F316264

General Info

Members Datasets Scaffolds Average Seq Length
207 116 207 143

Family's Representative Sequence

Representative Sequence 3300005981|Ga0081538_10000112|Ga0081538_1000011223
Length 169
Sequence LNSSEGPLACPRCATKYPLDERFCPECGMPLTYAGHGERKPITDRHERARKIKPQYTEGALVRVAGGRNQAEAEMIQGMLLEEGIPSMLRRTRGFDVPDFLAAGPRDVMVPAAGYEPARQVLLDAEMVSNGGEPEGLPGIGSPARLLTWVLIAVAGAAVLVWALYQISG

Samples

Sample ID Description Type Environment
1 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
5 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
6 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
7 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
8 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
9 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
10 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
11 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
12 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
13 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
14 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
15 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
16 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
17 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
18 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
19 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
20 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
21 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
22 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
23 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
24 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
25 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
26 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
27 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
28 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
29 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
30 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
31 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
32 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
33 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
34 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
35 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
36 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
52 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
53 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
54 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
55 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
56 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
57 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
58 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
59 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
60 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
61 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
62 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
63 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
64 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
65 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
66 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
67 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
68 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
69 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
70 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
71 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
72 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
73 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
74 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
75 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
76 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
77 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
78 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
79 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
80 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
81 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
82 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
83 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
84 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
85 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
86 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
87 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
88 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
89 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
90 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
91 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
92 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
93 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
94 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
95 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
96 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
97 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
98 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
99 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
100 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
101 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
102 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
103 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
104 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
105 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
106 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
107 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
108 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
109 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
110 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
111 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
112 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
113 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
114 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
115 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
116 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.97
Nodule 0
Rhizoplane 2.42
Rhizosphere 95.17
Stem 0
Stem Tuber 0
Unclassified 1.45

