F315311

General Info

Members Datasets Scaffolds Average Seq Length
206 157 412 134

Family's Representative Sequence

Representative Sequence 3300031731|Ga0307405_10000586|Ga0307405_100005865
Length 152
Sequence MKHAIAHVALVVRDYDEAIAFYTQKLGFTLVEDTYQPEQDKRWVTVAPAGASGTTLLLARASTPEQARFIGDQAGGRVFLFLRTDDFWRDYQRMTAAGVSFVRPPTVAPYGTVAVFEDLYGNRWDLIEYGGQGREDIAVLPGDAPLGPPPAP

Samples

Sample ID Description Type Environment
1 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
6 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
7 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
8 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
9 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
27 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
35 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
36 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
37 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
38 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
39 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
41 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
42 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
43 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
44 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
45 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
46 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
47 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
48 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
49 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
50 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
51 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
52 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
53 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
54 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
55 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
56 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
57 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
58 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
59 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
86 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
87 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
88 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
89 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
90 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
91 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
92 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
93 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
94 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
95 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
96 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
97 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
98 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
99 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
100 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
101 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
102 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
103 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
104 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
105 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
106 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
107 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
108 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
109 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
110 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
111 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
112 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
113 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
114 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
115 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
116 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
117 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
118 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
119 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
120 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
121 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
122 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
123 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
124 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
125 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
126 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
127 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
128 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
129 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
130 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
131 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
132 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
133 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
134 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
135 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
136 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
137 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
138 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
139 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
140 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
141 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
142 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
144 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
145 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
146 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
147 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
148 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
149 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
150 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
151 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
152 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
153 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
154 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
155 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
156 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
157 2643221693 Rhizobium sp. Root491 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.06
Metatranscriptomes 0.97
Isolates 0.97

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.34
Nodule 0
Rhizoplane 1.46
Rhizosphere 89.32
Stem 0
Stem Tuber 0
Unclassified 6.31

