F315124

General Info

Members Datasets Scaffolds Average Seq Length
206 125 412 148

Family's Representative Sequence

Representative Sequence 3300013306|Ga0163162_11485469|Ga0163162_114854691
Length 150
Sequence MGSILNEKDRAEILRRFDSLSPSAAGRWGTLDVVGMLQHLQLSARMTLGDLPVPSANKRVFQMFPLKHLILYVLPFPKGAPTAPELKPVAAPAESFAAERAALLEMLERIGAGPSDGAGPAHPLFGPLTWREWGVITYKHADHHLKQFGV

Samples

Sample ID Description Type Environment
1 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
18 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
19 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
23 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
24 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
25 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
26 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
27 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
32 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
33 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
34 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
35 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
36 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
37 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
38 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
39 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
40 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
41 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
42 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
43 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
44 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
45 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
46 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
48 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
49 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
51 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
52 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
53 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
54 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
55 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
56 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
57 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
58 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
59 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
60 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
61 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
62 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
63 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
64 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
65 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
66 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
67 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
98 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
99 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
100 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
101 3300038699 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot26 Metagenome Rhizosphere
102 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
103 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
104 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
105 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
106 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
107 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
108 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
109 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
110 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
111 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
112 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
113 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
114 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
115 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
116 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
117 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
118 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
119 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
120 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
121 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
122 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
123 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
124 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
125 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.49
Rhizosphere 99.51
Stem 0
Stem Tuber 0
Unclassified 31.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0163162_11485469 3300013306 Unclassified 772
2 MBSR1b_contig_6096180 2162886012 Unclassified 839
3 Ga0065704_10120788 3300005289 Bacteria 1757
4 Ga0065704_10222165 3300005289 Unclassified 1070
5 Ga0065704_10229245 3300005289 Unclassified 1033
6 Ga0065715_10276583 3300005293 Bacteria 1097
7 Ga0065707_10008300 3300005295 Bacteria 3017
8 Ga0065707_10212125 3300005295 Bacteria 1235
9 Ga0065707_10789237 3300005295 Unclassified 603
10 Ga0070676_10073551 3300005328 Bacteria 2056
11 Ga0070670_100264415 3300005331 Unclassified 1500
12 Ga0068869_100004892 3300005334 Bacteria 8380
13 Ga0068869_100337551 3300005334 Bacteria 1226
14 Ga0068869_101197522 3300005334 Unclassified 667
15 Ga0070680_100352285 3300005336 Unclassified 1252
16 Ga0070689_101354977 3300005340 Bacteria 642
17 Ga0070687_100154298 3300005343 Unclassified 1351
18 Ga0070687_100702158 3300005343 Unclassified 707
19 Ga0070692_10006967 3300005345 Bacteria 4948
20 Ga0070692_10012730 3300005345 Bacteria 3905
21 Ga0070692_10082749 3300005345 Unclassified 1731
22 Ga0070692_10186392 3300005345 Bacteria 1206
23 Ga0070692_10365315 3300005345 Bacteria 901
24 Ga0070669_100065454 3300005353 Bacteria 2678
25 Ga0070669_100670376 3300005353 Bacteria 874
26 Ga0070674_100320584 3300005356 Bacteria 1242
27 Ga0070673_100120789 3300005364 Bacteria 2185
28 Ga0070659_100768395 3300005366 Unclassified 836
29 Ga0070705_100354853 3300005440 Unclassified 1070
30 Ga0070705_100886398 3300005440 Unclassified 716
31 Ga0070700_100021594 3300005441 Bacteria 3744
32 Ga0070700_100793482 3300005441 Unclassified 762
33 Ga0070694_100003543 3300005444 Bacteria 9334
34 Ga0070694_100065887 3300005444 Bacteria 2483
35 Ga0070694_100125845 3300005444 Bacteria 1845
36 Ga0070694_100236872 3300005444 Bacteria 1375
37 Ga0070694_101134539 3300005444 Bacteria 653
38 Ga0070662_100869649 3300005457 Unclassified 768
39 Ga0068867_100202335 3300005459 Bacteria 1590
40 Ga0068867_100245089 3300005459 Bacteria 1455
41 Ga0068867_100518303 3300005459 Bacteria 1028
42 Ga0068867_100856921 3300005459 Unclassified 814
43 Ga0070698_100491704 3300005471 Unclassified 1164
44 Ga0070697_100263883 3300005536 Bacteria 1475
45 Ga0070686_100065140 3300005544 Bacteria 2366
46 Ga0070695_100023844 3300005545 Bacteria 3767
47 Ga0070695_100102725 3300005545 Unclassified 1928
48 Ga0070695_100273773 3300005545 Unclassified 1238
49 Ga0070695_100492093 3300005545 Unclassified 947
50 Ga0070695_100967904 3300005545 Bacteria 691
51 Ga0070696_100574756 3300005546 Unclassified 906
52 Ga0070696_100593465 3300005546 Bacteria 892
53 Ga0070704_100094731 3300005549 Bacteria 2234
54 Ga0068855_100684105 3300005563 Bacteria 1099
55 Ga0068855_102289217 3300005563 Unclassified 541
56 Ga0068857_100281677 3300005577 Unclassified 1529
57 Ga0068856_100012368 3300005614 Bacteria 8267
58 Ga0068852_100470774 3300005616 Bacteria 1247
59 Ga0068859_100053389 3300005617 Bacteria 4065
60 Ga0068859_100168938 3300005617 Unclassified 2268
61 Ga0068859_100263606 3300005617 Bacteria 1815
62 Ga0068859_100502399 3300005617 Bacteria 1308
63 Ga0068859_102424535 3300005617 Unclassified 578
64 Ga0068864_100019394 3300005618 Bacteria 5688
65 Ga0068864_101143083 3300005618 Unclassified 776
66 Ga0068861_100011772 3300005719 Bacteria 6088
67 Ga0068861_100164142 3300005719 Bacteria 1835
