 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
109 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
110 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
111 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
112 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
113 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
114 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
115 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
116 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
117 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
118 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
119 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
120 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
121 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
122 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
123 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
124 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
125 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
126 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
127 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
128 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
129 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
130 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
131 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
132 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
133 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
134 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
135 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
136 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
137 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
138 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
139 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
140 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
141 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
142 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
143 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
144 2622736605 Geodermatophilus ruber DSM 45317 Isolate Rhizosphere
145 2808606522 Amycolatopsis sp. BJA-103 Isolate Unclassified
146 2837268691 Jiangella endophytica KE2-3 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.55
Metatranscriptomes 0
Isolates 1.45

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 6.76
Rhizosphere 89.86
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466963_0377479 3300044694 Bacteria 999
2 Ga0070658_10053589 3300005327 Bacteria 3274
3 Ga0070683_100161592 3300005329 Bacteria 2125
4 Ga0070683_100263709 3300005329 Bacteria 1639
5 Ga0070690_100178642 3300005330 Bacteria 1466
6 Ga0070680_100221228 3300005336 Bacteria 1598
7 Ga0070682_100283010 3300005337 Bacteria 1209
8 Ga0068868_100107503 3300005338 Bacteria 2264
9 Ga0070660_100136798 3300005339 Bacteria 1963
10 Ga0070660_100193149 3300005339 Bacteria 1649
11 Ga0070687_100064973 3300005343 Bacteria 1940
12 Ga0070668_100005265 3300005347 Bacteria 9598
13 Ga0070668_100296327 3300005347 Bacteria 1355
14 Ga0070669_100272698 3300005353 Bacteria 1353
15 Ga0070669_100485160 3300005353 Bacteria 1023
