F316057

General Info

Members Datasets Scaffolds Average Seq Length
207 146 206 85

Family's Representative Sequence

Representative Sequence 3300005343|Ga0070687_101260888|Ga0070687_1012608881
Length 93
Sequence VKHFTLPRFWQHYRQLPKEVQVSADKSYELLKADPRHPSLHFKQIGGAKKLWSVRVGKHHRALGSEKPQGIVWFWIGPHAEYDKLLASARQKA

Samples

Sample ID Description Type Environment
1 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
2 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
53 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
54 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
55 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
56 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
57 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
58 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
59 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
60 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
63 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
64 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
65 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
67 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
68 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
69 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
70 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
71 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
72 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
73 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
74 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
75 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
76 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
77 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
78 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
79 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
80 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
109 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
111 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
112 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
113 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
114 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
115 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
116 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
117 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
118 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
119 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
120 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
121 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
122 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
123 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
124 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
125 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
126 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
127 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
128 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
129 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
130 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
131 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
132 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
133 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
134 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
135 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
136 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
137 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
138 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
139 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
140 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
141 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
142 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
143 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
144 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
145 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
146 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.03
Metatranscriptomes 0.48
Isolates 0.48

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.97
Nodule 0
Rhizoplane 0.48
Rhizosphere 95.65
Stem 0
Stem Tuber 0
Unclassified 2.9

