F315312

General Info

Members Datasets Scaffolds Average Seq Length
206 163 412 144

Family's Representative Sequence

Representative Sequence 3300031731|Ga0307405_11074491|Ga0307405_110744911
Length 145
Sequence MSDKTYQGKCFCGAVELTVTGDPAGMGYCHCESCRSWSAGPVNAFTLWPVSAVKVTKGADQIGTFNKTPNSARKWCKICGGHLMTDHPNLGPGLVDVYAATIPGLKFEPGIHVNYGEKVLQIKDGLPKQKDFPAELGGSGTAVDE

Samples

Sample ID Description Type Environment
1 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
2 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
3 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
4 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
7 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
8 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
9 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
10 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
11 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
29 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
32 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
44 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
45 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
46 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
47 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
48 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
49 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
50 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
52 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
53 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
55 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
57 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
58 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
59 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
60 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
61 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
62 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
63 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
64 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
65 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
66 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
67 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
68 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
69 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
71 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
72 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
74 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
75 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
98 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
99 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
100 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
101 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
104 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
105 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
106 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
107 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
108 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
109 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
110 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
111 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
112 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
113 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
114 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
115 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
116 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
117 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
118 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
119 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
120 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
121 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
122 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
123 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
124 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
125 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
126 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
127 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
128 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
129 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
130 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
131 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
132 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
133 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
134 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
135 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
136 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
137 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
138 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
139 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
140 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
141 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
142 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
143 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
144 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
145 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
146 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
147 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
148 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
149 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
150 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
151 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
152 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
153 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
154 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
155 2643221557 Ensifer sp. Root558 Isolate Unclassified
156 2643221610 Ensifer sp. Root74 Isolate Unclassified
157 2643221668 Ensifer sp. Root423 Isolate Unclassified
158 2643221675 Ensifer sp. Root1298 Isolate Unclassified
159 2643221680 Ensifer sp. Root1312 Isolate Unclassified
160 2643221723 Ensifer sp. Root278 Isolate Unclassified
161 2643221726 Ensifer sp. Root954 Isolate Unclassified
162 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
163 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 95.15
Metatranscriptomes 0
Isolates 4.85