68 Ga0068851_10002933 3300005834 Bacteria 7538
69 Ga0068858_100188389 3300005842 Bacteria 1949
70 Ga0068860_100951101 3300005843 Bacteria 876
71 Ga0068862_100021487 3300005844 Bacteria 5393
72 Ga0075428_100444461 3300006844 Bacteria 1389
73 Ga0075428_100588131 3300006844 Unclassified 1189
74 Ga0075428_101957912 3300006844 Unclassified 608
75 Ga0075430_100049493 3300006846 Bacteria 3547
76 Ga0075430_100152469 3300006846 Bacteria 1924
77 Ga0075430_100227955 3300006846 Bacteria 1545
78 Ga0075431_100073046 3300006847 Unclassified 3539
79 Ga0075431_100855700 3300006847 Unclassified 880
80 Ga0075433_10147254 3300006852 Bacteria 2093
81 Ga0075433_10168910 3300006852 Unclassified 1947
82 Ga0075433_10272648 3300006852 Bacteria 1499
83 Ga0075433_10382120 3300006852 Bacteria 1243
84 Ga0075433_10929662 3300006852 Unclassified 758
85 Ga0075434_100665097 3300006871 Unclassified 1060
86 Ga0075434_101511681 3300006871 Bacteria 680
87 Ga0075429_100433796 3300006880 Unclassified 1151
88 Ga0075436_100564988 3300006914 Unclassified 836
89 Ga0097620_100053389 3300006931 Bacteria 4065
90 Ga0097620_100168944 3300006931 Unclassified 2268
91 Ga0097620_100263620 3300006931 Bacteria 1815
92 Ga0097620_100356201 3300006931 Bacteria 1558
93 Ga0097620_100502438 3300006931 Bacteria 1308
94 Ga0097620_102425202 3300006931 Unclassified 578
95 Ga0075435_100300542 3300007076 Bacteria 1373
96 Ga0105240_12400421 3300009093 Unclassified 546
97 Ga0114129_10144988 3300009147 Bacteria 3253
98 Ga0114129_10218462 3300009147 Bacteria 2573
99 Ga0114129_11100393 3300009147 Bacteria 995
100 Ga0105243_10084207 3300009148 Bacteria 2604
101 Ga0105241_10041313 3300009174 Bacteria 3484
102 Ga0105241_10931833 3300009174 Bacteria 808
103 Ga0105242_10001035 3300009176 Bacteria 21844
104 Ga0105248_10051573 3300009177 Bacteria 4616
105 Ga0105237_10001943 3300009545 Bacteria 26329
106 Ga0105238_10253290 3300009551 Bacteria 1739
107 Ga0105249_10000028 3300009553 Bacteria 230039
108 Ga0105249_10029190 3300009553 Bacteria 4981
109 Ga0105249_10039338 3300009553 Bacteria 4293
110 Ga0105239_10033120 3300010375 Bacteria 5676
111 Ga0105239_10056556 3300010375 Bacteria 4303
112 Ga0105246_10027606 3300011119 Unclassified 3722
113 Ga0157374_10866103 3300013296 Bacteria 920
114 Ga0157378_10000001 3300013297 Bacteria 352632
115 Ga0157378_10019121 3300013297 Bacteria 6019
116 Ga0157378_10027939 3300013297 Bacteria 4974
117 Ga0157378_10046530 3300013297 Bacteria 3856
118 Ga0157378_10660400 3300013297 Bacteria 1062
119 Ga0157378_11265196 3300013297 Unclassified 778
120 Ga0163162_10000027 3300013306 Bacteria 178451
121 Ga0163162_10161126 3300013306 Bacteria 2365
122 Ga0157375_10000761 3300013308 Bacteria 28214
123 Ga0157375_10654741 3300013308 Unclassified 1206
124 Ga0157375_10985918 3300013308 Bacteria 983
125 Ga0163163_10091866 3300014325 Bacteria 3050
126 Ga0157380_10034855 3300014326 Bacteria 3885
127 Ga0157380_10192758 3300014326 Bacteria 1801
128 Ga0157377_10241903 3300014745 Bacteria 1165
129 Ga0157379_10079921 3300014968 Bacteria 2929
130 Ga0163161_10036157 3300017792 Bacteria 3536
131 Ga0163161_11255259 3300017792 Bacteria 642
132 Ga0207656_10005303 3300025321 Bacteria 4548
133 Ga0207653_10004534 3300025885 Bacteria 4353
134 Ga0207642_10083195 3300025899 Unclassified 1560
135 Ga0207647_10343765 3300025904 Unclassified 845
136 Ga0207645_10163973 3300025907 Bacteria 1454
137 Ga0207643_10080225 3300025908 Bacteria 1890
138 Ga0207671_10003734 3300025914 Bacteria 15006
139 Ga0207662_10150430 3300025918 Bacteria 1480
140 Ga0207662_10395122 3300025918 Bacteria 936
141 Ga0207657_10832941 3300025919 Unclassified 712
142 Ga0207649_10622588 3300025920 Unclassified 832
143 Ga0207681_10003106 3300025923 Bacteria 10438
144 Ga0207694_11479180 3300025924 Bacteria 573
145 Ga0207650_10850074 3300025925 Unclassified 774
146 Ga0207706_10387018 3300025933 Unclassified 1213
147 Ga0207709_10488326 3300025935 Bacteria 959