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307405_10000586 3300031731 Bacteria 13951
2 JGI24739J22299_10000269 3300001989 Bacteria 17471
3 JGI24739J22299_10002648 3300001989 Bacteria 6891
4 JGI24737J22298_10001237 3300001990 Bacteria 9021
5 JGI24735J21928_10002379 3300002067 Bacteria 6546
6 JGI24738J21930_10000843 3300002075 Bacteria 8772
7 JGI24744J21845_10000608 3300002077 Bacteria 6487
8 JGI25164J39214_1015981 3300002772 Bacteria 686
9 JGI25165J46597_1000106 3300003214 Bacteria 151139
10 rootH1_10041362 3300003323 Bacteria 3368
11 Ga0070658_10002456 3300005327 Bacteria 15507
12 Ga0070683_100001030 3300005329 Bacteria 20924
13 Ga0070677_10000549 3300005333 Bacteria 12833
14 Ga0068869_100129518 3300005334 Bacteria 1938
15 Ga0070660_100087505 3300005339 Bacteria 2452
16 Ga0070660_100180376 3300005339 Unclassified 1709
17 Ga0070660_100200661 3300005339 Bacteria 1618
18 Ga0070661_100000003 3300005344 Bacteria 254653
19 Ga0070692_10028759 3300005345 Bacteria 2765
20 Ga0070668_100367500 3300005347 Bacteria 1221
21 Ga0070674_100713979 3300005356 Unclassified 858
22 Ga0070673_100815470 3300005364 Unclassified 862
23 Ga0070688_101077802 3300005365 Bacteria 641
24 Ga0070659_100009361 3300005366 Bacteria 7195
25 Ga0070659_100197329 3300005366 Bacteria 1656
26 Ga0070667_100292423 3300005367 Bacteria 1465
27 Ga0070694_101703581 3300005444 Bacteria 536
28 Ga0070678_100111250 3300005456 Bacteria 2143
29 Ga0070662_100099093 3300005457 Bacteria 2203
30 Ga0070685_10765339 3300005466 Bacteria 709
31 Ga0070706_100433533 3300005467 Unclassified 1223
32 Ga0070698_101744778 3300005471 Bacteria 575
33 Ga0070684_100007828 3300005535 Bacteria 8334
34 Ga0068853_101246427 3300005539 Bacteria 718
35 Ga0070665_100000303 3300005548 Bacteria 76933
36 Ga0070665_100000317 3300005548 Bacteria 74997
37 Ga0070665_100279186 3300005548 Bacteria 1672
38 Ga0068855_100000048 3300005563 Bacteria 145334
39 Ga0068855_100029130 3300005563 Bacteria 6603
40 Ga0068855_100740479 3300005563 Bacteria 1049
41 Ga0068856_100076298 3300005614 Bacteria 3321
42 Ga0068856_100442482 3300005614 Unclassified 1320
43 Ga0068861_100708682 3300005719 Bacteria 936
44 Ga0070716_100528788 3300006173 Bacteria 875
45 Ga0075428_101794791 3300006844 Bacteria 639
46 Ga0075431_100019772 3300006847 Bacteria 6873
47 Ga0105240_10309205 3300009093 Bacteria 1805
48 Ga0105240_10882839 3300009093 Bacteria 963
49 Ga0114129_10301183 3300009147 Bacteria 2137
50 Ga0105241_10017214 3300009174 Bacteria 5308
51 Ga0105248_10059397 3300009177 Bacteria 4295
52 Ga0105238_10031105 3300009551 Bacteria 5434
53 Ga0105238_10478908 3300009551 Bacteria 1244
54 Ga0105238_10581916 3300009551 Bacteria 1126
55 Ga0105249_10002001 3300009553 Bacteria 17711
56 Ga0105249_10242034 3300009553 Unclassified 1784
57 Ga0157370_10000462 3300013104 Bacteria 50795
58 Ga0157370_10086599 3300013104 Bacteria 2943
59 Ga0157369_10013841 3300013105 Bacteria 9117
60 Ga0157369_10234572 3300013105 Bacteria 1917
61 Ga0157378_10431248 3300013297 Unclassified 1304
62 Ga0157378_11385281 3300013297 Bacteria 746
63 Ga0163162_11273121 3300013306 Bacteria 835
64 Ga0157372_10013283 3300013307 Bacteria 8789
65 Ga0157375_12098518 3300013308 Bacteria 673
66 Ga0163163_10598997 3300014325 Unclassified 1165
67 Ga0157380_10111525 3300014326 Bacteria 2299
68 Ga0206354_10455892 3300020081 Bacteria 1530
69 Ga0206353_11989462 3300020082 Bacteria 1528
70 Ga0213876_10057319 3300021384 Unclassified 2057
71 Ga0207427_100586 3300025231 Bacteria 18316
72 Ga0209026_1010546 3300025250 Bacteria 1718
73 Ga0209026_1046057 3300025250 Bacteria 626
74 Ga0209148_1001365 3300025254 Bacteria 12736
75 Ga0209233_1000003 3300025261 Bacteria 1607366