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL3b_contig_1108656 2162886006 Bacteria 911
2 SwRhRL3b_contig_1544510 2162886006 Bacteria 1072
3 SwRhRL3b_contig_3949845 2162886006 Bacteria 1072
4 Ga0065704_10271436 3300005289 Bacteria 938
5 Ga0065715_10136477 3300005293 Bacteria 1904
6 Ga0065707_10005242 3300005295 Unclassified 4891
7 Ga0070683_100038269 3300005329 Unclassified 4396
8 Ga0070670_101159309 3300005331 Unclassified 706
9 Ga0070670_101722522 3300005331 Bacteria 577
10 Ga0068869_101000224 3300005334 Unclassified 728
11 Ga0070680_100034553 3300005336 Bacteria 4076
12 Ga0070680_100803144 3300005336 Unclassified 811
13 Ga0070680_101110458 3300005336 Unclassified 683
14 Ga0070660_100960344 3300005339 Unclassified 722
15 Ga0070689_100589578 3300005340 Bacteria 962
16 Ga0070687_101260888 3300005343 Unclassified 547
17 Ga0070661_100650593 3300005344 Unclassified 856
18 Ga0070692_11117624 3300005345 Unclassified 557
19 Ga0070669_100925596 3300005353 Unclassified 745
20 Ga0070675_100326222 3300005354 Bacteria 1357
21 Ga0070671_100368821 3300005355 Unclassified 1226
22 Ga0070673_100661879 3300005364 Bacteria 957
23 Ga0070673_100999956 3300005364 Unclassified 779
24 Ga0070673_102065509 3300005364 Unclassified 541
25 Ga0070659_100090418 3300005366 Bacteria 2453
26 Ga0070659_100345050 3300005366 Unclassified 1248
27 Ga0070713_100963567 3300005436 Bacteria 822
28 Ga0070701_10389109 3300005438 Unclassified 881
29 Ga0070705_101118339 3300005440 Bacteria 645
30 Ga0070700_100794025 3300005441 Bacteria 762
31 Ga0070700_101731056 3300005441 Unclassified 537
32 Ga0070694_100662043 3300005444 Bacteria 846
33 Ga0070694_100894654 3300005444 Bacteria 733
34 Ga0070694_101313280 3300005444 Bacteria 609
35 Ga0070708_100721166 3300005445 Unclassified 938
36 Ga0070708_101709589 3300005445 Bacteria 585
37 Ga0070663_101067027 3300005455 Unclassified 705
38 Ga0070663_101374122 3300005455 Bacteria 625
39 Ga0070678_101374771 3300005456 Bacteria 659
40 Ga0070662_100374396 3300005457 Unclassified 1171
41 Ga0070681_10097434 3300005458 Bacteria 2888
42 Ga0070681_10817019 3300005458 Unclassified 849
43 Ga0070685_10886218 3300005466 Unclassified 663
44 Ga0070706_100131555 3300005467 Bacteria 2335
45 Ga0070707_100127048 3300005468 Bacteria 2477
46 Ga0070698_100029857 3300005471 Bacteria 5656
47 Ga0070699_100570807 3300005518 Bacteria 1030
48 Ga0070699_100712956 3300005518 Unclassified 917
49 Ga0070699_100966657 3300005518 Bacteria 780
50 Ga0070679_100034170 3300005530 Bacteria 5038
51 Ga0070679_100098991 3300005530 Bacteria 2903
52 Ga0070684_100040372 3300005535 Bacteria 4018
53 Ga0070697_100068087 3300005536 Unclassified 2913
54 Ga0070697_101639945 3300005536 Unclassified 575
55 Ga0068853_100134010 3300005539 Bacteria 2219
56 Ga0070672_100227302 3300005543 Bacteria 1566
57 Ga0070672_102121484 3300005543 Unclassified 506
58 Ga0070695_100659870 3300005545 Bacteria 827
59 Ga0070695_101430515 3300005545 Unclassified 574
60 Ga0068855_100848237 3300005563 Unclassified 968
61 Ga0068855_101062949 3300005563 Bacteria 848
62 Ga0070664_100097666 3300005564 Bacteria 2550
63 Ga0068857_100706066 3300005577 Unclassified 958
64 Ga0068857_102458984 3300005577 Unclassified 511
65 Ga0068854_102269537 3300005578 Unclassified 503
66 Ga0070702_101155348 3300005615 Bacteria 622
67 Ga0068859_100077837 3300005617 Bacteria 3357
68 Ga0068864_100036730 3300005618 Bacteria 4178
69 Ga0068864_101969827 3300005618 Bacteria 590
