F314002

General Info

Members Datasets Scaffolds Average Seq Length
205 156 203 125

Family's Representative Sequence

Representative Sequence 3300028786|Ga0307517_10351827|Ga0307517_103518273
Length 146
Sequence MAGCTLERLLKTIINKPIKQKAMTTTKVLTTQEVAARFNELAQKEKWFEIHDELFADNVRSIDPPDSPYFPYAEGKAAVRKKGEDFVKRIEAVHRLYASEPVVSGNHFAVGREKDITVQGFGRIQINEIMLYEVKDGQIVLEQFFY

Samples

Sample ID Description Type Environment
1 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
4 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
5 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
6 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
7 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
8 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
9 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
10 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
11 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
12 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
13 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
14 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
15 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
37 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
38 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
39 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
40 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
41 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
43 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
44 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
45 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
46 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
47 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
48 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
49 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
51 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
53 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
54 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
55 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
56 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
57 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
58 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
59 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
60 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
61 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
62 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
63 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
64 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
65 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
66 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
67 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
68 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
92 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
93 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
94 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
95 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
96 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
97 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
98 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
99 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
100 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
101 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
102 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
103 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
104 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
105 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
106 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
107 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
108 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
109 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
110 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
111 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
112 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
113 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
114 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
115 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
116 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
117 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
118 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
119 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
120 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
121 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
122 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
123 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
124 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
125 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
126 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
127 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
128 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
129 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
130 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
131 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
132 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
133 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
134 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
135 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
136 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
137 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
138 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
139 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
140 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
141 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
142 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
143 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
144 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
145 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
146 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
147 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
148 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
149 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
150 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
151 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
152 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
153 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
154 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
155 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
156 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.02
Metatranscriptomes 0
Isolates 0.98

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 20
Nodule 0
Rhizoplane 2.44
Rhizosphere 67.32
Stem 0
Stem Tuber 0
Unclassified 10.24

