F316785

General Info

Members Datasets Scaffolds Average Seq Length
207 156 414 115

Family's Representative Sequence

Representative Sequence 3300041453|Ga0451797_1312372|Ga0451797_1312372_75_443
Length 122
Sequence MTTGLKTIIYPVKDLGQAKAVYGALLGGVDPVMDQAYYVQFNVGSTEVGLDPHGHTKGMTGPVSYWHVEDIKQTVAELLAAGAEVQAAVTEFGGRLVGSVRDADGNVIGLIQTTSDTTPNVG

Samples

Sample ID Description Type Environment
1 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
2 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
3 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
10 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
13 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
14 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
15 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
16 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
17 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
21 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
22 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
23 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
27 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
28 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
29 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
30 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
31 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
32 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
33 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
34 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
35 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
36 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
37 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
38 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
39 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
40 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
41 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
42 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
43 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
44 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
45 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
47 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
48 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
49 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
50 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
51 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
52 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
53 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
72 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
73 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
74 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
75 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
76 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
77 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
78 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
79 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
80 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
81 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
82 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
83 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
84 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
85 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
86 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
87 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
88 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
89 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
90 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
91 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
92 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
93 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
94 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
95 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
96 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
97 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
98 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
99 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
100 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
101 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
102 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
103 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
104 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
105 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
106 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
107 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
108 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
109 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
110 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
111 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
112 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
113 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
114 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
115 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
116 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
117 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
118 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
119 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
120 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
121 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
122 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
123 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
124 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
125 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
126 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
127 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
128 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
129 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
130 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
131 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
132 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
133 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
134 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
135 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
136 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
137 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
138 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
139 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
140 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
141 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
142 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
144 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
145 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
146 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
147 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
148 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
149 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
150 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
151 2643221711 Terrabacter sp. Root85 Isolate Unclassified
152 2818991458 Terrabacter sp. 3211 Isolate Rhizosphere
153 2818991462 Terrabacter sp. 3264 Isolate Rhizosphere
154 2818991469 Terrabacter lapilli 3265 Isolate Rhizosphere
155 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified
156 8053945823 Actinomadura terrae OS3-83 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.14
Metatranscriptomes 0.97
Isolates 2.9

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.48
Nodule 0
Rhizoplane 8.21
Rhizosphere 87.44
Stem 0
Stem Tuber 0
Unclassified 5.8

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451797_1312372 3300041453 Unclassified 556
2 Ga0006562J51391_1080056 3300003578 Bacteria 750
3 Ga0058862_12607129 3300004803 Unclassified 536
4 Ga0070658_10646931 3300005327 Bacteria 917
5 Ga0070683_100124982 3300005329 Bacteria 2431