70 Ga0068851_10951461 3300005834 Unclassified 540
71 Ga0068858_100933086 3300005842 Bacteria 849
72 Ga0068860_100046780 3300005843 Bacteria 4125
73 Ga0068862_100010566 3300005844 Bacteria 7630
74 Ga0081538_10027794 3300005981 Bacteria 3909
75 Ga0081538_10087111 3300005981 Bacteria 1632
76 Ga0070716_100128683 3300006173 Unclassified 1597
77 Ga0070712_100143828 3300006175 Unclassified 1823
78 Ga0075428_100074601 3300006844 Bacteria 3705
79 Ga0075428_101620269 3300006844 Bacteria 676
80 Ga0075430_100315028 3300006846 Unclassified 1294
81 Ga0075430_100503097 3300006846 Unclassified 1000
82 Ga0075430_100903692 3300006846 Unclassified 727
83 Ga0075430_101073909 3300006846 Bacteria 663
84 Ga0075431_100645302 3300006847 Unclassified 1040
85 Ga0075434_100426705 3300006871 Bacteria 1347
86 Ga0075429_100104785 3300006880 Bacteria 2470
87 Ga0075429_100543931 3300006880 Unclassified 1018
88 Ga0075436_100817145 3300006914 Unclassified 695
89 Ga0075436_101367396 3300006914 Unclassified 536
90 Ga0097620_100077836 3300006931 Bacteria 3357
91 Ga0075435_100181116 3300007076 Bacteria 1780
92 Ga0105251_10273622 3300009011 Bacteria 763
93 Ga0105240_10766854 3300009093 Unclassified 1047
94 Ga0105240_12717402 3300009093 Unclassified 510
95 Ga0114129_12156940 3300009147 Unclassified 671
96 Ga0105241_10767883 3300009174 Unclassified 885
97 Ga0105237_10489930 3300009545 Unclassified 1236
98 Ga0105249_10205529 3300009553 Bacteria 1929
99 Ga0105239_11456733 3300010375 Unclassified 791
100 Ga0105246_12419200 3300011119 Unclassified 515
101 Ga0157373_10124542 3300013100 Bacteria 1812
102 Ga0157373_10247429 3300013100 Unclassified 1261
103 Ga0157370_10571254 3300013104 Unclassified 1036
104 Ga0157370_10601264 3300013104 Bacteria 1007
105 Ga0157370_10615392 3300013104 Bacteria 994
106 Ga0157369_10911864 3300013105 Unclassified 901
107 Ga0157378_10137771 3300013297 Bacteria 2264
108 Ga0157378_10308519 3300013297 Bacteria 1534
109 Ga0157372_10190990 3300013307 Bacteria 2372
110 Ga0157372_11081067 3300013307 Unclassified 928
111 Ga0157372_11091265 3300013307 Unclassified 923
112 Ga0163163_10090025 3300014325 Bacteria 3081
113 Ga0157380_10198374 3300014326 Bacteria 1778
114 Ga0157380_10524880 3300014326 Bacteria 1156
115 Ga0213876_10076281 3300021384 Bacteria 1770
116 Ga0213876_10097380 3300021384 Bacteria 1559
117 Ga0224712_10056133 3300022467 Bacteria 1551
118 Ga0207645_10746015 3300025907 Unclassified 666
119 Ga0207684_10127411 3300025910 Bacteria 2185
120 Ga0207684_10136221 3300025910 Bacteria 2109
121 Ga0207654_10446284 3300025911 Unclassified 906
122 Ga0207707_10005421 3300025912 Bacteria 11152
123 Ga0207707_10027986 3300025912 Bacteria 4928
124 Ga0207707_10045056 3300025912 Bacteria 3844
125 Ga0207707_10536975 3300025912 Unclassified 995
126 Ga0207695_11219962 3300025913 Unclassified 632
127 Ga0207693_10118245 3300025915 Unclassified 2081
128 Ga0207660_10075778 3300025917 Bacteria 2458
129 Ga0207660_10885365 3300025917 Unclassified 729
130 Ga0207657_11298362 3300025919 Unclassified 550
131 Ga0207652_10669740 3300025921 Unclassified 927
132 Ga0207652_10781831 3300025921 Unclassified 848
133 Ga0207646_10078483 3300025922 Bacteria 2951
134 Ga0207646_11446307 3300025922 Unclassified 597
135 Ga0207700_10626230 3300025928 Bacteria 958
136 Ga0207690_10014213 3300025932 Bacteria 4803
137 Ga0207706_11003262 3300025933 Unclassified 701
138 Ga0207670_10936294 3300025936 Bacteria 727