148 Ga0207670_11309498 3300025936 Bacteria 614
149 Ga0207711_10313898 3300025941 Bacteria 1447
150 Ga0207711_10814244 3300025941 Bacteria 870
151 Ga0207689_10011212 3300025942 Bacteria 7691
152 Ga0207689_10029117 3300025942 Bacteria 4615
153 Ga0207689_10298027 3300025942 Bacteria 1336
154 Ga0207712_10032816 3300025961 Bacteria 3506
155 Ga0207712_10312134 3300025961 Unclassified 1294
156 Ga0207668_10001043 3300025972 Bacteria 16545
157 Ga0207677_11172550 3300026023 Bacteria 702
158 Ga0207703_10218949 3300026035 Bacteria 1701
159 Ga0207708_10013257 3300026075 Bacteria 6155
160 Ga0207708_10027890 3300026075 Bacteria 4275
161 Ga0207708_11014767 3300026075 Bacteria 721
162 Ga0207641_11718405 3300026088 Unclassified 629
163 Ga0207648_10228384 3300026089 Bacteria 1655
164 Ga0207676_10332166 3300026095 Bacteria 1399
165 Ga0207676_11667531 3300026095 Unclassified 636
166 Ga0207674_10678470 3300026116 Unclassified 995
167 Ga0207675_100034568 3300026118 Bacteria 4713
168 Ga0268265_11717514 3300028380 Bacteria 634
169 Ga0268264_12018714 3300028381 Unclassified 586
170 Ga0307408_100111729 3300031548 Bacteria 2100
171 Ga0307408_100388601 3300031548 Bacteria 1195
172 Ga0307416_100096383 3300032002 Bacteria 2558
173 Ga0395900_0350051 3300037418 Unclassified 1451
174 Ga0395901_0623384 3300038443 Unclassified 1085
175 Ga0242422_04948 3300038699 Unclassified 821
176 Ga0242420_004506 3300038996 Bacteria 2112
177 Ga0439453_0083337 3300041408 Bacteria 693
178 Ga0451577_0127861 3300042876 Bacteria 2278
179 Ga0453683_0199176 3300044673 Bacteria 1271
180 Ga0453684_0139809 3300044712 Bacteria 2894
181 Ga0451576_0877206 3300045051 Bacteria 942
182 Ga0495662_0100972 3300046476 Bacteria 1411
183 Ga0495598_0000028 3300046537 Bacteria 22526
184 Ga0495621_0000745 3300046539 Bacteria 8256
185 Ga0495668_0141980 3300046616 Bacteria 1314
186 Ga0495658_0101152 3300046683 Unclassified 1721
187 Ga0496106_0663384 3300048909 Unclassified 833
188 Ga0501067_0258559 3300049583 Unclassified 969
189 Ga0501233_096529 3300049668 Bacteria 777
190 Ga0501241_071364 3300049758 Bacteria 710
191 Ga0501267_058181 3300049764 Unclassified 517
192 nmdc:mga05p37_584940_c1 3300050507 Bacteria 1263
193 nmdc:mga05p37_777316_c1 3300050507 Bacteria 1051
194 nmdc:mga09592_502073_c1 3300050508 Unclassified 1044
195 nmdc:mga09592_74056_c1 3300050508 Unclassified 2894
196 nmdc:mga0qj67_45406_c1 3300050509 Bacteria 3467
197 nmdc:mga0qj67_565985_c1 3300050509 Unclassified 911
198 nmdc:mga06r32_70564_c1 3300050510 Bacteria 3379
199 nmdc:mga08y16_478291_c1 3300050511 Bacteria 1268
200 nmdc:mga0n895_118732_c1 3300050512 Bacteria 2665
201 nmdc:mga0n895_247822_c1 3300050512 Unclassified 1808
202 nmdc:mga0n895_437726_c1 3300050512 Bacteria 1321
203 nmdc:mga0rr50_1240784_c1 3300050513 Unclassified 633
204 nmdc:mga0a205_133459_c1 3300050515 Bacteria 2383
205 nmdc:mga0a205_365146_c1 3300050515 Bacteria 1310
206 nmdc:mga0a205_72234_c1 3300050515 Bacteria 3333
207 Ga0163162_11485469
208 MBSR1b_contig_6096180
209 Ga0065704_10120788
210 Ga0065704_10222165
211 Ga0065704_10229245
212 Ga0065715_10276583
213 Ga0065707_10008300
214 Ga0065707_10212125
215 Ga0065707_10789237
216 Ga0070676_10073551
217 Ga0070670_100264415
218 Ga0068869_100004892
219 Ga0068869_100337551
220 Ga0068869_101197522
221 Ga0070680_100352285
222 Ga0070689_101354977
223 Ga0070687_100154298
224 Ga0070687_100702158
225 Ga0070692_10006967
226 Ga0070692_10012730
227 Ga0070692_10082749
228 Ga0070692_10186392
229 Ga0070692_10365315
230 Ga0070669_100065454
231 Ga0070669_100670376
232 Ga0070674_100320584
233 Ga0070673_100120789
234 Ga0070659_100768395
235 Ga0070705_100354853
236 Ga0070705_100886398
237 Ga0070700_100021594
238 Ga0070700_100793482
239 Ga0070694_100003543
240 Ga0070694_100065887
241 Ga0070694_100125845
242 Ga0070694_100236872
243 Ga0070694_101134539
244 Ga0070662_100869649
245 Ga0068867_100202335
246 Ga0068867_100245089
247 Ga0068867_100518303
248 Ga0068867_100856921