16 Ga0070673_100258568 3300005364 Bacteria 1520
17 Ga0070688_100073656 3300005365 Bacteria 2191
18 Ga0070659_100110088 3300005366 Bacteria 2223
19 Ga0070714_100170830 3300005435 Bacteria 1973
20 Ga0070701_10150647 3300005438 Bacteria 1339
21 Ga0070705_100004945 3300005440 Bacteria 6491
22 Ga0070705_100186134 3300005440 Bacteria 1411
23 Ga0070700_100269271 3300005441 Bacteria 1230
24 Ga0070694_100122042 3300005444 Bacteria 1871
25 Ga0070708_100163019 3300005445 Bacteria 2078
26 Ga0070663_100004226 3300005455 Bacteria 8403
27 Ga0068867_100140252 3300005459 Bacteria 1889
28 Ga0070685_10014338 3300005466 Bacteria 4197
29 Ga0070698_100026895 3300005471 Bacteria 5983
30 Ga0070684_100074184 3300005535 Bacteria 2999
31 Ga0070695_100166970 3300005545 Bacteria 1550
32 Ga0070696_100058082 3300005546 Bacteria 2702
33 Ga0070696_100171785 3300005546 Bacteria 1603
34 Ga0070664_100194463 3300005564 Bacteria 1808
35 Ga0068859_100057996 3300005617 Bacteria 3899
36 Ga0068859_100142878 3300005617 Bacteria 2467
37 Ga0068864_100333057 3300005618 Bacteria 1429
38 Ga0068864_100394865 3300005618 Bacteria 1313
39 Ga0068863_100585744 3300005841 Bacteria 1103
40 Ga0068858_100001270 3300005842 Bacteria 26112
41 Ga0081455_10022720 3300005937 Bacteria 5853
42 Ga0070715_10073180 3300006163 Bacteria 1536
43 Ga0070712_100213650 3300006175 Bacteria 1523
44 Ga0075430_100105048 3300006846 Bacteria 2357
45 Ga0075433_10018006 3300006852 Bacteria 5863
46 Ga0075433_10069008 3300006852 Bacteria 3104
47 Ga0075429_100189684 3300006880 Bacteria 1801
48 Ga0068865_100076598 3300006881 Bacteria 2388
49 Ga0075436_100154299 3300006914 Bacteria 1617
50 Ga0097620_100057998 3300006931 Bacteria 3899
51 Ga0097620_100142881 3300006931 Bacteria 2467
52 Ga0075435_100105610 3300007076 Bacteria 2338
53 Ga0111539_10001707 3300009094 Bacteria 29247
54 Ga0111539_10131199 3300009094 Bacteria 2934
55 Ga0105245_10077483 3300009098 Bacteria 3031
56 Ga0105245_10269572 3300009098 Bacteria 1660
57 Ga0105245_10296962 3300009098 Bacteria 1584
58 Ga0105245_10418348 3300009098 Bacteria 1343
59 Ga0105247_10435646 3300009101 Bacteria 942
60 Ga0114129_10001140 3300009147 Bacteria 35156
61 Ga0105243_10152187 3300009148 Bacteria 1986
62 Ga0105241_10000025 3300009174 Bacteria 132929
63 Ga0105248_10026136 3300009177 Bacteria 6494
64 Ga0105249_10176565 3300009553 Bacteria 2075
65 Ga0157338_1000515 3300012515 Bacteria 2318
66 Ga0157375_10087482 3300013308 Bacteria 3168
67 Ga0157375_10307188 3300013308 Bacteria 1750
68 Ga0157380_10329963 3300014326 Bacteria 1418
69 Ga0157379_10004561 3300014968 Bacteria 11881
70 Ga0163161_10172762 3300017792 Bacteria 1653
71 Ga0207685_10020034 3300025905 Bacteria 2215
72 Ga0207705_10081444 3300025909 Bacteria 2359
73 Ga0207654_10001593 3300025911 Bacteria 11917
74 Ga0207657_10089778 3300025919 Bacteria 2566
75 Ga0207649_10199959 3300025920 Bacteria 1411
76 Ga0207681_10247135 3300025923 Bacteria 1391
77 Ga0207681_10399369 3300025923 Bacteria 1110
78 Ga0207669_10162132 3300025937 Bacteria 1581
79 Ga0207669_10169825 3300025937 Bacteria 1551
80 Ga0207704_10076199 3300025938 Bacteria 2148
81 Ga0207711_10052411 3300025941 Bacteria 3497
82 Ga0207689_10089107 3300025942 Bacteria 2534