6 Ga0070683_100185815 3300005329 Bacteria 1973
7 Ga0070683_101454618 3300005329 Bacteria 659
8 Ga0070680_100771236 3300005336 Bacteria 828
9 Ga0070682_100017975 3300005337 Bacteria 4125
10 Ga0070682_100112119 3300005337 Bacteria 1819
11 Ga0070682_100336425 3300005337 Bacteria 1121
12 Ga0070660_100390258 3300005339 Bacteria 1150
13 Ga0070660_101816806 3300005339 Bacteria 519
14 Ga0070659_100192842 3300005366 Bacteria 1675
15 Ga0070667_100012186 3300005367 Bacteria 7115
16 Ga0070713_100360409 3300005436 Bacteria 1351
17 Ga0070694_100376426 3300005444 Bacteria 1106
18 Ga0070708_100087019 3300005445 Bacteria 2839
19 Ga0070708_100211432 3300005445 Bacteria 1817
20 Ga0070663_100559220 3300005455 Bacteria 957
21 Ga0070706_100007474 3300005467 Bacteria 10244
22 Ga0070706_100464197 3300005467 Bacteria 1178
23 Ga0070707_100248519 3300005468 Bacteria 1731
24 Ga0070698_100007980 3300005471 Bacteria 11447
25 Ga0070679_101133044 3300005530 Bacteria 727
26 Ga0070684_100168617 3300005535 Bacteria 1988
27 Ga0070684_100178218 3300005535 Bacteria 1932
28 Ga0070697_100419341 3300005536 Bacteria 1163
29 Ga0068853_101643976 3300005539 Bacteria 622
30 Ga0068853_101900515 3300005539 Bacteria 577
31 Ga0070672_100557459 3300005543 Bacteria 995
32 Ga0070696_100402193 3300005546 Bacteria 1071
33 Ga0070665_100110686 3300005548 Bacteria 2749
34 Ga0068855_100031416 3300005563 Bacteria 6341
35 Ga0070664_100559594 3300005564 Bacteria 1058
36 Ga0068856_100213356 3300005614 Bacteria 1945
37 Ga0070702_101346991 3300005615 Unclassified 581
38 Ga0068852_100023070 3300005616 Bacteria 5002
39 Ga0068861_101512375 3300005719 Bacteria 659
40 Ga0068860_101192837 3300005843 Bacteria 781
41 Ga0068862_102626778 3300005844 Unclassified 515
42 Ga0081455_10109086 3300005937 Unclassified 2203
43 Ga0081455_10140798 3300005937 Bacteria 1874
44 Ga0081538_10011353 3300005981 Bacteria 7224
45 Ga0081539_10026136 3300005985 Bacteria 3737
46 Ga0075363_100361320 3300006048 Bacteria 849
47 Ga0075428_100038141 3300006844 Bacteria 5288
48 Ga0075430_100079925 3300006846 Bacteria 2739
49 Ga0075430_100743431 3300006846 Bacteria 808
50 Ga0075431_100122378 3300006847 Bacteria 2684
51 Ga0075431_100225267 3300006847 Bacteria 1912
52 Ga0075431_100335754 3300006847 Bacteria 1521
53 Ga0075429_100406832 3300006880 Bacteria 1192
54 Ga0075435_101079080 3300007076 Bacteria 702
55 Ga0099794_10208200 3300007265 Bacteria 1003
56 Ga0099795_10186186 3300007788 Bacteria 869
57 Ga0105251_10035766 3300009011 Bacteria 2448
58 Ga0114129_10122218 3300009147 Bacteria 3583
59 Ga0114129_10609774 3300009147 Bacteria 1413
60 Ga0105243_12441450 3300009148 Bacteria 561
61 Ga0105239_10650424 3300010375 Bacteria 1204
62 Ga0105239_12198806 3300010375 Bacteria 641
63 Ga0105246_11073752 3300011119 Bacteria 733
64 Ga0157370_10054382 3300013104 Bacteria 3816
65 Ga0157372_10000023 3300013307 Bacteria 198536
66 Ga0157372_10766948 3300013307 Bacteria 1121
67 Ga0163163_10294442 3300014325 Bacteria 1675
68 Ga0213876_10077424 3300021384 Bacteria 1757
69 Ga0207643_10862009 3300025908 Bacteria 587
70 Ga0207684_10366284 3300025910 Bacteria 1240
71 Ga0207657_10432114 3300025919 Bacteria 1034
72 Ga0207652_11733795 3300025921 Bacteria 529
73 Ga0207646_10664993 3300025922 Bacteria 933
74 Ga0207690_10309861 3300025932 Bacteria 1238
75 Ga0207709_11550032 3300025935 Bacteria 550
76 Ga0207691_11502418 3300025940 Unclassified 551
77 Ga0207661_10429767 3300025944 Bacteria 1200
78 Ga0207679_10183164 3300025945 Bacteria 1734
79 Ga0207667_10610828 3300025949 Bacteria 1099
80 Ga0207658_10011362 3300025986 Bacteria 6059
81 Ga0207677_11270125 3300026023 Bacteria 676
82 Ga0207639_11838671 3300026041 Bacteria 566
83 Ga0207702_10061766 3300026078 Bacteria 3197
84 Ga0207675_101313312 3300026118 Bacteria 744
85 Ga0207698_10214760 3300026142 Bacteria 1733
86 Ga0268266_10105299 3300028379 Bacteria 2492
87 Ga0307513_10097704 3300031456 Bacteria 2971
88 Ga0307413_10029748 3300031824 Bacteria 3061