249 Ga0070698_100491704
250 Ga0070697_100263883
251 Ga0070686_100065140
252 Ga0070695_100023844
253 Ga0070695_100102725
254 Ga0070695_100273773
255 Ga0070695_100492093
256 Ga0070695_100967904
257 Ga0070696_100574756
258 Ga0070696_100593465
259 Ga0070704_100094731
260 Ga0068855_100684105
261 Ga0068855_102289217
262 Ga0068857_100281677
263 Ga0068856_100012368
264 Ga0068852_100470774
265 Ga0068859_100053389
266 Ga0068859_100168938
267 Ga0068859_100263606
268 Ga0068859_100502399
269 Ga0068859_102424535
270 Ga0068864_100019394
271 Ga0068864_101143083
272 Ga0068861_100011772
273 Ga0068861_100164142
274 Ga0068851_10002933
275 Ga0068858_100188389
276 Ga0068860_100951101
277 Ga0068862_100021487
278 Ga0075428_100444461
279 Ga0075428_100588131
280 Ga0075428_101957912
281 Ga0075430_100049493
282 Ga0075430_100152469
283 Ga0075430_100227955
284 Ga0075431_100073046
285 Ga0075431_100855700
286 Ga0075433_10147254
287 Ga0075433_10168910
288 Ga0075433_10272648
289 Ga0075433_10382120
290 Ga0075433_10929662
291 Ga0075434_100665097
292 Ga0075434_101511681
293 Ga0075429_100433796
294 Ga0075436_100564988
295 Ga0097620_100053389
296 Ga0097620_100168944
297 Ga0097620_100263620
298 Ga0097620_100356201
299 Ga0097620_100502438
300 Ga0097620_102425202
301 Ga0075435_100300542
302 Ga0105240_12400421
303 Ga0114129_10144988
304 Ga0114129_10218462
305 Ga0114129_11100393
306 Ga0105243_10084207
307 Ga0105241_10041313
308 Ga0105241_10931833
309 Ga0105242_10001035
310 Ga0105248_10051573
311 Ga0105237_10001943
312 Ga0105238_10253290
313 Ga0105249_10000028
314 Ga0105249_10029190
315 Ga0105249_10039338
316 Ga0105239_10033120
317 Ga0105239_10056556
318 Ga0105246_10027606
319 Ga0157374_10866103
320 Ga0157378_10000001
321 Ga0157378_10019121
322 Ga0157378_10027939
323 Ga0157378_10046530
324 Ga0157378_10660400
325 Ga0157378_11265196
326 Ga0163162_10000027
327 Ga0163162_10161126
328 Ga0157375_10000761
329 Ga0157375_10654741
330 Ga0157375_10985918
331 Ga0163163_10091866
332 Ga0157380_10034855
333 Ga0157380_10192758
334 Ga0157377_10241903
335 Ga0157379_10079921
336 Ga0163161_10036157
337 Ga0163161_11255259
338 Ga0207656_10005303
339 Ga0207653_10004534
340 Ga0207642_10083195
341 Ga0207647_10343765
342 Ga0207645_10163973
343 Ga0207643_10080225
344 Ga0207671_10003734
345 Ga0207662_10150430
346 Ga0207662_10395122
347 Ga0207657_10832941
348 Ga0207649_10622588
349 Ga0207681_10003106
350 Ga0207694_11479180
351 Ga0207650_10850074
352 Ga0207706_10387018
353 Ga0207709_10488326
354 Ga0207670_11309498
355 Ga0207711_10313898
356 Ga0207711_10814244
357 Ga0207689_10011212
358 Ga0207689_10029117
359 Ga0207689_10298027
360 Ga0207712_10032816
361 Ga0207712_10312134
362 Ga0207668_10001043
363 Ga0207677_11172550
364 Ga0207703_10218949
365 Ga0207708_10013257
366 Ga0207708_10027890
367 Ga0207708_11014767
368 Ga0207641_11718405
369 Ga0207648_10228384
370 Ga0207676_10332166
371 Ga0207676_11667531
372 Ga0207674_10678470
373 Ga0207675_100034568
374 Ga0268265_11717514
375 Ga0268264_12018714
376 Ga0307408_100111729
377 Ga0307408_100388601
378 Ga0307416_100096383
379 Ga0395900_0350051
380 Ga0395901_0623384
381 Ga0242422_04948
382 Ga0242420_004506
383 Ga0439453_0083337
384 Ga0451577_0127861
385 Ga0453683_0199176
386 Ga0453684_0139809
387 Ga0451576_0877206
388 Ga0495662_0100972
389 Ga0495598_0000028
390 Ga0495621_0000745
391 Ga0495668_0141980
392 Ga0495658_0101152
393 Ga0496106_0663384
394 Ga0501067_0258559
395 Ga0501233_096529
396 Ga0501241_071364
397 Ga0501267_058181
398 nmdc:mga05p37_584940_c1
399 nmdc:mga05p37_777316_c1
400 nmdc:mga09592_502073_c1
401 nmdc:mga09592_74056_c1
402 nmdc:mga0qj67_45406_c1
403 nmdc:mga0qj67_565985_c1
404 nmdc:mga06r32_70564_c1
405 nmdc:mga08y16_478291_c1
406 nmdc:mga0n895_118732_c1
407 nmdc:mga0n895_247822_c1
408 nmdc:mga0n895_437726_c1
409 nmdc:mga0rr50_1240784_c1
410 nmdc:mga0a205_133459_c1
411 nmdc:mga0a205_365146_c1
412 nmdc:mga0a205_72234_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07606