83 Ga0207679_10134159 3300025945 Bacteria 1991
84 Ga0207667_10203751 3300025949 Bacteria 2029
85 Ga0207668_10033763 3300025972 Bacteria 3391
86 Ga0207703_10001365 3300026035 Bacteria 22286
87 Ga0207703_10281624 3300026035 Bacteria 1510
88 Ga0207678_10003469 3300026067 Bacteria 14194
89 Ga0207678_10150333 3300026067 Bacteria 1988
90 Ga0207641_10511790 3300026088 Bacteria 1167
91 Ga0207648_10078664 3300026089 Bacteria 2877
92 Ga0207676_10294320 3300026095 Bacteria 1480
93 Ga0207674_10216576 3300026116 Bacteria 1863
94 Ga0207683_10140987 3300026121 Bacteria 2172
95 Ga0207428_10031860 3300027907 Bacteria 4343
96 Ga0268264_10548546 3300028381 Bacteria 1133
97 Ga0265334_10049658 3300028573 Bacteria 1613
98 Ga0307515_10216307 3300028794 Bacteria 1746
99 Ga0307509_10170896 3300031507 Bacteria 2053
100 Ga0307408_100171189 3300031548 Bacteria 1734
101 Ga0307408_100200785 3300031548 Bacteria 1614
102 Ga0307405_10108050 3300031731 Bacteria 1879
103 Ga0307518_10002383 3300031838 Bacteria 13720
104 Ga0307410_10025943 3300031852 Bacteria 3682
105 Ga0307410_10345802 3300031852 Bacteria 1187
106 Ga0307406_10234253 3300031901 Bacteria 1373
107 Ga0307406_10255989 3300031901 Bacteria 1321
108 Ga0307406_10463662 3300031901 Bacteria 1019
109 Ga0307407_10092488 3300031903 Bacteria 1857
110 Ga0307407_10314949 3300031903 Bacteria 1096
111 Ga0307409_100004746 3300031995 Bacteria 7699
112 Ga0307409_100019721 3300031995 Bacteria 4575
113 Ga0307409_100034185 3300031995 Bacteria 3709
114 Ga0307409_100419039 3300031995 Bacteria 1284
115 Ga0307416_100040873 3300032002 Bacteria 3607
116 Ga0307416_100134520 3300032002 Bacteria 2233
117 Ga0307416_100200207 3300032002 Bacteria 1894
118 Ga0307416_100313685 3300032002 Bacteria 1566
119 Ga0307416_100607318 3300032002 Bacteria 1174
120 Ga0307416_100744067 3300032002 Bacteria 1072
121 Ga0307414_10055826 3300032004 Bacteria 2767
122 Ga0307411_10068468 3300032005 Bacteria 2393
123 Ga0307415_100057535 3300032126 Bacteria 2672
124 Ga0307415_100112304 3300032126 Bacteria 2025
125 Ga0307415_100115839 3300032126 Bacteria 1998
126 Ga0307415_100461149 3300032126 Bacteria 1101
127 Ga0373956_0000445 3300035119 Bacteria 16853
128 Ga0395900_0087283 3300037418 Bacteria 3206
129 Ga0436364_1033735 3300037853 Bacteria 2411
130 Ga0395901_0025372 3300038443 Bacteria 6085
131 Ga0436365_0189744 3300039437 Bacteria 1412
132 Ga0436365_1491969 3300039437 Bacteria 1686
133 Ga0450888_011078 3300042126 Bacteria 1053
134 Ga0451577_0222656 3300042876 Bacteria 1705
135 Ga0466969_0100518 3300044656 Bacteria 1362
136 Ga0453683_0147501 3300044673 Bacteria 1486
137 Ga0466965_0172270 3300044683 Bacteria 1139
138 Ga0466961_0005725 3300044693 Bacteria 7863
139 Ga0466961_0101810 3300044693 Bacteria 1809
140 Ga0466963_0011421 3300044694 Bacteria 5408
141 Ga0466963_0057851 3300044694 Bacteria 2583
142 Ga0466963_0060747 3300044694 Bacteria 2525
143 Ga0466963_0187002 3300044694 Bacteria 1447
144 Ga0466963_0211899 3300044694 Bacteria 1356
145 Ga0453684_0208815 3300044712 Bacteria 2271
146 Ga0466971_0031871 3300044719 Bacteria 2361
147 Ga0466970_0003051 3300044765 Bacteria 8127
148 Ga0466970_0046885 3300044765 Bacteria 2302
149 Ga0466970_0062916 3300044765 Bacteria 1990