89 Ga0307413_10212380 3300031824 Archaea 1407
90 Ga0307410_11091840 3300031852 Bacteria 691
91 Ga0307406_10114080 3300031901 Bacteria 1866
92 Ga0307407_10056414 3300031903 Bacteria 2274
93 Ga0307407_10841977 3300031903 Bacteria 700
94 Ga0307407_11030988 3300031903 Bacteria 637
95 Ga0307407_11078586 3300031903 Unclassified 623
96 Ga0307409_100508996 3300031995 Bacteria 1174
97 Ga0307409_100521752 3300031995 Bacteria 1161
98 Ga0307409_100601803 3300031995 Bacteria 1086
99 Ga0307409_101199435 3300031995 Bacteria 782
100 Ga0307409_101461040 3300031995 Unclassified 711
101 Ga0307409_102066093 3300031995 Bacteria 599
102 Ga0307416_100010039 3300032002 Bacteria 6236
103 Ga0307416_101387619 3300032002 Bacteria 808
104 Ga0307416_101427632 3300032002 Bacteria 798
105 Ga0307416_101436904 3300032002 Unclassified 795
106 Ga0307416_103790348 3300032002 Bacteria 506
107 Ga0307414_10033766 3300032004 Bacteria 3385
108 Ga0307414_10393925 3300032004 Unclassified 1201
109 Ga0307414_10521286 3300032004 Bacteria 1055
110 Ga0307411_11981919 3300032005 Bacteria 543
111 Ga0307415_100032944 3300032126 Bacteria 3358
112 Ga0307415_100086359 3300032126 Viruses 2257
113 Ga0307415_100146601 3300032126 Bacteria 1811
114 Ga0307415_100510267 3300032126 Bacteria 1053
115 Ga0373944_0245471 3300035089 Bacteria 660
116 Ga0373936_0219071 3300035113 Bacteria 844
117 Ga0373943_0715791 3300035170 Bacteria 594
118 Ga0373931_0400722 3300035691 Bacteria 869
119 Ga0373935_0531762 3300035692 Bacteria 856
120 Ga0373947_0259777 3300035725 Bacteria 1150
121 Ga0436365_0712208 3300039437 Bacteria 6740
122 Ga0451800_0106221 3300041459 Bacteria 572
123 Ga0451804_1046273 3300041463 Bacteria 543
124 Ga0451853_2646900 3300041512 Bacteria 573
125 Ga0451853_3909192 3300041512 Bacteria 715
126 Ga0466972_0014568 3300044658 Bacteria 3937
127 Ga0466961_0133645 3300044693 Bacteria 1555
128 Ga0466970_0269610 3300044765 Bacteria 956
129 Ga0466960_0129421 3300044901 Bacteria 1330
130 Ga0466967_1461913 3300045976 Bacteria 681
131 Ga0495603_0320269 3300046455 Bacteria 890
132 Ga0495582_0787161 3300046473 Bacteria 550
133 Ga0495630_0704664 3300046517 Bacteria 772
134 Ga0495665_0198568 3300046531 Bacteria 1040
135 Ga0495659_0243629 3300046664 Bacteria 748
136 Ga0495588_0117168 3300046674 Bacteria 1404
137 Ga0495613_0083769 3300046689 Bacteria 2316
138 Ga0495636_0426206 3300047318 Bacteria 635
139 Ga0495614_0296431 3300048089 Bacteria 747
140 Ga0496102_0216322 3300048905 Bacteria 1806
141 Ga0496102_0344084 3300048905 Bacteria 1404
142 Ga0496103_0305257 3300048906 Bacteria 1024
143 Ga0496106_0210007 3300048909 Bacteria 1551
144 Ga0496107_0776842 3300048910 Bacteria 702
145 Ga0496108_0291545 3300048911 Bacteria 1421
146 Ga0496109_0691572 3300048912 Bacteria 957
147 Ga0496109_0854133 3300048912 Bacteria 848
148 Ga0496110_0180409 3300048913 Unclassified 1917
149 Ga0496110_0367311 3300048913 Bacteria 1311
150 Ga0496111_0256235 3300048914 Bacteria 1298
151 Ga0496111_0319491 3300048914 Bacteria 1150
152 Ga0496113_0073549 3300048916 Bacteria 2604
153 Ga0496113_0322385 3300048916 Bacteria 1238
154 Ga0501031_0016042 3300049568 Bacteria 4863
155 Ga0501032_0051447 3300049569 Bacteria 2777
156 Ga0501033_0026965 3300049570 Bacteria 4321
157 Ga0501034_0011995 3300049571 Bacteria 8954
158 Ga0501034_0278125 3300049571 Bacteria 1614
159 Ga0501036_0036995 3300049572 Bacteria 4128
160 Ga0501037_0005867 3300049573 Bacteria 8972
161 Ga0501038_0039482 3300049574 Bacteria 4128
162 Ga0501038_0521112 3300049574 Bacteria 907
163 Ga0501039_0054048 3300049575 Bacteria 3108
164 Ga0501040_0021705 3300049576 Bacteria 4291
165 Ga0501041_0002418 3300049577 Bacteria 10582
166 Ga0501042_0065930 3300049578 Bacteria 2587
167 Ga0501043_0006057 3300049579 Bacteria 9719
168 Ga0501046_0023865 3300049580 Bacteria 5023
169 Ga0501047_0009981 3300049581 Bacteria 8974
170 Ga0501048_0038594 3300049582 Bacteria 3426
171 Ga0501067_0001501 3300049583 Bacteria 12712
172 Ga0501067_0083341 3300049583 Bacteria 1774