76 Ga0209455_1000265 3300025272 Bacteria 59804
77 Ga0207682_10006559 3300025893 Bacteria 4684
78 Ga0207647_10000348 3300025904 Bacteria 37517
79 Ga0207647_10008260 3300025904 Bacteria 7475
80 Ga0207705_10001719 3300025909 Bacteria 17362
81 Ga0207684_11071727 3300025910 Unclassified 672
82 Ga0207654_10025687 3300025911 Bacteria 3180
83 Ga0207695_10239894 3300025913 Bacteria 1714
84 Ga0207657_10042321 3300025919 Bacteria 4020
85 Ga0207657_10164829 3300025919 Bacteria 1798
86 Ga0207649_10000016 3300025920 Bacteria 243843
87 Ga0207694_10024413 3300025924 Bacteria 4592
88 Ga0207694_10338236 3300025924 Bacteria 1244
89 Ga0207690_10004206 3300025932 Bacteria 8507
90 Ga0207690_10289404 3300025932 Bacteria 1278
91 Ga0207706_10006596 3300025933 Bacteria 10749
92 Ga0207669_10550769 3300025937 Unclassified 931
93 Ga0207711_10025851 3300025941 Bacteria 4923
94 Ga0207661_10003136 3300025944 Bacteria 11458
95 Ga0207667_10000023 3300025949 Bacteria 362527
96 Ga0207667_10078489 3300025949 Bacteria 3422
97 Ga0207651_10358753 3300025960 Unclassified 1230
98 Ga0207712_10000847 3300025961 Bacteria 22346
99 Ga0207668_10042992 3300025972 Bacteria 3063
100 Ga0207668_10435666 3300025972 Bacteria 1115
101 Ga0207640_11272352 3300025981 Bacteria 656
102 Ga0207702_10048468 3300026078 Bacteria 3583
103 Ga0207702_10566997 3300026078 Bacteria 1112
104 Ga0207648_10047576 3300026089 Bacteria 3759
105 Ga0207683_10036446 3300026121 Bacteria 4283
106 Ga0207698_10470672 3300026142 Bacteria 1217
107 Ga0268266_10001868 3300028379 Bacteria 23785
108 Ga0268266_10390525 3300028379 Bacteria 1314
109 Ga0268264_10281439 3300028381 Bacteria 1558
110 Ga0307513_10412350 3300031456 Bacteria 1083
111 Ga0307408_100010434 3300031548 Bacteria 6127
112 Ga0307408_102112955 3300031548 Bacteria 543
113 Ga0316579_10499338 3300031691 Bacteria 589
114 Ga0316576_10062432 3300031727 Bacteria 2733
115 Ga0307405_10004256 3300031731 Bacteria 6735
116 Ga0316577_10108455 3300031733 Bacteria 1558
117 Ga0307413_10006137 3300031824 Bacteria 5454
118 Ga0307413_11609474 3300031824 Bacteria 577
119 Ga0307410_10001981 3300031852 Bacteria 9632
120 Ga0307410_10003857 3300031852 Bacteria 7621
121 Ga0307410_10299308 3300031852 Bacteria 1269
122 Ga0307410_10486531 3300031852 Bacteria 1013
123 Ga0307406_10024661 3300031901 Bacteria 3594
124 Ga0307406_10328026 3300031901 Bacteria 1187
125 Ga0307406_10464736 3300031901 Bacteria 1018
126 Ga0307407_10011181 3300031903 Bacteria 4260
127 Ga0307412_10005688 3300031911 Bacteria 7008
128 Ga0307412_10009379 3300031911 Bacteria 5614
129 Ga0307412_10190151 3300031911 Bacteria 1551
130 Ga0307409_100004959 3300031995 Bacteria 7576
131 Ga0307409_100974214 3300031995 Bacteria 865
132 Ga0307416_100000912 3300032002 Bacteria 15587
133 Ga0307416_100188170 3300032002 Bacteria 1943
134 Ga0307416_101173949 3300032002 Bacteria 873
135 Ga0307414_10016820 3300032004 Bacteria 4459
136 Ga0307411_10000320 3300032005 Bacteria 15972
137 Ga0307411_10034848 3300032005 Bacteria 3136
138 Ga0307411_10178803 3300032005 Bacteria 1608
139 Ga0307415_100023666 3300032126 Bacteria 3818
140 Ga0316582_0250912 3300036647 Bacteria 1213
141 Ga0395899_0001153 3300037312 Bacteria 23326
142 Ga0395900_0051799 3300037418 Bacteria 4227
143 Ga0395900_0128301 3300037418 Bacteria 2600
144 Ga0395905_1683910 3300037471 Bacteria 539
145 Ga0395901_0060639 3300038443 Bacteria 3937
146 Ga0436365_0830566 3300039437 Bacteria 2548
147 Ga0451793_1300821 3300041452 Bacteria 940
148 Ga0451804_0611089 3300041463 Bacteria 813
149 Ga0451577_0029332 3300042876 Bacteria 4972
150 Ga0466965_0347575 3300044683 Bacteria 812
151 Ga0466961_0057402 3300044693 Bacteria 2478
152 Ga0466963_0008585 3300044694 Bacteria 6133