150 Ga0466957_0004831 3300044842 Bacteria 7538
151 Ga0466957_0031065 3300044842 Bacteria 3191
152 Ga0466957_0088080 3300044842 Bacteria 1942
153 Ga0466960_0032113 3300044901 Bacteria 2428
154 Ga0466960_0065315 3300044901 Bacteria 1797
155 Ga0466960_0133772 3300044901 Bacteria 1311
156 Ga0466959_0043752 3300045049 Bacteria 3300
157 Ga0466959_0057617 3300045049 Bacteria 2832
158 Ga0466959_0060915 3300045049 Bacteria 2745
159 Ga0451576_0637338 3300045051 Bacteria 1120
160 Ga0466958_0142893 3300045836 Bacteria 1507
161 Ga0466967_0029542 3300045976 Bacteria 4589
162 Ga0466967_0034165 3300045976 Bacteria 4313
163 Ga0466967_0073044 3300045976 Bacteria 3076
164 Ga0466967_0348723 3300045976 Bacteria 1432
165 Ga0495603_0166579 3300046455 Bacteria 1277
166 Ga0495603_0233478 3300046455 Bacteria 1060
167 Ga0495629_0236312 3300046459 Bacteria 1259
168 Ga0495594_0026710 3300046499 Bacteria 3108
169 Ga0495606_0001741 3300046507 Bacteria 27951
170 Ga0495644_0018226 3300046523 Bacteria 2682
171 Ga0495644_0099459 3300046523 Bacteria 1100
172 Ga0495663_0070976 3300046525 Bacteria 1109
173 Ga0495621_0110231 3300046539 Bacteria 1055
174 Ga0495667_0008715 3300046559 Bacteria 6888
175 Ga0495668_0000642 3300046616 Bacteria 42122
176 Ga0495625_0001727 3300046660 Bacteria 25329
177 Ga0495659_0000163 3300046664 Bacteria 29791
178 Ga0495647_0024948 3300046681 Bacteria 2180
179 Ga0495672_0190142 3300047320 Bacteria 1033
180 Ga0495676_0154731 3300047321 Bacteria 1628
181 Ga0495676_0412964 3300047321 Bacteria 894
182 Ga0495626_0000455 3300048091 Bacteria 41789
183 Ga0496100_0058259 3300048903 Bacteria 2534
184 Ga0496101_0135655 3300048904 Bacteria 1872
185 Ga0496102_0224618 3300048905 Bacteria 1770
186 Ga0496102_0720376 3300048905 Bacteria 920
187 Ga0496103_0135719 3300048906 Bacteria 1572
188 Ga0496105_0037622 3300048908 Bacteria 3985
189 Ga0496106_0061948 3300048909 Bacteria 2840
190 Ga0496108_0132732 3300048911 Bacteria 2140
191 Ga0496108_0178740 3300048911 Bacteria 1837
192 Ga0496109_0124638 3300048912 Bacteria 2401
193 Ga0496109_0183462 3300048912 Bacteria 1966
194 Ga0496109_0714655 3300048912 Bacteria 939
195 Ga0496111_0104659 3300048914 Bacteria 2082
196 Ga0496114_0124665 3300048917 Bacteria 2219
197 Ga0501075_0267839 3300049591 Bacteria 1302
198 nmdc:mga05p37_5256_c1 3300050507 Bacteria 15194
199 nmdc:mga09592_164587_c1 3300050508 Bacteria 1916
200 nmdc:mga06r32_468489_c1 3300050510 Bacteria 1238
201 nmdc:mga08y16_115958_c1 3300050511 Bacteria 2788
202 nmdc:mga08y16_4274_c1 3300050511 Bacteria 14909
203 nmdc:mga0a205_98466_c1 3300050515 Bacteria 2823
204 Ga0466962_0096253 3300061719 Bacteria 1419
205 2623499300 2622736605 Bacteria 4992138
206 2809593517 2808606522 Bacteria 9488490
207 2837274909 2837268691 Bacteria 7850704
208 Ga0466963_0377479
209 Ga0070658_10053589
210 Ga0070683_100161592
211 Ga0070683_100263709
212 Ga0070690_100178642
213 Ga0070680_100221228
214 Ga0070682_100283010
215 Ga0068868_100107503
216 Ga0070660_100136798
217 Ga0070660_100193149
218 Ga0070687_100064973
219 Ga0070668_100005265
220 Ga0070668_100296327
221 Ga0070669_100272698
222 Ga0070669_100485160
223 Ga0070673_100258568
224 Ga0070688_100073656
225 Ga0070659_100110088