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.65
Nodule 1.46
Rhizoplane 1.46
Rhizosphere 79.13
Stem 0
Stem Tuber 0
Unclassified 11.17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307405_11074491 3300031731 Bacteria 690
2 JGI25158J39367_1004707 3300002739 Bacteria 2037
3 JGI25159J45721_1000005 3300002987 Bacteria 214315
4 JGI25151J46595_10082825 3300003187 Bacteria 922
5 rootH1_10163311 3300003323 Bacteria 2072
6 JGI25160J50197_1000005 3300003354 Bacteria 417280
7 JGI25161J50226_1000584 3300003374 Bacteria 15412
8 Ga0055526_1003755 3300003771 Bacteria 9476
9 Ga0055524_1000939 3300003775 Bacteria 18642
10 Ga0055524_1040069 3300003775 Bacteria 1200
11 Ga0055543_1000091 3300004625 Bacteria 79152
12 Ga0065165_1000002 3300005262 Bacteria 444192
13 Ga0070670_100028401 3300005331 Bacteria 4814
14 Ga0068869_100552241 3300005334 Bacteria 968
15 Ga0070682_100011271 3300005337 Bacteria 5103
16 Ga0070692_10144463 3300005345 Bacteria 1350
17 Ga0070675_100300021 3300005354 Bacteria 1415
18 Ga0070671_100020994 3300005355 Bacteria 5329
19 Ga0070673_100007510 3300005364 Bacteria 7200
20 Ga0070673_100189103 3300005364 Bacteria 1767
21 Ga0070667_100009049 3300005367 Bacteria 8243
22 Ga0070667_100149572 3300005367 Bacteria 2050
23 Ga0070703_10024608 3300005406 Bacteria 1781
24 Ga0070701_10001650 3300005438 Bacteria 8347
25 Ga0070705_101577556 3300005440 Bacteria 552
26 Ga0070700_100374054 3300005441 Bacteria 1063
27 Ga0070694_100156653 3300005444 Bacteria 1668
28 Ga0070694_100572218 3300005444 Bacteria 907
29 Ga0070678_101643552 3300005456 Unclassified 604
30 Ga0070681_10573908 3300005458 Bacteria 1042
31 Ga0068867_100400288 3300005459 Bacteria 1158
32 Ga0070685_10192512 3300005466 Bacteria 1320
33 Ga0070685_11093478 3300005466 Bacteria 602
34 Ga0070699_101115866 3300005518 Unclassified 723
35 Ga0070672_100000590 3300005543 Bacteria 21270
36 Ga0070672_100034708 3300005543 Bacteria 3830
37 Ga0070695_100148903 3300005545 Bacteria 1631
38 Ga0070695_101234887 3300005545 Unclassified 616
39 Ga0070696_100190226 3300005546 Bacteria 1527
40 Ga0068855_100006401 3300005563 Bacteria 14343
41 Ga0068855_101076581 3300005563 Bacteria 841
42 Ga0068857_100924548 3300005577 Unclassified 837
43 Ga0068857_101200109 3300005577 Bacteria 735
44 Ga0068856_100894658 3300005614 Bacteria 907
45 Ga0068859_100011063 3300005617 Bacteria 9076
46 Ga0068859_100039692 3300005617 Bacteria 4723
47 Ga0068864_100000557 3300005618 Bacteria 31825
48 Ga0068861_100001762 3300005719 Bacteria 13906
49 Ga0068863_100000569 3300005841 Bacteria 37520
50 Ga0068858_100000604 3300005842 Bacteria 37527
51 Ga0068860_100039776 3300005843 Bacteria 4497
52 Ga0068862_100026334 3300005844 Bacteria 4888
53 Ga0068862_101541402 3300005844 Bacteria 671
54 Ga0081455_10676925 3300005937 Unclassified 660
55 Ga0068871_100059888 3300006358 Unclassified 3104
56 Ga0075428_100003390 3300006844 Bacteria 17424
57 Ga0075428_100009700 3300006844 Bacteria 10690
58 Ga0075428_100617181 3300006844 Bacteria 1157
59 Ga0075428_101611289 3300006844 Bacteria 679
60 Ga0075430_100801669 3300006846 Bacteria 776
61 Ga0075430_100837339 3300006846 Unclassified 758
62 Ga0075431_101366824 3300006847 Unclassified 668
63 Ga0075429_100003262 3300006880 Bacteria 13824
64 Ga0075429_100785956 3300006880 Bacteria 834
65 Ga0068865_100462697 3300006881 Bacteria 1051
66 Ga0068865_101148143 3300006881 Unclassified 686
67 Ga0097620_100011063 3300006931 Bacteria 9076
68 Ga0097620_100039695 3300006931 Bacteria 4723
69 Ga0097620_102014941 3300006931 Bacteria 637
70 Ga0075435_100085741 3300007076 Bacteria 2592
71 Ga0075435_100197467 3300007076 Bacteria 1704
72 Ga0105250_10028636 3300009092 Bacteria 2243
73 Ga0111539_10184853 3300009094 Bacteria 2434