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25407J50210_10000241 3300003373 Bacteria 9571
2 JGI25407J50210_10003515 3300003373 Bacteria 3761
3 JGI25407J50210_10005113 3300003373 Bacteria 3216
4 JGI25407J50210_10008822 3300003373 Bacteria 2547
5 JGI25407J50210_10013508 3300003373 Bacteria 2100
6 JGI25407J50210_10014303 3300003373 Bacteria 2046
7 Ga0070676_10201830 3300005328 Bacteria 1304
8 Ga0070680_100583435 3300005336 Bacteria 959
9 Ga0070691_10028168 3300005341 Bacteria 2623
10 Ga0070692_10141678 3300005345 Bacteria 1361
11 Ga0070668_100190520 3300005347 Bacteria 1679
12 Ga0070669_100529179 3300005353 Bacteria 981
13 Ga0070669_100716042 3300005353 Bacteria 846
14 Ga0070659_100510066 3300005366 Bacteria 1026
15 Ga0070705_101133970 3300005440 Bacteria 641
16 Ga0070700_100100692 3300005441 Bacteria 1903
17 Ga0070700_100939298 3300005441 Bacteria 707
18 Ga0070662_100637739 3300005457 Bacteria 898
19 Ga0070681_10686203 3300005458 Bacteria 940
20 Ga0070696_100085279 3300005546 Bacteria 2242
21 Ga0070704_100670548 3300005549 Bacteria 917
22 Ga0070704_100854681 3300005549 Bacteria 816
23 Ga0068854_100218098 3300005578 Bacteria 1508
24 Ga0068854_100375857 3300005578 Bacteria 1170
25 Ga0068854_100651686 3300005578 Bacteria 904
26 Ga0070702_100058549 3300005615 Bacteria 2233
27 Ga0068861_100042392 3300005719 Bacteria 3410
28 Ga0068858_101066721 3300005842 Bacteria 793
29 Ga0081455_10008208 3300005937 Bacteria 10887
30 Ga0081538_10000018 3300005981 Bacteria 143542
31 Ga0081538_10000098 3300005981 Bacteria 84863
32 Ga0081538_10000112 3300005981 Bacteria 81614
33 Ga0081538_10000270 3300005981 Bacteria 59449
34 Ga0081538_10001442 3300005981 Bacteria 24442
35 Ga0081538_10001590 3300005981 Bacteria 23301
36 Ga0081538_10001806 3300005981 Bacteria 21581
37 Ga0081538_10030685 3300005981 Bacteria 3643
38 Ga0081538_10031052 3300005981 Bacteria 3613
39 Ga0081538_10033261 3300005981 Bacteria 3436
40 Ga0081538_10035997 3300005981 Bacteria 3240
41 Ga0075365_10105975 3300006038 Bacteria 1928
42 Ga0075432_10088742 3300006058 Bacteria 1130
43 Ga0075428_100130076 3300006844 Bacteria 2738
44 Ga0075428_100399214 3300006844 Bacteria 1474
45 Ga0075428_100547633 3300006844 Unclassified 1237
46 Ga0075430_100000024 3300006846 Bacteria 80210
47 Ga0075430_100014081 3300006846 Bacteria 6818
48 Ga0075430_100111161 3300006846 Bacteria 2285
49 Ga0075431_100601264 3300006847 Bacteria 1084
50 Ga0075431_100817187 3300006847 Bacteria 905
51 Ga0075431_101139835 3300006847 Bacteria 744
52 Ga0075429_100170549 3300006880 Bacteria 1906
53 Ga0111539_10001745 3300009094 Bacteria 28884
54 Ga0111539_10089518 3300009094 Bacteria 3617
55 Ga0105245_10023385 3300009098 Bacteria 5424
56 Ga0105247_10959259 3300009101 Bacteria 665
57 Ga0114129_10061899 3300009147 Bacteria 5230
58 Ga0114129_10405589 3300009147 Bacteria 1796
59 Ga0114129_10634273 3300009147 Bacteria 1381
60 Ga0114129_12246768 3300009147 Bacteria 656
61 Ga0105243_10983352 3300009148 Bacteria 845
62 Ga0105249_10003298 3300009553 Bacteria 13982
63 Ga0105239_10132888 3300010375 Bacteria 2769
64 Ga0157380_11050156 3300014326 Bacteria 851
65 Ga0157379_10005656 3300014968 Bacteria 10742
66 Ga0207692_10422678 3300025898 Bacteria 835
67 Ga0207645_10228862 3300025907 Bacteria 1227
68 Ga0207660_10833474 3300025917 Bacteria 753
69 Ga0207681_10549262 3300025923 Bacteria 951