153 Ga0453684_0410728 3300044712 Bacteria 1514
154 Ga0453684_1157060 3300044712 Unclassified 814
155 Ga0466971_0000833 3300044719 Bacteria 12516
156 Ga0466957_0014204 3300044842 Bacteria 4635
157 Ga0451576_0682423 3300045051 Bacteria 1079
158 Ga0451576_0809248 3300045051 Bacteria 984
159 Ga0451576_1228322 3300045051 Bacteria 782
160 Ga0466958_0003823 3300045836 Bacteria 7863
161 Ga0466967_1754318 3300045976 Bacteria 618
162 Ga0495585_0065876 3300046492 Bacteria 1984
163 Ga0495606_0228056 3300046507 Bacteria 1046
164 Ga0495656_0157504 3300046615 Bacteria 1101
165 Ga0495668_0001582 3300046616 Bacteria 21462
166 Ga0495668_0140602 3300046616 Bacteria 1321
167 Ga0495625_0136064 3300046660 Bacteria 1661
168 Ga0495672_0306562 3300047320 Bacteria 750
169 Ga0495686_0205456 3300047472 Bacteria 1128
170 Ga0495615_0023049 3300048090 Bacteria 1423
171 Ga0496109_1092640 3300048912 Bacteria 735
172 Ga0501032_0020373 3300049569 Bacteria 4619
173 Ga0501034_1315063 3300049571 Bacteria 599
174 Ga0501036_0023610 3300049572 Bacteria 5182
175 Ga0501037_0161402 3300049573 Bacteria 1598
176 Ga0501038_0156086 3300049574 Bacteria 1858
177 Ga0501043_0022834 3300049579 Bacteria 4905
178 Ga0501047_0003056 3300049581 Bacteria 15875
179 Ga0501068_0053081 3300049584 Bacteria 2453
180 Ga0501070_0125936 3300049586 Bacteria 2117
181 Ga0501073_0001600 3300049589 Bacteria 16770
182 Ga0501073_0009089 3300049589 Bacteria 7334
183 Ga0501074_0014372 3300049590 Bacteria 5761
184 Ga0501225_0030297 3300049705 Bacteria 1489
185 Ga0501080_0019898 3300049742 Bacteria 6216
186 Ga0501083_0007578 3300049744 Bacteria 7690
187 Ga0501035_0192090 3300049822 Bacteria 1755
188 Ga0501044_0024922 3300049823 Bacteria 6344
189 Ga0501045_0414471 3300049824 Bacteria 1002
190 Ga0501204_084206 3300049850 Bacteria 545
191 nmdc:mga07m45_619361_c1 3300050496 Bacteria 625
192 nmdc:mga05p37_171254_c1 3300050507 Bacteria 2647
193 nmdc:mga05p37_198728_c1 3300050507 Bacteria 2430
194 nmdc:mga06r32_1061539_c1 3300050510 Bacteria 760
195 nmdc:mga06r32_39341_c1 3300050510 Bacteria 4486
196 nmdc:mga0a205_17765_c1 3300050515 Bacteria 6675
197 Ga0500646_0223939 3300053090 Bacteria 653
198 Ga0500647_0030468 3300053091 Bacteria 2563
199 Ga0500658_0136393 3300053134 Bacteria 1098
200 Ga0500622_0028074 3300053156 Bacteria 2963
201 Ga0501084_1456704 3300054114 Bacteria 573
202 Ga0501084_1624719 3300054114 Bacteria 540
203 Ga0501082_0511868 3300060353 Bacteria 1049
204 Ga0466962_0000862 3300061719 Bacteria 13747
205 2644194948 2643221634 Bacteria 6705461
206 2644520053 2643221693 Bacteria 5513853
207 Ga0307405_10000586
208 JGI24739J22299_10000269
209 JGI24739J22299_10002648
210 JGI24737J22298_10001237
211 JGI24735J21928_10002379
212 JGI24738J21930_10000843
213 JGI24744J21845_10000608
214 JGI25164J39214_1015981
215 JGI25165J46597_1000106
216 rootH1_10041362
217 Ga0070658_10002456
218 Ga0070683_100001030
219 Ga0070677_10000549
220 Ga0068869_100129518
221 Ga0070660_100087505
222 Ga0070660_100180376
223 Ga0070660_100200661
224 Ga0070661_100000003
225 Ga0070692_10028759
226 Ga0070668_100367500
227 Ga0070674_100713979
228 Ga0070673_100815470
229 Ga0070688_101077802
230 Ga0070659_100009361
231 Ga0070659_100197329
232 Ga0070667_100292423
233 Ga0070694_101703581
234 Ga0070678_100111250
235 Ga0070662_100099093
236 Ga0070685_10765339
237 Ga0070706_100433533
238 Ga0070698_101744778
239 Ga0070684_100007828
240 Ga0068853_101246427
241 Ga0070665_100000303
242 Ga0070665_100000317
243 Ga0070665_100279186
244 Ga0068855_100000048
245 Ga0068855_100029130
246 Ga0068855_100740479
247 Ga0068856_100076298
248 Ga0068856_100442482
249 Ga0068861_100708682
250 Ga0070716_100528788
251 Ga0075428_101794791