74 Ga0105247_10011390 3300009101 Bacteria 5362
75 Ga0114129_10186134 3300009147 Bacteria 2822
76 Ga0105243_10890828 3300009148 Bacteria 884
77 Ga0105248_10000070 3300009177 Bacteria 119985
78 Ga0105237_11538447 3300009545 Unclassified 672
79 Ga0105249_10068148 3300009553 Bacteria 3281
80 Ga0105249_10467661 3300009553 Unclassified 1302
81 Ga0105249_13506967 3300009553 Bacteria 505
82 Ga0163162_10016386 3300013306 Bacteria 7244
83 Ga0157375_11400495 3300013308 Bacteria 824
84 Ga0163163_10022419 3300014325 Bacteria 5980
85 Ga0182008_10777703 3300014497 Bacteria 554
86 Ga0157379_10096644 3300014968 Bacteria 2651
87 Ga0157376_10525885 3300014969 Bacteria 1167
88 Ga0157376_10594346 3300014969 Bacteria 1101
89 Ga0214544_1000417 3300021320 Bacteria 76109
90 Ga0209436_100363 3300025208 Bacteria 20485
91 Ga0209130_1000010 3300025284 Bacteria 444920
92 Ga0209676_1029069 3300025292 Bacteria 1712
93 Ga0209025_1000234 3300025294 Bacteria 130341
94 Ga0209564_1000025 3300025295 Bacteria 520535
95 Ga0209050_1016085 3300025298 Bacteria 3088
96 Ga0209256_1000209 3300025299 Bacteria 110253
97 Ga0209256_1000311 3300025299 Bacteria 84751
98 Ga0207426_1000036 3300025302 Bacteria 444920
99 Ga0209257_1003293 3300025304 Bacteria 14078
100 Ga0209257_1045730 3300025304 Bacteria 1269
101 Ga0207696_1039463 3300025711 Bacteria 1388
102 Ga0207710_10125524 3300025900 Bacteria 1229
103 Ga0207671_10977871 3300025914 Unclassified 667
104 Ga0207650_10072091 3300025925 Bacteria 2600
105 Ga0207644_10011297 3300025931 Bacteria 5904
106 Ga0207709_11833610 3300025935 Unclassified 505
107 Ga0207704_10497346 3300025938 Unclassified 982
108 Ga0207691_10006022 3300025940 Bacteria 11708
109 Ga0207691_10058003 3300025940 Bacteria 3522
110 Ga0207691_10593560 3300025940 Bacteria 938
111 Ga0207711_10000051 3300025941 Bacteria 140854
112 Ga0207689_10125034 3300025942 Bacteria 2116
113 Ga0207689_10768773 3300025942 Bacteria 813
114 Ga0207667_10011662 3300025949 Bacteria 10198
115 Ga0207651_10054254 3300025960 Bacteria 2745
116 Ga0207712_10021879 3300025961 Bacteria 4203
117 Ga0207712_11581353 3300025961 Bacteria 587
118 Ga0207668_10177108 3300025972 Bacteria 1678
119 Ga0207658_10006070 3300025986 Bacteria 8249
120 Ga0207658_10213909 3300025986 Bacteria 1617
121 Ga0207703_10052867 3300026035 Bacteria 3300
122 Ga0207708_10032949 3300026075 Unclassified 3935
123 Ga0207641_10002146 3300026088 Bacteria 18591
124 Ga0207641_10887110 3300026088 Bacteria 885
125 Ga0207676_10000139 3300026095 Bacteria 63189
126 Ga0207675_100009223 3300026118 Bacteria 9252
127 Ga0207675_100108918 3300026118 Bacteria 2613
128 Ga0207683_10423703 3300026121 Bacteria 1226
129 Ga0209969_1042667 3300027360 Bacteria 706
130 Ga0209967_1025883 3300027364 Bacteria 869
131 Ga0209971_1023629 3300027682 Bacteria 1467
132 Ga0207428_10012225 3300027907 Bacteria 7550
133 Ga0268265_10074253 3300028380 Bacteria 2659
134 Ga0268265_10524767 3300028380 Bacteria 1120
135 Ga0268264_10005158 3300028381 Bacteria 11071
136 Ga0265337_1007634 3300028556 Bacteria 4029
137 Ga0265334_10007670 3300028573 Bacteria 4622
138 Ga0265320_10000192 3300031240 Bacteria 50468
139 Ga0265320_10000434 3300031240 Bacteria 33028
140 Ga0265339_10236477 3300031249 Bacteria 888
141 Ga0307513_10762561 3300031456 Bacteria 673
142 Ga0307408_100560263 3300031548 Bacteria 1010
143 Ga0265313_10251200 3300031595 Bacteria 721
144 Ga0265314_10079392 3300031711 Bacteria 2169
145 Ga0307410_10256877 3300031852 Bacteria 1361
146 Ga0307406_10003994 3300031901 Bacteria 8023
147 Ga0307407_10022942 3300031903 Bacteria 3248
148 Ga0307415_100054711 3300032126 Bacteria 2726
149 Ga0373925_0148270 3300037068 Bacteria 1840
150 Ga0395900_0204395 3300037418 Bacteria 1997