139 Ga0207665_10197076 3300025939 Unclassified 1466
140 Ga0207689_10561975 3300025942 Unclassified 958
141 Ga0207661_10346577 3300025944 Unclassified 1339
142 Ga0207661_10548479 3300025944 Bacteria 1059
143 Ga0207679_10022282 3300025945 Bacteria 4311
144 Ga0207667_10443515 3300025949 Bacteria 1320
145 Ga0207667_11258821 3300025949 Bacteria 717
146 Ga0207651_10482189 3300025960 Bacteria 1069
147 Ga0207651_10695455 3300025960 Unclassified 895
148 Ga0207712_10228514 3300025961 Bacteria 1492
149 Ga0207640_10470043 3300025981 Bacteria 1041
150 Ga0207639_10383091 3300026041 Bacteria 1263
151 Ga0207678_11051758 3300026067 Unclassified 721
152 Ga0207708_10000007 3300026075 Bacteria 264612
153 Ga0207676_10061282 3300026095 Bacteria 2978
154 Ga0207674_10009041 3300026116 Bacteria 11443
155 Ga0207674_11900753 3300026116 Unclassified 561
156 Ga0207698_10401987 3300026142 Unclassified 1309
157 Ga0207428_10046879 3300027907 Unclassified 3473
158 Ga0207428_10768594 3300027907 Unclassified 686
159 Ga0268265_10265055 3300028380 Bacteria 1529
160 Ga0268265_11362850 3300028380 Unclassified 711
161 Ga0307408_101666600 3300031548 Bacteria 607
162 Ga0307412_11002662 3300031911 Unclassified 738
163 Ga0307416_102518662 3300032002 Unclassified 613
164 Ga0307414_11583015 3300032004 Unclassified 610
165 Ga0307415_101669617 3300032126 Bacteria 614
166 Ga0395898_0084548 3300037466 Unclassified 3059
167 Ga0400489_17982 3300039093 Bacteria 1058
168 Ga0436365_0106992 3300039437 Unclassified 2536
169 Ga0436365_1365423 3300039437 Unclassified 4404
170 Ga0451577_0132655 3300042876 Bacteria 2235
171 Ga0453683_0950657 3300044673 Unclassified 569
172 Ga0466963_0593535 3300044694 Bacteria 782
173 Ga0466963_0954166 3300044694 Unclassified 604
174 Ga0453684_0005494 3300044712 Bacteria 25049
175 Ga0451576_0221111 3300045051 Bacteria 1977
176 Ga0466958_0294613 3300045836 Bacteria 1041
177 Ga0466967_0422757 3300045976 Bacteria 1299
178 Ga0495580_0582776 3300046472 Bacteria 740
179 Ga0495580_1068377 3300046472 Bacteria 512
180 Ga0495652_0608761 3300046529 Bacteria 744
181 Ga0495647_0340556 3300046681 Bacteria 681
182 Ga0495658_0940656 3300046683 Bacteria 552
183 Ga0496108_0562515 3300048911 Bacteria 994
184 Ga0501037_0130682 3300049573 Bacteria 1801
185 Ga0501043_0216737 3300049579 Bacteria 1482
186 Ga0501067_0099563 3300049583 Unclassified 1614
187 Ga0501073_0968603 3300049589 Bacteria 585
188 Ga0501074_1242918 3300049590 Unclassified 522
189 Ga0501079_0499935 3300049741 Bacteria 956
190 nmdc:mga0yw44_571_c1 3300050492 Bacteria 13302
191 nmdc:mga05p37_477537_c1 3300050507 Unclassified 1437
192 nmdc:mga09592_110031_c1 3300050508 Bacteria 2363
193 nmdc:mga09592_545343_c1 3300050508 Unclassified 996
194 nmdc:mga0qj67_266600_c1 3300050509 Unclassified 1389
195 nmdc:mga0qj67_527318_c1 3300050509 Unclassified 948
196 nmdc:mga06r32_966218_c1 3300050510 Unclassified 806
197 nmdc:mga08y16_1538774_c1 3300050511 Unclassified 625
198 nmdc:mga08y16_386214_c1 3300050511 Bacteria 1435
199 nmdc:mga0n895_12203_c1 3300050512 Bacteria 7697
200 nmdc:mga0n895_441850_c1 3300050512 Bacteria 1314
201 nmdc:mga0n895_6314_c1 3300050512 Bacteria 10050
202 nmdc:mga0n895_85347_c1 3300050512 Bacteria 3152
203 nmdc:mga08x19_1139403_c1 3300050514 Unclassified 553
204 nmdc:mga0a205_146700_c1 3300050515 Bacteria 2260
205 nmdc:mga0sz30_204664_c1 3300050516 Bacteria 876
206 Ga0501082_0000157 3300060353 Bacteria 57772