252 Ga0075431_100019772
253 Ga0105240_10309205
254 Ga0105240_10882839
255 Ga0114129_10301183
256 Ga0105241_10017214
257 Ga0105248_10059397
258 Ga0105238_10031105
259 Ga0105238_10478908
260 Ga0105238_10581916
261 Ga0105249_10002001
262 Ga0105249_10242034
263 Ga0157370_10000462
264 Ga0157370_10086599
265 Ga0157369_10013841
266 Ga0157369_10234572
267 Ga0157378_10431248
268 Ga0157378_11385281
269 Ga0163162_11273121
270 Ga0157372_10013283
271 Ga0157375_12098518
272 Ga0163163_10598997
273 Ga0157380_10111525
274 Ga0206354_10455892
275 Ga0206353_11989462
276 Ga0213876_10057319
277 Ga0207427_100586
278 Ga0209026_1010546
279 Ga0209026_1046057
280 Ga0209148_1001365
281 Ga0209233_1000003
282 Ga0209455_1000265
283 Ga0207682_10006559
284 Ga0207647_10000348
285 Ga0207647_10008260
286 Ga0207705_10001719
287 Ga0207684_11071727
288 Ga0207654_10025687
289 Ga0207695_10239894
290 Ga0207657_10042321
291 Ga0207657_10164829
292 Ga0207649_10000016
293 Ga0207694_10024413
294 Ga0207694_10338236
295 Ga0207690_10004206
296 Ga0207690_10289404
297 Ga0207706_10006596
298 Ga0207669_10550769
299 Ga0207711_10025851
300 Ga0207661_10003136
301 Ga0207667_10000023
302 Ga0207667_10078489
303 Ga0207651_10358753
304 Ga0207712_10000847
305 Ga0207668_10042992
306 Ga0207668_10435666
307 Ga0207640_11272352
308 Ga0207702_10048468
309 Ga0207702_10566997
310 Ga0207648_10047576
311 Ga0207683_10036446
312 Ga0207698_10470672
313 Ga0268266_10001868
314 Ga0268266_10390525
315 Ga0268264_10281439
316 Ga0307513_10412350
317 Ga0307408_100010434
318 Ga0307408_102112955
319 Ga0316579_10499338
320 Ga0316576_10062432
321 Ga0307405_10004256
322 Ga0316577_10108455
323 Ga0307413_10006137
324 Ga0307413_11609474
325 Ga0307410_10001981
326 Ga0307410_10003857
327 Ga0307410_10299308
328 Ga0307410_10486531
329 Ga0307406_10024661
330 Ga0307406_10328026
331 Ga0307406_10464736
332 Ga0307407_10011181
333 Ga0307412_10005688
334 Ga0307412_10009379
335 Ga0307412_10190151
336 Ga0307409_100004959
337 Ga0307409_100974214
338 Ga0307416_100000912
339 Ga0307416_100188170
340 Ga0307416_101173949
341 Ga0307414_10016820
342 Ga0307411_10000320
343 Ga0307411_10034848
344 Ga0307411_10178803
345 Ga0307415_100023666
346 Ga0316582_0250912
347 Ga0395899_0001153
348 Ga0395900_0051799
349 Ga0395900_0128301
350 Ga0395905_1683910
351 Ga0395901_0060639
352 Ga0436365_0830566
353 Ga0451793_1300821
354 Ga0451804_0611089
355 Ga0451577_0029332
356 Ga0466965_0347575
357 Ga0466961_0057402
358 Ga0466963_0008585
359 Ga0453684_0410728
360 Ga0453684_1157060
361 Ga0466971_0000833
362 Ga0466957_0014204
363 Ga0451576_0682423
364 Ga0451576_0809248
365 Ga0451576_1228322
366 Ga0466958_0003823
367 Ga0466967_1754318
368 Ga0495585_0065876
369 Ga0495606_0228056
370 Ga0495656_0157504
371 Ga0495668_0001582
372 Ga0495668_0140602
373 Ga0495625_0136064
374 Ga0495672_0306562
375 Ga0495686_0205456
376 Ga0495615_0023049
377 Ga0496109_1092640
378 Ga0501032_0020373
379 Ga0501034_1315063
380 Ga0501036_0023610
381 Ga0501037_0161402
382 Ga0501038_0156086
383 Ga0501043_0022834
384 Ga0501047_0003056
385 Ga0501068_0053081
386 Ga0501070_0125936
387 Ga0501073_0001600
388 Ga0501073_0009089
389 Ga0501074_0014372
390 Ga0501225_0030297
391 Ga0501080_0019898
392 Ga0501083_0007578
393 Ga0501035_0192090
394 Ga0501044_0024922
395 Ga0501045_0414471
396 Ga0501204_084206
397 nmdc:mga07m45_619361_c1
398 nmdc:mga05p37_171254_c1
399 nmdc:mga05p37_198728_c1
400 nmdc:mga06r32_1061539_c1
401 nmdc:mga06r32_39341_c1
402 nmdc:mga0a205_17765_c1
403 Ga0500646_0223939
404 Ga0500647_0030468
405 Ga0500658_0136393
406 Ga0500622_0028074
407 Ga0501084_1456704
408 Ga0501084_1624719
409 Ga0501082_0511868
410 Ga0466962_0000862
411 2644194948
412 2644520053