70 Ga0207687_10054957 3300025927 Bacteria 2788
71 Ga0207690_10416833 3300025932 Bacteria 1074
72 Ga0207706_10018387 3300025933 Bacteria 6289
73 Ga0207712_10239081 3300025961 Bacteria 1462
74 Ga0207668_10099033 3300025972 Bacteria 2161
75 Ga0207640_10321573 3300025981 Bacteria 1232
76 Ga0207677_10494297 3300026023 Bacteria 1056
77 Ga0207703_11350814 3300026035 Bacteria 685
78 Ga0207708_10055097 3300026075 Bacteria 3031
79 Ga0207708_10195143 3300026075 Unclassified 1613
80 Ga0207648_10495639 3300026089 Unclassified 1117
81 Ga0207675_100000627 3300026118 Bacteria 34607
82 Ga0209983_1015255 3300027665 Bacteria 1584
83 Ga0207428_10027455 3300027907 Bacteria 4738
84 Ga0207428_10046634 3300027907 Bacteria 3485
85 Ga0307408_100060871 3300031548 Bacteria 2754
86 Ga0307408_100064686 3300031548 Unclassified 2680
87 Ga0307408_100289126 3300031548 Bacteria 1368
88 Ga0307408_100844932 3300031548 Bacteria 834
89 Ga0307405_10103766 3300031731 Bacteria 1912
90 Ga0307405_10642661 3300031731 Bacteria 871
91 Ga0307405_10717444 3300031731 Bacteria 830
92 Ga0307413_10018380 3300031824 Bacteria 3667
93 Ga0307413_10029270 3300031824 Bacteria 3079
94 Ga0307413_10643354 3300031824 Bacteria 874
95 Ga0307413_10942099 3300031824 Unclassified 736
96 Ga0307410_10013754 3300031852 Bacteria 4736
97 Ga0307410_10065235 3300031852 Bacteria 2504
98 Ga0307410_10079180 3300031852 Bacteria 2302
99 Ga0307406_10246820 3300031901 Bacteria 1342
100 Ga0307406_10255115 3300031901 Bacteria 1323
101 Ga0307406_10367945 3300031901 Bacteria 1129
102 Ga0307407_10098132 3300031903 Bacteria 1812
103 Ga0307412_10105619 3300031911 Bacteria 2001
104 Ga0307412_10408833 3300031911 Bacteria 1107
105 Ga0307409_100006490 3300031995 Bacteria 6880
106 Ga0307409_100085627 3300031995 Bacteria 2562
107 Ga0307409_100340866 3300031995 Bacteria 1410
108 Ga0307409_100643140 3300031995 Bacteria 1053
109 Ga0307409_101011516 3300031995 Unclassified 850
110 Ga0307416_100014256 3300032002 Bacteria 5437
111 Ga0307416_100014698 3300032002 Bacteria 5378
112 Ga0307416_100035494 3300032002 Bacteria 3809
113 Ga0307416_100168325 3300032002 Bacteria 2036
114 Ga0307416_100307124 3300032002 Bacteria 1580
115 Ga0307416_101454087 3300032002 Bacteria 791
116 Ga0307414_10339277 3300032004 Bacteria 1286
117 Ga0307414_11135954 3300032004 Bacteria 722
118 Ga0307411_10042758 3300032005 Bacteria 2894
119 Ga0307411_10086295 3300032005 Bacteria 2177
120 Ga0307411_10927970 3300032005 Bacteria 775
121 Ga0307415_100026976 3300032126 Bacteria 3632
122 Ga0307415_100123325 3300032126 Bacteria 1947
123 Ga0307415_100256154 3300032126 Bacteria 1425
124 Ga0307415_100327965 3300032126 Unclassified 1279
125 Ga0373959_0121126 3300034820 Bacteria 640
126 Ga0373940_0223635 3300035088 Bacteria 626
127 Ga0373939_0050248 3300035114 Bacteria 1292
128 Ga0373941_0078238 3300035115 Bacteria 1112
129 Ga0373960_0001929 3300035121 Bacteria 4648
130 Ga0395900_0377789 3300037418 Bacteria 1386
131 Ga0395900_0811273 3300037418 Bacteria 863
132 Ga0395905_0648318 3300037471 Bacteria 958
133 Ga0395901_0079644 3300038443 Bacteria 3421
134 Ga0395901_0139212 3300038443 Bacteria 2551
135 Ga0395901_0334249 3300038443 Bacteria 1566
136 Ga0395901_0492931 3300038443 Bacteria 1248
137 Ga0436365_0177016 3300039437 Bacteria 1047
138 Ga0439450_182505 3300042008 Bacteria 558