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005345 Ga0070692_11117624 Ga0070692_111176242 74
2 iso_pu_bacteria 2854896431 2854901369 80
3 3300005331 Ga0070670_101159309 Ga0070670_1011593092 83
4 3300005331 Ga0070670_101722522 Ga0070670_1017225222 83
5 3300005334 Ga0068869_101000224 Ga0068869_1010002241 83
6 3300005336 Ga0070680_100034553 Ga0070680_1000345534 83
7 3300005339 Ga0070660_100960344 Ga0070660_1009603441 83
8 3300005340 Ga0070689_100589578 Ga0070689_1005895783 83
9 3300005344 Ga0070661_100650593 Ga0070661_1006505933 83
10 3300005355 Ga0070671_100368821 Ga0070671_1003688212 83
11 3300005364 Ga0070673_100661879 Ga0070673_1006618792 83
12 3300005364 Ga0070673_102065509 Ga0070673_1020655091 83
13 3300005366 Ga0070659_100090418 Ga0070659_1000904184 83
14 3300005440 Ga0070705_101118339 Ga0070705_1011183392 83
15 3300005441 Ga0070700_101731056 Ga0070700_1017310561 83
16 3300005444 Ga0070694_101313280 Ga0070694_1013132802 83
17 3300005445 Ga0070708_101709589 Ga0070708_1017095891 83
18 3300005455 Ga0070663_101374122 Ga0070663_1013741221 83
19 3300005457 Ga0070662_100374396 Ga0070662_1003743963 83
20 3300005471 Ga0070698_100029857 Ga0070698_1000298572 83
21 3300005518 Ga0070699_100570807 Ga0070699_1005708073 83
22 3300005518 Ga0070699_100966657 Ga0070699_1009666573 83
23 3300005530 Ga0070679_100098991 Ga0070679_1000989913 83
24 3300005536 Ga0070697_100068087 Ga0070697_1000680874 83
25 3300005539 Ga0068853_100134010 Ga0068853_1001340103 83
26 3300005543 Ga0070672_102121484 Ga0070672_1021214841 83
27 3300005545 Ga0070695_100659870 Ga0070695_1006598702 83
28 3300005545 Ga0070695_101430515 Ga0070695_1014305151 83
29 3300005563 Ga0068855_101062949 Ga0068855_1010629492 83
30 3300005564 Ga0070664_100097666 Ga0070664_1000976664 83
31 3300005577 Ga0068857_100706066 Ga0068857_1007060663 83
32 3300005578 Ga0068854_102269537 Ga0068854_1022695372 83
33 3300005615 Ga0070702_101155348 Ga0070702_1011553481 83
34 3300005618 Ga0068864_100036730 Ga0068864_1000367305 83
35 3300005618 Ga0068864_101969827 Ga0068864_1019698271 83
36 3300005834 Ga0068851_10951461 Ga0068851_109514612 83
37 3300009011 Ga0105251_10273622 Ga0105251_102736222 83
38 3300011119 Ga0105246_12419200 Ga0105246_124192001 83
39 3300013100 Ga0157373_10124542 Ga0157373_101245423 83
40 3300013100 Ga0157373_10247429 Ga0157373_102474292 83
41 3300013297 Ga0157378_10137771 Ga0157378_101377713 83
42 3300013307 Ga0157372_10190990 Ga0157372_101909902 83
43 3300014325 Ga0163163_10090025 Ga0163163_100900252 83
44 3300021384 Ga0213876_10076281 Ga0213876_100762811 83
45 3300025907 Ga0207645_10746015 Ga0207645_107460152 83
46 3300025912 Ga0207707_10027986 Ga0207707_100279866 83
47 3300025917 Ga0207660_10075778 Ga0207660_100757783 83
48 3300025919 Ga0207657_11298362 Ga0207657_112983622 83
49 3300025921 Ga0207652_10669740 Ga0207652_106697402 83
50 3300025922 Ga0207646_11446307 Ga0207646_114463071 83
51 3300025932 Ga0207690_10014213 Ga0207690_100142138 83
52 3300025933 Ga0207706_11003262 Ga0207706_110032622 83
53 3300025936 Ga0207670_10936294 Ga0207670_109362942 83
54 3300025942 Ga0207689_10561975 Ga0207689_105619753 83
55 3300025944 Ga0207661_10548479 Ga0207661_105484792 83
56 3300025945 Ga0207679_10022282 Ga0207679_100222824 83
57 3300025949 Ga0207667_11258821 Ga0207667_112588212 83
58 3300025960 Ga0207651_10482189 Ga0207651_104821893 83
59 3300025981 Ga0207640_10470043 Ga0207640_104700432 83
60 3300026041 Ga0207639_10383091 Ga0207639_103830913 83
61 3300026067 Ga0207678_11051758 Ga0207678_110517581 83
62 3300026095 Ga0207676_10061282 Ga0207676_100612824 83
63 3300026116 Ga0207674_10009041 Ga0207674_100090411 83
64 3300028380 Ga0268265_11362850 Ga0268265_113628502 83
65 3300032004 Ga0307414_11583015 Ga0307414_115830151 83
66 3300037466 Ga0395898_0084548 Ga0395898_0084548_141_392 83
67 3300042876 Ga0451577_0132655 Ga0451577_0132655_340_591 83
68 3300044712 Ga0453684_0005494 Ga0453684_0005494_8793_9044 83
69 3300045051 Ga0451576_0221111 Ga0451576_0221111_876_1127 83
70 3300049741 Ga0501079_0499935 Ga0501079_0499935_306_557 83
71 3300050512 nmdc:mga0n895_85347_c1 nmdc:mga0n895_85347_c1_1133_1384 83