151 Ga0395905_0903508 3300037471 Bacteria 786
152 Ga0395901_1562488 3300038443 Bacteria 614
153 Ga0451789_0049787 3300041443 Bacteria 693
154 Ga0451837_1134556 3300041494 Bacteria 577
155 Ga0451843_1723263 3300041509 Unclassified 895
156 Ga0451853_3514203 3300041512 Unclassified 1756
157 Ga0439435_0240529 3300042436 Bacteria 607
158 Ga0451576_0168905 3300045051 Bacteria 2283
159 Ga0466967_1606535 3300045976 Unclassified 648
160 Ga0495639_0698967 3300046475 Bacteria 524
161 Ga0495647_0158157 3300046681 Bacteria 975
162 Ga0495686_0003589 3300047472 Bacteria 13323
163 Ga0495686_0015684 3300047472 Bacteria 5165
164 Ga0496109_1334400 3300048912 Unclassified 653
165 Ga0496116_0238129 3300048919 Bacteria 916
166 Ga0501067_0061958 3300049583 Bacteria 2071
167 Ga0501068_0471561 3300049584 Bacteria 813
168 Ga0501071_0064439 3300049587 Bacteria 2659
169 Ga0501072_0107887 3300049588 Unclassified 2215
170 Ga0501073_0396589 3300049589 Bacteria 953
171 Ga0501075_0193859 3300049591 Bacteria 1550
172 Ga0501080_0844312 3300049742 Bacteria 801
173 Ga0501081_0091418 3300049743 Unclassified 2140
174 Ga0501045_0598963 3300049824 Unclassified 816
175 Ga0501226_027153 3300049853 Bacteria 644
176 nmdc:mga05p37_11327_c1 3300050507 Bacteria 10608
177 nmdc:mga05p37_289302_c1 3300050507 Bacteria 1951
178 nmdc:mga09592_310710_c1 3300050508 Bacteria 1366
179 nmdc:mga09592_58505_c1 3300050508 Bacteria 3259
180 nmdc:mga0qj67_136137_c1 3300050509 Bacteria 1990
181 nmdc:mga0qj67_680746_c1 3300050509 Bacteria 819
182 nmdc:mga06r32_368472_c1 3300050510 Bacteria 1420
183 nmdc:mga08y16_160976_c1 3300050511 Bacteria 2332
184 nmdc:mga08y16_17949_c1 3300050511 Bacteria 7454
185 nmdc:mga08y16_182345_c1 3300050511 Bacteria 2180
186 nmdc:mga08y16_835906_c1 3300050511 Bacteria 911
187 nmdc:mga08y16_933452_c1 3300050511 Bacteria 852
188 nmdc:mga0n895_188_c1 3300050512 Bacteria 38251
189 nmdc:mga0rr50_130407_c1 3300050513 Bacteria 2012
190 nmdc:mga0rr50_295155_c1 3300050513 Bacteria 1355
191 nmdc:mga0a205_500_c1 3300050515 Bacteria 30751
192 Ga0495619_0419989 3300053085 Unclassified 923
193 Ga0500595_094499 3300053119 Bacteria 862
194 Ga0500618_036362 3300053125 Bacteria 1141
195 Ga0500552_079206 3300053733 Bacteria 601
196 Ga0501082_1906224 3300060353 Bacteria 518
197 2600196401 2599185352 Bacteria 7228948
198 2643805457 2643221557 Bacteria 7184309
199 2644069247 2643221610 Bacteria 7480339
200 2644379822 2643221668 Bacteria 7306521
201 2644420400 2643221675 Bacteria 7473456
202 2644453926 2643221680 Bacteria 7473610
203 2644674899 2643221723 Bacteria 7095460
204 2644686301 2643221726 Bacteria 7455827
205 2904691322 2904690495 Bacteria 9412302
206 2913296337 2913295892 Bacteria 6333755
207 Ga0307405_11074491
208 JGI25158J39367_1004707
209 JGI25159J45721_1000005
210 JGI25151J46595_10082825
211 rootH1_10163311
212 JGI25160J50197_1000005
213 JGI25161J50226_1000584
214 Ga0055526_1003755
215 Ga0055524_1000939
216 Ga0055524_1040069
217 Ga0055543_1000091
218 Ga0065165_1000002
219 Ga0070670_100028401
220 Ga0068869_100552241
221 Ga0070682_100011271
222 Ga0070692_10144463
223 Ga0070675_100300021
224 Ga0070671_100020994
225 Ga0070673_100007510
226 Ga0070673_100189103
227 Ga0070667_100009049
228 Ga0070667_100149572
229 Ga0070703_10024608
230 Ga0070701_10001650
231 Ga0070705_101577556
232 Ga0070700_100374054
233 Ga0070694_100156653
234 Ga0070694_100572218
235 Ga0070678_101643552
236 Ga0070681_10573908
237 Ga0068867_100400288
238 Ga0070685_10192512
239 Ga0070685_11093478
240 Ga0070699_101115866
241 Ga0070672_100000590
242 Ga0070672_100034708
243 Ga0070695_100148903
244 Ga0070695_101234887
245 Ga0070696_100190226
246 Ga0068855_100006401
247 Ga0068855_101076581
248 Ga0068857_100924548
249 Ga0068857_101200109