139 Ga0439463_064727 3300042016 Bacteria 935
140 Ga0439460_0065581 3300042461 Bacteria 1116
141 Ga0439460_0164374 3300042461 Bacteria 745
142 Ga0466965_0444544 3300044683 Bacteria 721
143 Ga0466971_0206051 3300044719 Bacteria 929
144 Ga0466968_0304820 3300044735 Bacteria 767
145 Ga0466959_0375622 3300045049 Bacteria 968
146 Ga0466967_0053795 3300045976 Bacteria 3540
147 Ga0466967_1098786 3300045976 Unclassified 792
148 Ga0466967_1302941 3300045976 Unclassified 723
149 Ga0495650_0000035 3300046471 Bacteria 403799
150 Ga0495584_0411334 3300046491 Unclassified 688
151 Ga0495620_0067079 3300046515 Bacteria 1477
152 Ga0495631_0314579 3300046518 Bacteria 666
153 Ga0495644_0107625 3300046523 Bacteria 1057
154 Ga0495669_0129394 3300046684 Bacteria 1188
155 Ga0495671_0124161 3300046692 Bacteria 1259
156 Ga0495677_0095110 3300047445 Bacteria 1125
157 Ga0495602_0797056 3300048088 Bacteria 635
158 Ga0496102_0298254 3300048905 Bacteria 1519
159 Ga0496102_0615893 3300048905 Bacteria 1009
160 Ga0496103_0266561 3300048906 Bacteria 1102
161 Ga0496109_0133409 3300048912 Bacteria 2319
162 Ga0496109_1100303 3300048912 Bacteria 732
163 Ga0496119_0145745 3300048922 Bacteria 1274
164 Ga0496121_0095672 3300048924 Bacteria 2307
165 Ga0501040_0199403 3300049576 Bacteria 1421
166 Ga0501040_0209644 3300049576 Bacteria 1385
167 Ga0501040_0518050 3300049576 Bacteria 860
168 Ga0501041_0404040 3300049577 Bacteria 865
169 Ga0501041_0414880 3300049577 Bacteria 853
170 Ga0501042_0338206 3300049578 Bacteria 1088
171 Ga0501042_0737221 3300049578 Unclassified 717
172 Ga0501067_0250413 3300049583 Unclassified 986
173 Ga0501071_1331491 3300049587 Bacteria 555
174 Ga0501075_0018550 3300049591 Bacteria 5037
175 Ga0501075_0065448 3300049591 Bacteria 2743
176 Ga0501216_015428 3300049660 Bacteria 1288
177 Ga0501079_0398764 3300049741 Bacteria 1079
178 Ga0501081_0163643 3300049743 Bacteria 1604
179 Ga0501081_0268102 3300049743 Bacteria 1248
180 Ga0501045_0062259 3300049824 Bacteria 2738
181 Ga0501045_0989682 3300049824 Bacteria 617
182 nmdc:mga0yw44_43186_c1 3300050492 Bacteria 2690
183 nmdc:mga05p37_1285777_c1 3300050507 Bacteria 747
184 nmdc:mga05p37_1593760_c1 3300050507 Bacteria 644
185 nmdc:mga05p37_1685_c1 3300050507 Bacteria 25708
186 nmdc:mga05p37_22083_c1 3300050507 Bacteria 7713
187 nmdc:mga05p37_271019_c1 3300050507 Bacteria 2028
188 nmdc:mga05p37_412732_c1 3300050507 Bacteria 1573
189 nmdc:mga09592_125791_c1 3300050508 Bacteria 2203
190 nmdc:mga09592_967290_c1 3300050508 Bacteria 713
191 nmdc:mga0qj67_11680_c1 3300050509 Bacteria 6588
192 nmdc:mga0qj67_1319_c1 3300050509 Bacteria 17430
193 nmdc:mga0qj67_665932_c1 3300050509 Bacteria 830
194 nmdc:mga0qj67_890948_c1 3300050509 Unclassified 701
195 nmdc:mga06r32_32956_c1 3300050510 Bacteria 4878
196 nmdc:mga06r32_610515_c1 3300050510 Bacteria 1061
197 nmdc:mga06r32_657911_c1 3300050510 Bacteria 1015
198 nmdc:mga08y16_44110_c1 3300050511 Bacteria 4672
199 nmdc:mga08y16_74065_c1 3300050511 Bacteria 3548
200 Ga0495655_0044625 3300053083 Bacteria 1148
201 Ga0495655_0053661 3300053083 Bacteria 1076
202 Ga0501084_0158729 3300054114 Bacteria 1908
203 Ga0501084_1184739 3300054114 Bacteria 641
204 Ga0501082_0151395 3300060353 Bacteria 2015
205 Ga0501082_0775817 3300060353 Bacteria 839
206 Ga0466962_0293679 3300061719 Bacteria 803
207 Ga0530510_0908558 3300061734 Bacteria 673