72 3300005293 Ga0065715_10136477 Ga0065715_101364773 84
73 3300005336 Ga0070680_100803144 Ga0070680_1008031442 84
74 3300005353 Ga0070669_100925596 Ga0070669_1009255963 84
75 3300005354 Ga0070675_100326222 Ga0070675_1003262223 84
76 3300005364 Ga0070673_100999956 Ga0070673_1009999561 84
77 3300005436 Ga0070713_100963567 Ga0070713_1009635672 84
78 3300005441 Ga0070700_100794025 Ga0070700_1007940253 84
79 3300005444 Ga0070694_100894654 Ga0070694_1008946543 84
80 3300005445 Ga0070708_100721166 Ga0070708_1007211662 84
81 3300005456 Ga0070678_101374771 Ga0070678_1013747712 84
82 3300005458 Ga0070681_10097434 Ga0070681_100974343 84
83 3300005466 Ga0070685_10886218 Ga0070685_108862182 84
84 3300005467 Ga0070706_100131555 Ga0070706_1001315553 84
85 3300005468 Ga0070707_100127048 Ga0070707_1001270483 84
86 3300005536 Ga0070697_101639945 Ga0070697_1016399451 84
87 3300005543 Ga0070672_100227302 Ga0070672_1002273023 84
88 3300005577 Ga0068857_102458984 Ga0068857_1024589842 84
89 3300005981 Ga0081538_10027794 Ga0081538_100277943 84
90 3300005981 Ga0081538_10087111 Ga0081538_100871112 84
91 3300006173 Ga0070716_100128683 Ga0070716_1001286832 84
92 3300006175 Ga0070712_100143828 Ga0070712_1001438283 84
93 3300006844 Ga0075428_101620269 Ga0075428_1016202692 84
94 3300006846 Ga0075430_100315028 Ga0075430_1003150282 84
95 3300006846 Ga0075430_100903692 Ga0075430_1009036921 84
96 3300006846 Ga0075430_101073909 Ga0075430_1010739091 84
97 3300006847 Ga0075431_100645302 Ga0075431_1006453022 84
98 3300006871 Ga0075434_100426705 Ga0075434_1004267053 84
99 3300006880 Ga0075429_100104785 Ga0075429_1001047853 84
100 3300006914 Ga0075436_100817145 Ga0075436_1008171451 84
101 3300006914 Ga0075436_101367396 Ga0075436_1013673962 84
102 3300007076 Ga0075435_100181116 Ga0075435_1001811162 84
103 3300009147 Ga0114129_12156940 Ga0114129_121569402 84
104 3300009174 Ga0105241_10767883 Ga0105241_107678831 84
105 3300013104 Ga0157370_10615392 Ga0157370_106153923 84
106 3300013297 Ga0157378_10308519 Ga0157378_103085192 84
107 3300014326 Ga0157380_10198374 Ga0157380_101983743 84
108 3300021384 Ga0213876_10097380 Ga0213876_100973802 84
109 3300025910 Ga0207684_10127411 Ga0207684_101274113 84
110 3300025910 Ga0207684_10136221 Ga0207684_101362213 84
111 3300025911 Ga0207654_10446284 Ga0207654_104462841 84
112 3300025912 Ga0207707_10045056 Ga0207707_100450564 84
113 3300025915 Ga0207693_10118245 Ga0207693_101182455 84
114 3300025922 Ga0207646_10078483 Ga0207646_100784832 84
115 3300025928 Ga0207700_10626230 Ga0207700_106262302 84
116 3300025939 Ga0207665_10197076 Ga0207665_101970763 84
117 3300025960 Ga0207651_10695455 Ga0207651_106954552 84
118 3300026075 Ga0207708_10000007 Ga0207708_1000000756 84
119 3300026116 Ga0207674_11900753 Ga0207674_119007532 84
120 3300027907 Ga0207428_10768594 Ga0207428_107685942 84
121 3300031548 Ga0307408_101666600 Ga0307408_1016666001 84
122 3300031911 Ga0307412_11002662 Ga0307412_110026622 84
123 3300032002 Ga0307416_102518662 Ga0307416_1025186621 84
124 3300032126 Ga0307415_101669617 Ga0307415_1016696171 84
125 3300039437 Ga0436365_0106992 Ga0436365_0106992_1052_1306 84
126 3300039437 Ga0436365_1365423 Ga0436365_1365423_1247_1501 84
127 3300044673 Ga0453683_0950657 Ga0453683_0950657_189_443 84
128 3300044694 Ga0466963_0593535 Ga0466963_0593535_15_272 84
129 3300045836 Ga0466958_0294613 Ga0466958_0294613_758_1015 84
130 3300045976 Ga0466967_0422757 Ga0466967_0422757_250_507 84
131 3300046472 Ga0495580_0582776 Ga0495580_0582776_111_365 84
132 3300046472 Ga0495580_1068377 Ga0495580_1068377_41_295 84
133 3300046681 Ga0495647_0340556 Ga0495647_0340556_347_601 84
134 3300046683 Ga0495658_0940656 Ga0495658_0940656_265_519 84
135 3300048911 Ga0496108_0562515 Ga0496108_0562515_642_896 84
136 3300049573 Ga0501037_0130682 Ga0501037_0130682_92_358 84
137 3300049579 Ga0501043_0216737 Ga0501043_0216737_1034_1297 84
138 3300049589 Ga0501073_0968603 Ga0501073_0968603_130_390 84
139 3300050492 nmdc:mga0yw44_571_c1 nmdc:mga0yw44_571_c1_839_1093 84
140 3300050507 nmdc:mga05p37_477537_c1 nmdc:mga05p37_477537_c1_88_342 84