226 Ga0070714_100170830
227 Ga0070701_10150647
228 Ga0070705_100004945
229 Ga0070705_100186134
230 Ga0070700_100269271
231 Ga0070694_100122042
232 Ga0070708_100163019
233 Ga0070663_100004226
234 Ga0068867_100140252
235 Ga0070685_10014338
236 Ga0070698_100026895
237 Ga0070684_100074184
238 Ga0070695_100166970
239 Ga0070696_100058082
240 Ga0070696_100171785
241 Ga0070664_100194463
242 Ga0068859_100057996
243 Ga0068859_100142878
244 Ga0068864_100333057
245 Ga0068864_100394865
246 Ga0068863_100585744
247 Ga0068858_100001270
248 Ga0081455_10022720
249 Ga0070715_10073180
250 Ga0070712_100213650
251 Ga0075430_100105048
252 Ga0075433_10018006
253 Ga0075433_10069008
254 Ga0075429_100189684
255 Ga0068865_100076598
256 Ga0075436_100154299
257 Ga0097620_100057998
258 Ga0097620_100142881
259 Ga0075435_100105610
260 Ga0111539_10001707
261 Ga0111539_10131199
262 Ga0105245_10077483
263 Ga0105245_10269572
264 Ga0105245_10296962
265 Ga0105245_10418348
266 Ga0105247_10435646
267 Ga0114129_10001140
268 Ga0105243_10152187
269 Ga0105241_10000025
270 Ga0105248_10026136
271 Ga0105249_10176565
272 Ga0157338_1000515
273 Ga0157375_10087482
274 Ga0157375_10307188
275 Ga0157380_10329963
276 Ga0157379_10004561
277 Ga0163161_10172762
278 Ga0207685_10020034
279 Ga0207705_10081444
280 Ga0207654_10001593
281 Ga0207657_10089778
282 Ga0207649_10199959
283 Ga0207681_10247135
284 Ga0207681_10399369
285 Ga0207669_10162132
286 Ga0207669_10169825
287 Ga0207704_10076199
288 Ga0207711_10052411
289 Ga0207689_10089107
290 Ga0207679_10134159
291 Ga0207667_10203751
292 Ga0207668_10033763
293 Ga0207703_10001365
294 Ga0207703_10281624
295 Ga0207678_10003469
296 Ga0207678_10150333
297 Ga0207641_10511790
298 Ga0207648_10078664
299 Ga0207676_10294320
300 Ga0207674_10216576
301 Ga0207683_10140987
302 Ga0207428_10031860
303 Ga0268264_10548546
304 Ga0265334_10049658
305 Ga0307515_10216307
306 Ga0307509_10170896
307 Ga0307408_100171189
308 Ga0307408_100200785
309 Ga0307405_10108050
310 Ga0307518_10002383
311 Ga0307410_10025943
312 Ga0307410_10345802
313 Ga0307406_10234253
314 Ga0307406_10255989
315 Ga0307406_10463662
316 Ga0307407_10092488
317 Ga0307407_10314949
318 Ga0307409_100004746
319 Ga0307409_100019721
320 Ga0307409_100034185
321 Ga0307409_100419039
322 Ga0307416_100040873
323 Ga0307416_100134520
324 Ga0307416_100200207
325 Ga0307416_100313685
326 Ga0307416_100607318
327 Ga0307416_100744067
328 Ga0307414_10055826
329 Ga0307411_10068468
330 Ga0307415_100057535
331 Ga0307415_100112304
332 Ga0307415_100115839
333 Ga0307415_100461149
334 Ga0373956_0000445
335 Ga0395900_0087283
336 Ga0436364_1033735
337 Ga0395901_0025372
338 Ga0436365_0189744
339 Ga0436365_1491969
340 Ga0450888_011078
341 Ga0451577_0222656
342 Ga0466969_0100518
343 Ga0453683_0147501
344 Ga0466965_0172270
345 Ga0466961_0005725
346 Ga0466961_0101810
347 Ga0466963_0011421
348 Ga0466963_0057851
349 Ga0466963_0060747
350 Ga0466963_0187002
351 Ga0466963_0211899
352 Ga0453684_0208815
353 Ga0466971_0031871
354 Ga0466970_0003051
355 Ga0466970_0046885
356 Ga0466970_0062916
357 Ga0466957_0004831
358 Ga0466957_0031065
359 Ga0466957_0088080
360 Ga0466960_0032113
361 Ga0466960_0065315
362 Ga0466960_0133772
363 Ga0466959_0043752