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005353 Ga0070669_100529179 Ga0070669_1005291792 98
2 3300006844 Ga0075428_100547633 Ga0075428_1005476332 98
3 3300009094 Ga0111539_10001745 Ga0111539_100017453 98
4 3300027907 Ga0207428_10046634 Ga0207428_100466342 98
5 3300050507 nmdc:mga05p37_22083_c1 nmdc:mga05p37_22083_c1_6550_7023 98
6 3300050511 nmdc:mga08y16_74065_c1 nmdc:mga08y16_74065_c1_1064_1537 98
7 3300014326 Ga0157380_11050156 Ga0157380_110501562 99
8 3300026075 Ga0207708_10195143 Ga0207708_101951432 105
9 3300005336 Ga0070680_100583435 Ga0070680_1005834352 110
10 3300025917 Ga0207660_10833474 Ga0207660_108334741 110
11 3300048905 Ga0496102_0298254 Ga0496102_0298254_412_921 110
12 3300005937 Ga0081455_10008208 Ga0081455_100082087 111
13 3300050507 nmdc:mga05p37_1285777_c1 nmdc:mga05p37_1285777_c1_275_730 113
14 3300005615 Ga0070702_100058549 Ga0070702_1000585492 115
15 3300005842 Ga0068858_101066721 Ga0068858_1010667212 115
16 3300026023 Ga0207677_10494297 Ga0207677_104942972 115
17 3300026035 Ga0207703_11350814 Ga0207703_113508141 115
18 3300048912 Ga0496109_0133409 Ga0496109_0133409_296_808 115
19 3300031731 Ga0307405_10103766 Ga0307405_101037662 121
20 3300031824 Ga0307413_10018380 Ga0307413_100183805 121
21 3300031852 Ga0307410_10013754 Ga0307410_100137543 121
22 3300031903 Ga0307407_10098132 Ga0307407_100981322 121
23 3300031911 Ga0307412_10105619 Ga0307412_101056192 121
24 3300031995 Ga0307409_100006490 Ga0307409_1000064903 121
25 3300032002 Ga0307416_100014698 Ga0307416_1000146983 121
26 3300032005 Ga0307411_10086295 Ga0307411_100862952 121
27 3300049660 Ga0501216_015428 Ga0501216_015428_251_721 121
28 3300005549 Ga0070704_100854681 Ga0070704_1008546812 122
29 3300031548 Ga0307408_100064686 Ga0307408_1000646866 122
30 3300031731 Ga0307405_10717444 Ga0307405_107174442 122
31 3300032002 Ga0307416_100168325 Ga0307416_1001683252 122
32 3300032004 Ga0307414_11135954 Ga0307414_111359542 122
33 3300032005 Ga0307411_10927970 Ga0307411_109279701 122
34 3300032126 Ga0307415_100256154 Ga0307415_1002561541 122
35 3300025923 Ga0207681_10549262 Ga0207681_105492622 123
36 3300045049 Ga0466959_0375622 Ga0466959_0375622_285_782 123
37 3300048922 Ga0496119_0145745 Ga0496119_0145745_424_918 123
38 3300049576 Ga0501040_0199403 Ga0501040_0199403_627_1007 125
39 3300049577 Ga0501041_0414880 Ga0501041_0414880_54_434 125
40 3300049578 Ga0501042_0338206 Ga0501042_0338206_499_879 125
41 3300049587 Ga0501071_1331491 Ga0501071_1331491_129_509 125
42 3300049591 Ga0501075_0018550 Ga0501075_0018550_516_896 125
43 3300049743 Ga0501081_0163643 Ga0501081_0163643_518_898 125
44 3300049824 Ga0501045_0989682 Ga0501045_0989682_147_527 125
45 3300054114 Ga0501084_0158729 Ga0501084_0158729_1384_1764 125
46 3300039437 Ga0436365_0177016 Ga0436365_0177016_327_719 126
47 3300045976 Ga0466967_1098786 Ga0466967_1098786_31_432 126
48 3300048088 Ga0495602_0797056 Ga0495602_0797056_34_444 126
49 3300026089 Ga0207648_10495639 Ga0207648_104956392 130
50 3300009101 Ga0105247_10959259 Ga0105247_109592591 131
51 3300025898 Ga0207692_10422678 Ga0207692_104226782 131
52 3300044683 Ga0466965_0444544 Ga0466965_0444544_177_587 131
53 3300044735 Ga0466968_0304820 Ga0466968_0304820_153_563 131
54 3300048924 Ga0496121_0095672 Ga0496121_0095672_1479_1895 131
55 3300005458 Ga0070681_10686203 Ga0070681_106862031 132
56 3300005981 Ga0081538_10000112 Ga0081538_1000011223 132
57 3300005981 Ga0081538_10030685 Ga0081538_100306854 132
58 3300014968 Ga0157379_10005656 Ga0157379_1000565610 132
59 3300031548 Ga0307408_100060871 Ga0307408_1000608714 132
60 3300031852 Ga0307410_10079180 Ga0307410_100791804 132
61 3300031901 Ga0307406_10255115 Ga0307406_102551152 132
62 3300031995 Ga0307409_100085627 Ga0307409_1000856274 132
63 3300032002 Ga0307416_100014256 Ga0307416_1000142563 132
64 3300032005 Ga0307411_10042758 Ga0307411_100427582 132
65 3300032126 Ga0307415_100026976 Ga0307415_1000269764 132
66 3300044719 Ga0466971_0206051 Ga0466971_0206051_166_582 132
67 3300049576 Ga0501040_0518050 Ga0501040_0518050_419_817 132
68 3300061719 Ga0466962_0293679 Ga0466962_0293679_315_731 132
69 3300006038 Ga0075365_10105975 Ga0075365_101059752 133
70 3300038443 Ga0395901_0334249 Ga0395901_0334249_754_1167 133