141 3300050508 nmdc:mga09592_110031_c1 nmdc:mga09592_110031_c1_1693_1947 84
142 3300050508 nmdc:mga09592_545343_c1 nmdc:mga09592_545343_c1_641_901 84
143 3300050509 nmdc:mga0qj67_266600_c1 nmdc:mga0qj67_266600_c1_175_435 84
144 3300050509 nmdc:mga0qj67_527318_c1 nmdc:mga0qj67_527318_c1_118_372 84
145 3300050510 nmdc:mga06r32_966218_c1 nmdc:mga06r32_966218_c1_314_574 84
146 3300050511 nmdc:mga08y16_1538774_c1 nmdc:mga08y16_1538774_c1_293_553 84
147 3300050511 nmdc:mga08y16_386214_c1 nmdc:mga08y16_386214_c1_1162_1416 84
148 3300050512 nmdc:mga0n895_12203_c1 nmdc:mga0n895_12203_c1_6048_6302 84
149 3300050512 nmdc:mga0n895_441850_c1 nmdc:mga0n895_441850_c1_430_684 84
150 3300050512 nmdc:mga0n895_6314_c1 nmdc:mga0n895_6314_c1_8543_8797 84
151 3300050514 nmdc:mga08x19_1139403_c1 nmdc:mga08x19_1139403_c1_175_429 84
152 3300050515 nmdc:mga0a205_146700_c1 nmdc:mga0a205_146700_c1_567_821 84
153 3300050516 nmdc:mga0sz30_204664_c1 nmdc:mga0sz30_204664_c1_73_327 84
154 2162886006 SwRhRL3b_contig_1108656 SwRhRL3b_0189.00001400 87
155 2162886006 SwRhRL3b_contig_1544510 SwRhRL3b_0128.00001190 87
156 2162886006 SwRhRL3b_contig_3949845 SwRhRL3b_0949.00002550 87
157 3300005289 Ga0065704_10271436 Ga0065704_102714363 87
158 3300005295 Ga0065707_10005242 Ga0065707_100052424 87
159 3300005329 Ga0070683_100038269 Ga0070683_1000382691 87
160 3300005336 Ga0070680_101110458 Ga0070680_1011104581 87
161 3300005343 Ga0070687_101260888 Ga0070687_1012608881 87
162 3300005366 Ga0070659_100345050 Ga0070659_1003450501 87
163 3300005438 Ga0070701_10389109 Ga0070701_103891091 87
164 3300005444 Ga0070694_100662043 Ga0070694_1006620432 87
165 3300005455 Ga0070663_101067027 Ga0070663_1010670272 87
166 3300005458 Ga0070681_10817019 Ga0070681_108170192 87
167 3300005518 Ga0070699_100712956 Ga0070699_1007129562 87
168 3300005530 Ga0070679_100034170 Ga0070679_1000341708 87
169 3300005535 Ga0070684_100040372 Ga0070684_1000403724 87
170 3300005563 Ga0068855_100848237 Ga0068855_1008482372 87
171 3300005617 Ga0068859_100077837 Ga0068859_1000778375 87
172 3300005842 Ga0068858_100933086 Ga0068858_1009330862 87
173 3300005843 Ga0068860_100046780 Ga0068860_1000467804 87
174 3300005844 Ga0068862_100010566 Ga0068862_1000105666 87
175 3300006844 Ga0075428_100074601 Ga0075428_1000746012 87
176 3300006846 Ga0075430_100503097 Ga0075430_1005030972 87
177 3300006880 Ga0075429_100543931 Ga0075429_1005439313 87
178 3300006931 Ga0097620_100077836 Ga0097620_1000778365 87
179 3300009093 Ga0105240_10766854 Ga0105240_107668541 87
180 3300009093 Ga0105240_12717402 Ga0105240_127174021 87
181 3300009545 Ga0105237_10489930 Ga0105237_104899303 87
182 3300009553 Ga0105249_10205529 Ga0105249_102055293 87
183 3300010375 Ga0105239_11456733 Ga0105239_114567331 87
184 3300013104 Ga0157370_10571254 Ga0157370_105712541 87
185 3300013104 Ga0157370_10601264 Ga0157370_106012641 87
186 3300013105 Ga0157369_10911864 Ga0157369_109118642 87
187 3300013307 Ga0157372_11081067 Ga0157372_110810671 87
188 3300013307 Ga0157372_11091265 Ga0157372_110912651 87
189 3300014326 Ga0157380_10524880 Ga0157380_105248801 87
190 3300022467 Ga0224712_10056133 Ga0224712_100561332 87
191 3300025912 Ga0207707_10005421 Ga0207707_100054214 87
192 3300025912 Ga0207707_10536975 Ga0207707_105369751 87
193 3300025913 Ga0207695_11219962 Ga0207695_112199621 87
194 3300025917 Ga0207660_10885365 Ga0207660_108853652 87
195 3300025921 Ga0207652_10781831 Ga0207652_107818312 87
196 3300025944 Ga0207661_10346577 Ga0207661_103465773 87
197 3300025949 Ga0207667_10443515 Ga0207667_104435153 87
198 3300025961 Ga0207712_10228514 Ga0207712_102285142 87
199 3300026142 Ga0207698_10401987 Ga0207698_104019871 87
200 3300027907 Ga0207428_10046879 Ga0207428_100468793 87
201 3300028380 Ga0268265_10265055 Ga0268265_102650553 87
202 3300039093 Ga0400489_17982 Ga0400489_17982_725_994 87
203 3300044694 Ga0466963_0954166 Ga0466963_0954166_312_587 87
204 3300046529 Ga0495652_0608761 Ga0495652_0608761_416_682 87
205 3300049583 Ga0501067_0099563 Ga0501067_0099563_565_849 87
206 3300049590 Ga0501074_1242918 Ga0501074_1242918_27_290 87
207 3300060353 Ga0501082_0000157 Ga0501082_0000157_40772_41056 87