364 Ga0466959_0057617
365 Ga0466959_0060915
366 Ga0451576_0637338
367 Ga0466958_0142893
368 Ga0466967_0029542
369 Ga0466967_0034165
370 Ga0466967_0073044
371 Ga0466967_0348723
372 Ga0495603_0166579
373 Ga0495603_0233478
374 Ga0495629_0236312
375 Ga0495594_0026710
376 Ga0495606_0001741
377 Ga0495644_0018226
378 Ga0495644_0099459
379 Ga0495663_0070976
380 Ga0495621_0110231
381 Ga0495667_0008715
382 Ga0495668_0000642
383 Ga0495625_0001727
384 Ga0495659_0000163
385 Ga0495647_0024948
386 Ga0495672_0190142
387 Ga0495676_0154731
388 Ga0495676_0412964
389 Ga0495626_0000455
390 Ga0496100_0058259
391 Ga0496101_0135655
392 Ga0496102_0224618
393 Ga0496102_0720376
394 Ga0496103_0135719
395 Ga0496105_0037622
396 Ga0496106_0061948
397 Ga0496108_0132732
398 Ga0496108_0178740
399 Ga0496109_0124638
400 Ga0496109_0183462
401 Ga0496109_0714655
402 Ga0496111_0104659
403 Ga0496114_0124665
404 Ga0501075_0267839
405 nmdc:mga05p37_5256_c1
406 nmdc:mga09592_164587_c1
407 nmdc:mga06r32_468489_c1
408 nmdc:mga08y16_115958_c1
409 nmdc:mga08y16_4274_c1
410 nmdc:mga0a205_98466_c1
411 Ga0466962_0096253
412 2623499300
413 2809593517
414 2837274909

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02569

Pantoate_ligase

Pantoate-beta-alanine ligase

25

297

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ejc-assembly1.cif.gz_A-2 crystal structure of pantoate--beta-alanine ligase (panc) from thermotoga maritima 0.9722 1 280
3mxt-assembly1.cif.gz_A crystal structure of pantoate-beta-alanine ligase from campylobacter jejuni 0.9657 1 280
5ucr-assembly1.cif.gz_B crystal structure of a pantoate-beta-alanine ligase from neisseria gonorrhoeae with bound amppnp and alanine 0.9633 1 280
2x3f-assembly1.cif.gz_B crystal structure of the methicillin-resistant staphylococcus aureus sar2676, a pantothenate synthetase. 0.9628 1 280
2a86-assembly1.cif.gz_B crystal structure of a pantothenate synthetase complexed with amp and beta-alanine 0.9625 3 280
ID Description Score Start End Superfamily
3innA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.982 3 178 3.40.50.620
3imeB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9781 3 174 3.40.50.620
3innA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.971 3 178 3.40.50.620
3uy4A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9672 3 178 3.40.50.620
5hg0A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9599 3 178 3.40.50.620
ID Description Score Start End GO Terms
AF-A0A7S2CTR7-F1-model_v4 Pantoate--beta-alanine ligase (EC 6.3.2.1) (Pantoate-activating enzyme) (Pantothenate synthetase) 0.9976 119 214 GO:0004592
GO:0005524
GO:0015940
AF-A0A658NLZ5-F1-model_v4 pantoate--beta-alanine ligase (AMP-forming) (EC 6.3.2.1) (Pantoate-activating enzyme) 0.9906 129 212 GO:0004592
GO:0005524
GO:0005829
GO:0015940
AF-X1ITC4-F1-model_v4 Pantoate-activating enzyme 0.9871 1 180 GO:0004592
GO:0005524
GO:0005829
GO:0015940
AF-A0A536BM11-F1-model_v4 pantoate--beta-alanine ligase (AMP-forming) (EC 6.3.2.1) (Pantoate-activating enzyme) 0.9866 78 280 GO:0004592
GO:0005524
GO:0005829
GO:0015940
AF-A0A5C8BDN9-F1-model_v4 Pantoate--beta-alanine ligase (EC 6.3.2.1) 0.9861 1 186 GO:0004592
GO:0005524
GO:0005829
GO:0015940

Map