71 3300050492 nmdc:mga0yw44_43186_c1 nmdc:mga0yw44_43186_c1_2011_2412 133
72 3300054114 Ga0501084_1184739 Ga0501084_1184739_102_506 133
73 3300045976 Ga0466967_0053795 Ga0466967_0053795_2687_3097 134
74 3300003373 JGI25407J50210_10005113 JGI25407J50210_100051136 135
75 3300005345 Ga0070692_10141678 Ga0070692_101416782 135
76 3300005366 Ga0070659_100510066 Ga0070659_1005100662 135
77 3300005549 Ga0070704_100670548 Ga0070704_1006705481 135
78 3300005578 Ga0068854_100218098 Ga0068854_1002180983 135
79 3300005578 Ga0068854_100651686 Ga0068854_1006516862 135
80 3300005981 Ga0081538_10000018 Ga0081538_100000189 135
81 3300006058 Ga0075432_10088742 Ga0075432_100887422 135
82 3300006846 Ga0075430_100111161 Ga0075430_1001111613 135
83 3300006847 Ga0075431_100817187 Ga0075431_1008171872 135
84 3300009094 Ga0111539_10089518 Ga0111539_100895187 135
85 3300009147 Ga0114129_10634273 Ga0114129_106342732 135
86 3300009147 Ga0114129_12246768 Ga0114129_122467682 135
87 3300009148 Ga0105243_10983352 Ga0105243_109833522 135
88 3300025932 Ga0207690_10416833 Ga0207690_104168332 135
89 3300025981 Ga0207640_10321573 Ga0207640_103215732 135
90 3300027665 Ga0209983_1015255 Ga0209983_10152552 135
91 3300027907 Ga0207428_10027455 Ga0207428_100274552 135
92 3300031548 Ga0307408_100289126 Ga0307408_1002891262 135
93 3300031824 Ga0307413_10643354 Ga0307413_106433542 135
94 3300031824 Ga0307413_10942099 Ga0307413_109420991 135
95 3300031901 Ga0307406_10367945 Ga0307406_103679452 135
96 3300031995 Ga0307409_100340866 Ga0307409_1003408662 135
97 3300032002 Ga0307416_100035494 Ga0307416_1000354946 135
98 3300032002 Ga0307416_101454087 Ga0307416_1014540871 135
99 3300032004 Ga0307414_10339277 Ga0307414_103392772 135
100 3300034820 Ga0373959_0121126 Ga0373959_0121126_177_590 135
101 3300035088 Ga0373940_0223635 Ga0373940_0223635_11_424 135
102 3300035114 Ga0373939_0050248 Ga0373939_0050248_694_1107 135
103 3300035115 Ga0373941_0078238 Ga0373941_0078238_36_449 135
104 3300035121 Ga0373960_0001929 Ga0373960_0001929_924_1337 135
105 3300037418 Ga0395900_0377789 Ga0395900_0377789_456_863 135
106 3300038443 Ga0395901_0139212 Ga0395901_0139212_762_1181 135
107 3300038443 Ga0395901_0492931 Ga0395901_0492931_656_1063 135
108 3300042461 Ga0439460_0065581 Ga0439460_0065581_662_1075 135
109 3300045976 Ga0466967_1302941 Ga0466967_1302941_21_443 135
110 3300046515 Ga0495620_0067079 Ga0495620_0067079_729_1139 135
111 3300046692 Ga0495671_0124161 Ga0495671_0124161_469_879 135
112 3300048905 Ga0496102_0615893 Ga0496102_0615893_393_800 135
113 3300048906 Ga0496103_0266561 Ga0496103_0266561_177_596 135
114 3300048912 Ga0496109_1100303 Ga0496109_1100303_265_672 135
115 3300049576 Ga0501040_0209644 Ga0501040_0209644_797_1207 135
116 3300049577 Ga0501041_0404040 Ga0501041_0404040_367_777 135
117 3300049578 Ga0501042_0737221 Ga0501042_0737221_176_586 135
118 3300049583 Ga0501067_0250413 Ga0501067_0250413_278_778 135
119 3300049591 Ga0501075_0065448 Ga0501075_0065448_1926_2336 135
120 3300049741 Ga0501079_0398764 Ga0501079_0398764_364_774 135
121 3300049743 Ga0501081_0268102 Ga0501081_0268102_638_1048 135
122 3300049824 Ga0501045_0062259 Ga0501045_0062259_1478_1888 135
123 3300050507 nmdc:mga05p37_1593760_c1 nmdc:mga05p37_1593760_c1_227_634 135
124 3300050507 nmdc:mga05p37_271019_c1 nmdc:mga05p37_271019_c1_579_989 135
125 3300050508 nmdc:mga09592_967290_c1 nmdc:mga09592_967290_c1_281_691 135
126 3300050509 nmdc:mga0qj67_665932_c1 nmdc:mga0qj67_665932_c1_191_601 135
127 3300050509 nmdc:mga0qj67_890948_c1 nmdc:mga0qj67_890948_c1_47_454 135
128 3300050510 nmdc:mga06r32_610515_c1 nmdc:mga06r32_610515_c1_430_840 135
129 3300050511 nmdc:mga08y16_44110_c1 nmdc:mga08y16_44110_c1_1144_1557 135
130 3300060353 Ga0501082_0151395 Ga0501082_0151395_743_1153 135
131 3300061734 Ga0530510_0908558 Ga0530510_0908558_90_590 135
132 3300003373 JGI25407J50210_10014303 JGI25407J50210_100143031 136
133 3300005981 Ga0081538_10001806 Ga0081538_100018065 136
134 3300006844 Ga0075428_100130076 Ga0075428_1001300762 136
135 3300006844 Ga0075428_100399214 Ga0075428_1003992142 136
136 3300006846 Ga0075430_100000024 Ga0075430_10000002470 136
137 3300006846 Ga0075430_100014081 Ga0075430_1000140812 136
138 3300006847 Ga0075431_100601264 Ga0075431_1006012642 136
139 3300006880 Ga0075429_100170549 Ga0075429_1001705494 136