DUF1569

Protein of unknown function (DUF1569)

4

149

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
2hkv-assembly1.cif.gz_A-2 crystal structure of a putative member of the dinb family (exig_1237) from exiguobacterium sibiricum 255-15 at 1.70 a resolution 0.579 9 147
3di5-assembly1.cif.gz_A crystal structure of a dinb-like protein (bce_4655) from bacillus cereus atcc 10987 at 2.01 a resolution 0.5628 9 148
2nsg-assembly1.cif.gz_A crystal structure of the mycothiol-dependent maleylpyruvate isomerase h52a mutant 0.5511 5 149
8f5v-assembly1.cif.gz_B crystal structure of mycobacterium tuberculosis mycothiol s-transferase enzyme in complex with mycothiol and zn2+ 0.5438 8 148
2nsg-assembly1.cif.gz_A crystal structure of the mycothiol-dependent maleylpyruvate isomerase h52a mutant 0.5216 5 149
ID Description Score Start End Superfamily
2hkvA01 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.5923 8 147 1.20.120.450
af_P9WM91_7_150_1.20.120.450 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.5881 8 148 1.20.120.450
af_P71985_5_134_1.20.120.450 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.5758 3 148 1.20.120.450
af_P9WM91_7_150_1.20.120.450 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.5668 8 148 1.20.120.450
af_P71985_5_134_1.20.120.450 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.5624 3 148 1.20.120.450
ID Description Score Start End GO Terms
AF-A0A2V8QVR3-F1-model_v4 DUF1569 domain-containing protein 0.8478 1 149
AF-I0WDZ1-F1-model_v4 DUF1569 domain-containing protein 0.8458 1 149
AF-A0A2V8QVR3-F1-model_v4 DUF1569 domain-containing protein 0.8424 1 149
AF-A0A0Q0XRR7-F1-model_v4 DUF1569 domain-containing protein 0.8375 1 149
AF-A0A0Q0XRR7-F1-model_v4 DUF1569 domain-containing protein 0.8323 1 149

Map