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF24732

18

84

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
8g66-assembly2.cif.gz_D structure with sj3149 0.8083 51 78
8buq-assembly1.cif.gz_A structure of ddb1 bound to ds43-engaged cdk12-cyclin k 0.8073 51 78
8bu1-assembly1.cif.gz_A structure of ddb1 bound to ds17-engaged cdk12-cyclin k 0.8067 51 78
6h0f-assembly4.cif.gz_J structure of ddb1-crbn-pomalidomide complex bound to ikzf1(zf2) 0.8046 51 78
6h0f-assembly2.cif.gz_D structure of ddb1-crbn-pomalidomide complex bound to ikzf1(zf2) 0.802 51 78
ID Description Score Start End Superfamily
af_Q1WWB7_6_204_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.789 50 78 2.130.10.10
af_Q16531_4_505_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.7838 51 78 2.130.10.10
2kheA00 Alpha Beta;2-Layer Sandwich;YaeB-like fold;RelE-like 0.7762 2 80 3.30.2310.20
af_A0A1D6JF70_1_141_2.40.128.630 Mainly Beta;Beta Barrel;Lipocalin; 0.7694 42 78 2.40.128.630
3g5oB00 Alpha Beta;2-Layer Sandwich;YaeB-like fold;RelE-like 0.7693 3 78 3.30.2310.20
ID Description Score Start End GO Terms
AF-A0A7Z9DVV1-F1-model_v4 Type II toxin-antitoxin system HigB family toxin 0.9902 2 86
AF-A0A7Y4U6W3-F1-model_v4 Uncharacterized protein 0.9885 1 86
AF-A0A081BWR3-F1-model_v4 Plasmid stabilization system 0.9883 2 87
AF-G3IY67-F1-model_v4 Type II toxin-antitoxin system HigB family toxin 0.9879 1 87
AF-A0A7Y5D3U0-F1-model_v4 Type II toxin-antitoxin system HigB family toxin 0.9851 1 87

Feature Viewer

pLDDT pTM Quality
94.35 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map