140 3300009147 Ga0114129_10061899 Ga0114129_100618993 136
141 3300009147 Ga0114129_10405589 Ga0114129_104055892 136
142 3300031995 Ga0307409_101011516 Ga0307409_1010115162 136
143 3300032126 Ga0307415_100327965 Ga0307415_1003279652 136
144 3300042008 Ga0439450_182505 Ga0439450_182505_103_519 136
145 3300042016 Ga0439463_064727 Ga0439463_064727_30_539 136
146 3300042461 Ga0439460_0164374 Ga0439460_0164374_94_510 136
147 3300046491 Ga0495584_0411334 Ga0495584_0411334_123_623 136
148 3300050507 nmdc:mga05p37_1685_c1 nmdc:mga05p37_1685_c1_15518_16015 136
149 3300050507 nmdc:mga05p37_412732_c1 nmdc:mga05p37_412732_c1_654_1067 136
150 3300050508 nmdc:mga09592_125791_c1 nmdc:mga09592_125791_c1_1661_2074 136
151 3300050509 nmdc:mga0qj67_11680_c1 nmdc:mga0qj67_11680_c1_544_1041 136
152 3300050509 nmdc:mga0qj67_1319_c1 nmdc:mga0qj67_1319_c1_15627_16040 136
153 3300050510 nmdc:mga06r32_32956_c1 nmdc:mga06r32_32956_c1_4148_4561 136
154 3300053083 Ga0495655_0053661 Ga0495655_0053661_268_681 136
155 3300060353 Ga0501082_0775817 Ga0501082_0775817_60_473 136
156 3300003373 JGI25407J50210_10000241 JGI25407J50210_100002413 137
157 3300003373 JGI25407J50210_10003515 JGI25407J50210_100035153 137
158 3300003373 JGI25407J50210_10008822 JGI25407J50210_100088222 137
159 3300003373 JGI25407J50210_10013508 JGI25407J50210_100135084 137
160 3300005328 Ga0070676_10201830 Ga0070676_102018302 137
161 3300005341 Ga0070691_10028168 Ga0070691_100281683 137
162 3300005347 Ga0070668_100190520 Ga0070668_1001905203 137
163 3300005353 Ga0070669_100716042 Ga0070669_1007160422 137
164 3300005440 Ga0070705_101133970 Ga0070705_1011339701 137
165 3300005441 Ga0070700_100100692 Ga0070700_1001006922 137
166 3300005441 Ga0070700_100939298 Ga0070700_1009392981 137
167 3300005457 Ga0070662_100637739 Ga0070662_1006377391 137
168 3300005546 Ga0070696_100085279 Ga0070696_1000852791 137
169 3300005578 Ga0068854_100375857 Ga0068854_1003758572 137
170 3300005719 Ga0068861_100042392 Ga0068861_1000423924 137
171 3300005981 Ga0081538_10000098 Ga0081538_100000986 137
172 3300005981 Ga0081538_10000270 Ga0081538_1000027046 137
173 3300005981 Ga0081538_10001442 Ga0081538_1000144224 137
174 3300005981 Ga0081538_10001590 Ga0081538_1000159021 137
175 3300005981 Ga0081538_10031052 Ga0081538_100310526 137
176 3300005981 Ga0081538_10033261 Ga0081538_100332616 137
177 3300005981 Ga0081538_10035997 Ga0081538_100359973 137
178 3300006847 Ga0075431_101139835 Ga0075431_1011398351 137
179 3300009098 Ga0105245_10023385 Ga0105245_100233856 137
180 3300009553 Ga0105249_10003298 Ga0105249_100032982 137
181 3300010375 Ga0105239_10132888 Ga0105239_101328886 137
182 3300025907 Ga0207645_10228862 Ga0207645_102288623 137
183 3300025927 Ga0207687_10054957 Ga0207687_100549576 137
184 3300025933 Ga0207706_10018387 Ga0207706_100183875 137
185 3300025961 Ga0207712_10239081 Ga0207712_102390812 137
186 3300025972 Ga0207668_10099033 Ga0207668_100990332 137
187 3300026075 Ga0207708_10055097 Ga0207708_100550973 137
188 3300026118 Ga0207675_100000627 Ga0207675_10000062719 137
189 3300031548 Ga0307408_100844932 Ga0307408_1008449322 137
190 3300031731 Ga0307405_10642661 Ga0307405_106426612 137
191 3300031824 Ga0307413_10029270 Ga0307413_100292704 137
192 3300031852 Ga0307410_10065235 Ga0307410_100652355 137
193 3300031901 Ga0307406_10246820 Ga0307406_102468202 137
194 3300031911 Ga0307412_10408833 Ga0307412_104088332 137
195 3300031995 Ga0307409_100643140 Ga0307409_1006431402 137
196 3300032002 Ga0307416_100307124 Ga0307416_1003071242 137
197 3300032126 Ga0307415_100123325 Ga0307415_1001233252 137
198 3300037418 Ga0395900_0811273 Ga0395900_0811273_302_718 137
199 3300037471 Ga0395905_0648318 Ga0395905_0648318_378_794 137
200 3300038443 Ga0395901_0079644 Ga0395901_0079644_2029_2445 137
201 3300046471 Ga0495650_0000035 Ga0495650_0000035_147254_147694 137
202 3300046518 Ga0495631_0314579 Ga0495631_0314579_102_557 137
203 3300046523 Ga0495644_0107625 Ga0495644_0107625_313_816 137
204 3300046684 Ga0495669_0129394 Ga0495669_0129394_584_1000 137
205 3300047445 Ga0495677_0095110 Ga0495677_0095110_288_743 137
206 3300050510 nmdc:mga06r32_657911_c1 nmdc:mga06r32_657911_c1_533_949 137
207 3300053083 Ga0495655_0044625 Ga0495655_0044625_478_987 137