173 Ga0501068_0002784 3300049584 Bacteria 9296
174 Ga0501068_0574552 3300049584 Bacteria 734
175 Ga0501069_0013947 3300049585 Bacteria 4291
176 Ga0501069_0355239 3300049585 Bacteria 864
177 Ga0501070_0034439 3300049586 Bacteria 4234
178 Ga0501071_0024198 3300049587 Bacteria 4245
179 Ga0501072_0004754 3300049588 Bacteria 10338
180 Ga0501073_0012236 3300049589 Bacteria 6262
181 Ga0501074_0130407 3300049590 Bacteria 1798
182 Ga0501076_0047703 3300049592 Bacteria 3386
183 Ga0501233_127989 3300049668 Unclassified 692
184 Ga0501079_0006691 3300049741 Bacteria 8671
185 Ga0501080_0028159 3300049742 Bacteria 5224
186 Ga0501083_0015910 3300049744 Bacteria 5266
187 Ga0501035_0033027 3300049822 Bacteria 4705
188 Ga0501035_0255903 3300049822 Bacteria 1485
189 Ga0501044_0015433 3300049823 Bacteria 8227
190 Ga0501044_0042752 3300049823 Bacteria 4711
191 Ga0501044_0238048 3300049823 Bacteria 1765
192 Ga0501045_0011934 3300049824 Bacteria 6106
193 nmdc:mga05p37_1001320_c1 3300050507 Bacteria 888
194 nmdc:mga05p37_228274_c1 3300050507 Bacteria 2244
195 nmdc:mga05p37_83719_c1 3300050507 Bacteria 3929
196 nmdc:mga0qj67_57809_c1 3300050509 Bacteria 3075
197 nmdc:mga06r32_134315_c1 3300050510 Bacteria 2449
198 nmdc:mga06r32_828048_c1 3300050510 Bacteria 885
199 Ga0501084_0014372 3300054114 Bacteria 6560
200 Ga0501082_0005215 3300060353 Bacteria 11299
201 Ga0466962_0459695 3300061719 Bacteria 642
202 2644608171 2643221711 Bacteria 4865335
203 2819664571 2818991458 Bacteria 4794049
204 2819689699 2818991462 Bacteria 4320267
205 2819726746 2818991469 Bacteria 4644110
206 3003003408 3002998708 Bacteria 11715108
207 8053952111 8053945823 Bacteria 8962862
208 Ga0451797_1312372
209 Ga0006562J51391_1080056
210 Ga0058862_12607129
211 Ga0070658_10646931
212 Ga0070683_100124982
213 Ga0070683_100185815
214 Ga0070683_101454618
215 Ga0070680_100771236
216 Ga0070682_100017975
217 Ga0070682_100112119
218 Ga0070682_100336425
219 Ga0070660_100390258
220 Ga0070660_101816806
221 Ga0070659_100192842
222 Ga0070667_100012186
223 Ga0070713_100360409
224 Ga0070694_100376426
225 Ga0070708_100087019
226 Ga0070708_100211432
227 Ga0070663_100559220
228 Ga0070706_100007474
229 Ga0070706_100464197
230 Ga0070707_100248519
231 Ga0070698_100007980
232 Ga0070679_101133044
233 Ga0070684_100168617
234 Ga0070684_100178218
235 Ga0070697_100419341
236 Ga0068853_101643976
237 Ga0068853_101900515
238 Ga0070672_100557459
239 Ga0070696_100402193
240 Ga0070665_100110686
241 Ga0068855_100031416
242 Ga0070664_100559594
243 Ga0068856_100213356
244 Ga0070702_101346991
245 Ga0068852_100023070
246 Ga0068861_101512375
247 Ga0068860_101192837
248 Ga0068862_102626778
249 Ga0081455_10109086
250 Ga0081455_10140798
251 Ga0081538_10011353
252 Ga0081539_10026136
253 Ga0075363_100361320
254 Ga0075428_100038141
255 Ga0075430_100079925
256 Ga0075430_100743431
257 Ga0075431_100122378
258 Ga0075431_100225267
259 Ga0075431_100335754
260 Ga0075429_100406832
261 Ga0075435_101079080
262 Ga0099794_10208200
263 Ga0099795_10186186
264 Ga0105251_10035766
265 Ga0114129_10122218
266 Ga0114129_10609774
267 Ga0105243_12441450
268 Ga0105239_10650424
269 Ga0105239_12198806
270 Ga0105246_11073752
271 Ga0157370_10054382
272 Ga0157372_10000023
273 Ga0157372_10766948
274 Ga0163163_10294442
275 Ga0213876_10077424
276 Ga0207643_10862009
277 Ga0207684_10366284
278 Ga0207657_10432114
279 Ga0207652_11733795
280 Ga0207646_10664993
281 Ga0207690_10309861
282 Ga0207709_11550032
283 Ga0207691_11502418
284 Ga0207661_10429767
285 Ga0207679_10183164
286 Ga0207667_10610828
287 Ga0207658_10011362
288 Ga0207677_11270125
289 Ga0207639_11838671
290 Ga0207702_10061766
291 Ga0207675_101313312
292 Ga0207698_10214760
293 Ga0268266_10105299
294 Ga0307513_10097704
295 Ga0307413_10029748
296 Ga0307413_10212380
297 Ga0307410_11091840
298 Ga0307406_10114080
299 Ga0307407_10056414
300 Ga0307407_10841977
301 Ga0307407_11030988
302 Ga0307407_11078586
303 Ga0307409_100508996
304 Ga0307409_100521752
305 Ga0307409_100601803