250 Ga0068856_100894658
251 Ga0068859_100011063
252 Ga0068859_100039692
253 Ga0068864_100000557
254 Ga0068861_100001762
255 Ga0068863_100000569
256 Ga0068858_100000604
257 Ga0068860_100039776
258 Ga0068862_100026334
259 Ga0068862_101541402
260 Ga0081455_10676925
261 Ga0068871_100059888
262 Ga0075428_100003390
263 Ga0075428_100009700
264 Ga0075428_100617181
265 Ga0075428_101611289
266 Ga0075430_100801669
267 Ga0075430_100837339
268 Ga0075431_101366824
269 Ga0075429_100003262
270 Ga0075429_100785956
271 Ga0068865_100462697
272 Ga0068865_101148143
273 Ga0097620_100011063
274 Ga0097620_100039695
275 Ga0097620_102014941
276 Ga0075435_100085741
277 Ga0075435_100197467
278 Ga0105250_10028636
279 Ga0111539_10184853
280 Ga0105247_10011390
281 Ga0114129_10186134
282 Ga0105243_10890828
283 Ga0105248_10000070
284 Ga0105237_11538447
285 Ga0105249_10068148
286 Ga0105249_10467661
287 Ga0105249_13506967
288 Ga0163162_10016386
289 Ga0157375_11400495
290 Ga0163163_10022419
291 Ga0182008_10777703
292 Ga0157379_10096644
293 Ga0157376_10525885
294 Ga0157376_10594346
295 Ga0214544_1000417
296 Ga0209436_100363
297 Ga0209130_1000010
298 Ga0209676_1029069
299 Ga0209025_1000234
300 Ga0209564_1000025
301 Ga0209050_1016085
302 Ga0209256_1000209
303 Ga0209256_1000311
304 Ga0207426_1000036
305 Ga0209257_1003293
306 Ga0209257_1045730
307 Ga0207696_1039463
308 Ga0207710_10125524
309 Ga0207671_10977871
310 Ga0207650_10072091
311 Ga0207644_10011297
312 Ga0207709_11833610
313 Ga0207704_10497346
314 Ga0207691_10006022
315 Ga0207691_10058003
316 Ga0207691_10593560
317 Ga0207711_10000051
318 Ga0207689_10125034
319 Ga0207689_10768773
320 Ga0207667_10011662
321 Ga0207651_10054254
322 Ga0207712_10021879
323 Ga0207712_11581353
324 Ga0207668_10177108
325 Ga0207658_10006070
326 Ga0207658_10213909
327 Ga0207703_10052867
328 Ga0207708_10032949
329 Ga0207641_10002146
330 Ga0207641_10887110
331 Ga0207676_10000139
332 Ga0207675_100009223
333 Ga0207675_100108918
334 Ga0207683_10423703
335 Ga0209969_1042667
336 Ga0209967_1025883
337 Ga0209971_1023629
338 Ga0207428_10012225
339 Ga0268265_10074253
340 Ga0268265_10524767
341 Ga0268264_10005158
342 Ga0265337_1007634
343 Ga0265334_10007670
344 Ga0265320_10000192
345 Ga0265320_10000434
346 Ga0265339_10236477
347 Ga0307513_10762561
348 Ga0307408_100560263
349 Ga0265313_10251200
350 Ga0265314_10079392
351 Ga0307410_10256877
352 Ga0307406_10003994
353 Ga0307407_10022942
354 Ga0307415_100054711
355 Ga0373925_0148270
356 Ga0395900_0204395
357 Ga0395905_0903508
358 Ga0395901_1562488
359 Ga0451789_0049787
360 Ga0451837_1134556
361 Ga0451843_1723263
362 Ga0451853_3514203
363 Ga0439435_0240529
364 Ga0451576_0168905
365 Ga0466967_1606535
366 Ga0495639_0698967
367 Ga0495647_0158157
368 Ga0495686_0003589
369 Ga0495686_0015684
370 Ga0496109_1334400
371 Ga0496116_0238129
372 Ga0501067_0061958
373 Ga0501068_0471561
374 Ga0501071_0064439
375 Ga0501072_0107887
376 Ga0501073_0396589
377 Ga0501075_0193859
378 Ga0501080_0844312
379 Ga0501081_0091418
380 Ga0501045_0598963
381 Ga0501226_027153
382 nmdc:mga05p37_11327_c1
383 nmdc:mga05p37_289302_c1
384 nmdc:mga09592_310710_c1
385 nmdc:mga09592_58505_c1
386 nmdc:mga0qj67_136137_c1
387 nmdc:mga0qj67_680746_c1
388 nmdc:mga06r32_368472_c1
389 nmdc:mga08y16_160976_c1
390 nmdc:mga08y16_17949_c1
391 nmdc:mga08y16_182345_c1
392 nmdc:mga08y16_835906_c1
393 nmdc:mga08y16_933452_c1
394 nmdc:mga0n895_188_c1
395 nmdc:mga0rr50_130407_c1
396 nmdc:mga0rr50_295155_c1
397 nmdc:mga0a205_500_c1
398 Ga0495619_0419989
399 Ga0500595_094499
400 Ga0500618_036362
401 Ga0500552_079206
402 Ga0501082_1906224
403 2600196401
404 2643805457
405 2644069247
406 2644379822
407 2644420400
408 2644453926
409 2644674899
410 2644686301
411 2904691322
412 2913296337