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

4

126

0.96

PF18029

Glyoxalase_6

Glyoxalase-like domain

7

127

0.89

PF13669

Glyoxalase_4

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

6

116

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
5ump-assembly1.cif.gz_B crystal structure of tnms3, an antibiotic binding protein from streptomyces sp. cb03234 0.861 2 134
5ujp-assembly1.cif.gz_B the crystal structure of a glyoxalase/bleomycin resistance protein from streptomyces sp. cb03234 0.842 4 132
5ujp-assembly1.cif.gz_B the crystal structure of a glyoxalase/bleomycin resistance protein from streptomyces sp. cb03234 0.8355 4 132
5ump-assembly1.cif.gz_B crystal structure of tnms3, an antibiotic binding protein from streptomyces sp. cb03234 0.8348 2 134
4g6x-assembly1.cif.gz_A-2 crystal structure of glyoxalase/bleomycin resistance protein from catenulispora acidiphila. 0.8346 1 133
ID Description Score Start End Superfamily
2pjsB01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8918 84 132 3.10.180.10
3itwA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8881 84 134 3.30.720.110
3m2oB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8855 81 132 3.30.720.110
3m2oB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8701 81 132 3.30.720.110
5uhjB00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8438 1 134 3.10.180.10
ID Description Score Start End GO Terms
AF-W2EY14-F1-model_v4 VOC domain-containing protein 1.005 81 134
AF-A0A268JTP9-F1-model_v4 VOC domain-containing protein 0.9999 73 134
AF-A0A354Z613-F1-model_v4 Extradiol dioxygenase 0.9878 69 134 GO:0051213
AF-A0A1L8TP16-F1-model_v4 VOC domain-containing protein 0.9869 1 134
AF-A0A128F373-F1-model_v4 VOC domain-containing protein 0.9869 61 134

Map