306 Ga0307409_101199435
307 Ga0307409_101461040
308 Ga0307409_102066093
309 Ga0307416_100010039
310 Ga0307416_101387619
311 Ga0307416_101427632
312 Ga0307416_101436904
313 Ga0307416_103790348
314 Ga0307414_10033766
315 Ga0307414_10393925
316 Ga0307414_10521286
317 Ga0307411_11981919
318 Ga0307415_100032944
319 Ga0307415_100086359
320 Ga0307415_100146601
321 Ga0307415_100510267
322 Ga0373944_0245471
323 Ga0373936_0219071
324 Ga0373943_0715791
325 Ga0373931_0400722
326 Ga0373935_0531762
327 Ga0373947_0259777
328 Ga0436365_0712208
329 Ga0451800_0106221
330 Ga0451804_1046273
331 Ga0451853_2646900
332 Ga0451853_3909192
333 Ga0466972_0014568
334 Ga0466961_0133645
335 Ga0466970_0269610
336 Ga0466960_0129421
337 Ga0466967_1461913
338 Ga0495603_0320269
339 Ga0495582_0787161
340 Ga0495630_0704664
341 Ga0495665_0198568
342 Ga0495659_0243629
343 Ga0495588_0117168
344 Ga0495613_0083769
345 Ga0495636_0426206
346 Ga0495614_0296431
347 Ga0496102_0216322
348 Ga0496102_0344084
349 Ga0496103_0305257
350 Ga0496106_0210007
351 Ga0496107_0776842
352 Ga0496108_0291545
353 Ga0496109_0691572
354 Ga0496109_0854133
355 Ga0496110_0180409
356 Ga0496110_0367311
357 Ga0496111_0256235
358 Ga0496111_0319491
359 Ga0496113_0073549
360 Ga0496113_0322385
361 Ga0501031_0016042
362 Ga0501032_0051447
363 Ga0501033_0026965
364 Ga0501034_0011995
365 Ga0501034_0278125
366 Ga0501036_0036995
367 Ga0501037_0005867
368 Ga0501038_0039482
369 Ga0501038_0521112
370 Ga0501039_0054048
371 Ga0501040_0021705
372 Ga0501041_0002418
373 Ga0501042_0065930
374 Ga0501043_0006057
375 Ga0501046_0023865
376 Ga0501047_0009981
377 Ga0501048_0038594
378 Ga0501067_0001501
379 Ga0501067_0083341
380 Ga0501068_0002784
381 Ga0501068_0574552
382 Ga0501069_0013947
383 Ga0501069_0355239
384 Ga0501070_0034439
385 Ga0501071_0024198
386 Ga0501072_0004754
387 Ga0501073_0012236
388 Ga0501074_0130407
389 Ga0501076_0047703
390 Ga0501233_127989
391 Ga0501079_0006691
392 Ga0501080_0028159
393 Ga0501083_0015910
394 Ga0501035_0033027
395 Ga0501035_0255903
396 Ga0501044_0015433
397 Ga0501044_0042752
398 Ga0501044_0238048
399 Ga0501045_0011934
400 nmdc:mga05p37_1001320_c1
401 nmdc:mga05p37_228274_c1
402 nmdc:mga05p37_83719_c1
403 nmdc:mga0qj67_57809_c1
404 nmdc:mga06r32_134315_c1
405 nmdc:mga06r32_828048_c1
406 Ga0501084_0014372
407 Ga0501082_0005215
408 Ga0466962_0459695
409 2644608171
410 2819664571
411 2819689699
412 2819726746
413 3003003408
414 8053952111

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
3rhe-assembly1.cif.gz_A the crystal structure of nad-dependent benzaldehyde dehydrogenase from legionella pneumophila 0.8306 5 111
2r6u-assembly2.cif.gz_B crystal structure of gene product rha04853 from rhodococcus sp. rha1 0.8259 1 111
2r6u-assembly2.cif.gz_B crystal structure of gene product rha04853 from rhodococcus sp. rha1 0.8125 1 111
6xi3-assembly1.cif.gz_AAA crystal structure of tetra-tandem repeat in extending region of large adhesion protein 0.8121 94 111
2r6u-assembly2.cif.gz_D crystal structure of gene product rha04853 from rhodococcus sp. rha1 0.7997 2 111
ID Description Score Start End Superfamily
3sk1C01 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.9312 5 49 3.30.720.120
af_P9WKQ3_98_165_3.30.720.110 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.926 63 111 3.30.720.110
3itwA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8671 65 111 3.30.720.110
2kjzB01 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8654 1 49 3.30.720.120
2kjzB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8508 63 109 3.30.720.110
ID Description Score Start End GO Terms
AF-A0A4S8N8X5-F1-model_v4 Glyoxalase 0.9822 1 111
AF-A0A810LK08-F1-model_v4 deleted 0.98 3 112
AF-A0A2N3VUX6-F1-model_v4 Putative enzyme related to lactoylglutathione lyase 0.9798 1 112 GO:0016829
AF-A0A318K0Q1-F1-model_v4 Putative enzyme related to lactoylglutathione lyase 0.9764 1 112 GO:0016829
AF-A0A7K0C9N1-F1-model_v4 VOC domain-containing protein 0.9759 1 111

Map