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04828

GFA

Glutathione-dependent formaldehyde-activating enzyme

27

117

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
8ajq-assembly3.cif.gz_E crystal structure of pa2722 from pseudomonas aeruginosa pao1 0.8527 6 131
4wac-assembly1.cif.gz_A crystal structure of tarm 0.845 62 88
3fac-assembly8.cif.gz_H crystal structure of rhodobacter sphaeroides protein rsp_2168. northeast structural genomics target rhr83. 0.8285 8 105
1xa8-assembly1.cif.gz_A crystal structure analysis of glutathione-dependent formaldehyde-activating enzyme (gfa) 0.819 1 116
8p1x-assembly1.cif.gz_AAA tarm(se)_g117r-udp-glucose 0.7997 61 88
ID Description Score Start End Superfamily
af_O14034_2_133_3.90.1590.10 Alpha Beta;Alpha-Beta Complex;glutathione-dependent formaldehyde- activating enzyme (gfa);glutathione-dependent formaldehyde- activating enzyme (gfa) 0.8725 6 128 3.90.1590.10
af_Q54MP8_632_796_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.8343 61 88 2.130.10.10
3facD00 Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A; 0.8267 8 105 2.170.150.70
af_Q2FZM7_1_163_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.8189 62 88 3.40.50.2000
af_O14034_2_133_3.90.1590.10 Alpha Beta;Alpha-Beta Complex;glutathione-dependent formaldehyde- activating enzyme (gfa);glutathione-dependent formaldehyde- activating enzyme (gfa) 0.8114 6 128 3.90.1590.10
ID Description Score Start End GO Terms
AF-A0A530AJC1-F1-model_v4 GFA family protein 0.9943 6 112 GO:0016846
GO:0046872
AF-A0A530GKI3-F1-model_v4 GFA family protein 0.9931 6 101 GO:0016846
GO:0046872
AF-A0A1M6W7J2-F1-model_v4 Uncharacterized conserved protein 0.9882 6 144 GO:0016846
GO:0046872
AF-A0A4R3GC13-F1-model_v4 deleted 0.9836 27 144
AF-A0A534CDJ5-F1-model_v4 CENP-V/GFA domain-containing protein 0.9836 6 92 GO:0016846
GO:0046872

Map