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13240

zinc_ribbon_2

zinc-ribbon domain

10

31

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1yj7-assembly1.cif.gz_A crystal structure of enteropathogenic e.coli (epec) type iii secretion system protein escj 0.8928 33 98
2y9j-assembly1.cif.gz_Y three-dimensional model of salmonella's needle complex at subnanometer resolution 0.8881 35 100
1yj7-assembly1.cif.gz_C crystal structure of enteropathogenic e.coli (epec) type iii secretion system protein escj 0.8837 36 98
4w4m-assembly10.cif.gz_J crystal structure of prgk 19-92 0.8311 33 102
5gt7-assembly1.cif.gz_A crystal structure of arg-bound castor1 0.8277 49 97
ID Description Score Start End Superfamily
af_P0AD21_4_109_2.60.40.1130 Mainly Beta;Sandwich;Immunoglobulin-like;Rab geranylgeranyltransferase alpha-subunit, insert domain 0.881 41 103 2.60.40.1130
af_P09391_1_67_3.30.70.2350 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7924 35 97 3.30.70.2350
2hfvA01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;UreE, C-terminal domain 0.7275 32 100 3.30.70.790
af_Q58817_173_341_3.10.28.10 Alpha Beta;Roll;Endonuclease I-creI;Homing endonucleases 0.7188 37 91 3.10.28.10
af_Q9SVM9_215_428_3.30.559.10 Alpha Beta;2-Layer Sandwich;Chloramphenicol Acetyltransferase;Chloramphenicol acetyltransferase-like domain 0.6622 76 100 3.30.559.10
ID Description Score Start End GO Terms
AF-A0A538CB88-F1-model_v4 DUF2007 domain-containing protein 0.9313 33 99
AF-A0A6G8Q7Y5-F1-model_v4 DUF2007 domain-containing protein 0.9307 32 97
AF-A0A7X8ARZ7-F1-model_v4 DUF2007 domain-containing protein 0.9305 33 99
AF-A0A7C0USA2-F1-model_v4 DUF2007 domain-containing protein 0.9185 33 100
AF-A0A1Q3NDA5-F1-model_v4 deleted 0.9092 32 99

Feature Viewer

pLDDT pTM Quality
80.12 0.57 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map