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10037678 3300001989 Bacteria 1628
2 JGI24751J29686_10000732 3300002459 Bacteria 7929
3 JGI25154J39366_1000004 3300002738 Bacteria 346460
4 JGI25157J39369_1003834 3300002741 Bacteria 2930
5 JGI25153J46596_10011565 3300003215 Bacteria 3889
6 rootH2_10002436 3300003320 Bacteria 28019
7 rootH2_10011373 3300003320 Bacteria 7486
8 rootL2_10138862 3300003322 Bacteria 4536
9 rootH1_10099200 3300003323 Bacteria 9234
10 JGI25160J50197_1004985 3300003354 Bacteria 5631
11 Ga0055526_1039245 3300003771 Unclassified 1208
12 Ga0055526_1040998 3300003771 Bacteria 1159
13 Ga0065165_1048926 3300005262 Bacteria 1211
14 Ga0065712_10071932 3300005290 Bacteria 4979
15 Ga0065707_10457298 3300005295 Bacteria 794
16 Ga0070676_10861803 3300005328 Bacteria 672
17 Ga0070670_100104819 3300005331 Bacteria 2436
18 Ga0070670_101123779 3300005331 Unclassified 717
19 Ga0068869_100240651 3300005334 Bacteria 1442
20 Ga0070660_100350842 3300005339 Unclassified 1215
21 Ga0070668_101470557 3300005347 Bacteria 622
22 Ga0070671_101330554 3300005355 Bacteria 634
23 Ga0070673_102042793 3300005364 Bacteria 544
24 Ga0070688_100256127 3300005365 Bacteria 1248
25 Ga0070688_100534583 3300005365 Bacteria 889
26 Ga0070667_101111823 3300005367 Bacteria 739
27 Ga0070663_100240798 3300005455 Bacteria 1428
28 Ga0070662_100281711 3300005457 Unclassified 1345
29 Ga0070698_100034146 3300005471 Bacteria 5269
30 Ga0070698_100541084 3300005471 Bacteria 1104
31 Ga0070679_100792854 3300005530 Bacteria 891
32 Ga0070684_100523870 3300005535 Bacteria 1099
33 Ga0070684_101276531 3300005535 Bacteria 691
34 Ga0068853_100957737 3300005539 Unclassified 823
35 Ga0070665_100866145 3300005548 Bacteria 916
36 Ga0070665_101099019 3300005548 Bacteria 807
37 Ga0068855_101753358 3300005563 Bacteria 632
38 Ga0070664_100409069 3300005564 Bacteria 1241
39 Ga0068857_101596085 3300005577 Unclassified 637
40 Ga0068857_101627430 3300005577 Bacteria 631
41 Ga0068856_100002280 3300005614 Bacteria 19791
42 Ga0068856_100166832 3300005614 Bacteria 2213
43 Ga0068864_100673352 3300005618 Bacteria 1009
44 Ga0068851_10000105 3300005834 Bacteria 45381
45 Ga0068863_100548956 3300005841 Bacteria 1141
46 Ga0068858_100443094 3300005842 Bacteria 1251
47 Ga0081540_1150720 3300005983 Bacteria 918
48 Ga0075366_10199079 3300006195 Bacteria 1218
49 Ga0097621_100697239 3300006237 Bacteria 935
50 Ga0097621_100944125 3300006237 Bacteria 805
51 Ga0075370_10320872 3300006353 Unclassified 923
52 Ga0068871_100093428 3300006358 Bacteria 2510
53 Ga0075428_100142938 3300006844 Bacteria 2601
54 Ga0075428_100222008 3300006844 Bacteria 2040
55 Ga0075430_100011618 3300006846 Bacteria 7489
56 Ga0075430_100042029 3300006846 Bacteria 3866
57 Ga0075431_100082642 3300006847 Bacteria 3316
58 Ga0075431_100160255 3300006847 Bacteria 2314
59 Ga0075431_101515961 3300006847 Bacteria 629
60 Ga0075429_100042167 3300006880 Bacteria 3972
61 Ga0075429_100890636 3300006880 Bacteria 779
62 Ga0105240_10000723 3300009093 Bacteria 60353
63 Ga0111539_11810201 3300009094 Bacteria 708
64 Ga0105247_10254710 3300009101 Bacteria 1201
65 Ga0114129_10037103 3300009147 Bacteria 6881
66 Ga0114129_12130427 3300009147 Bacteria 676
67 Ga0105249_10011702 3300009553 Bacteria 7717
68 Ga0105249_10248745 3300009553 Bacteria 1761
69 Ga0105249_10574979 3300009553 Bacteria 1179
70 Ga0157370_10442532 3300013104 Bacteria 1195
71 Ga0157374_10143561 3300013296 Bacteria 2318
72 Ga0157378_10159190 3300013297 Bacteria 2110
73 Ga0163162_11069894 3300013306 Bacteria 913
74 Ga0157372_10007957 3300013307 Bacteria 11270
75 Ga0157375_10058496 3300013308 Bacteria 3814
76 Ga0157375_12020056 3300013308 Bacteria 685
77 Ga0163163_10347464 3300014325 Bacteria 1539
78 Ga0157380_10019087 3300014326 Bacteria 5105
79 Ga0157377_10115996 3300014745 Bacteria 1616
80 Ga0157379_10035008 3300014968 Unclassified 4476
81 Ga0157379_10174581 3300014968 Bacteria 1940
82 Ga0157379_10459701 3300014968 Bacteria 1176
83 Ga0209646_1000025 3300025246 Bacteria 406493
84 Ga0209026_1000097 3300025250 Bacteria 163212
85 Ga0209564_1005373 3300025295 Bacteria 7346
86 Ga0209564_1007248 3300025295 Bacteria 5765
87 Ga0209758_1010198 3300025297 Bacteria 5670
88 Ga0209758_1027081 3300025297 Bacteria 2460
89 Ga0207426_1000220 3300025302 Bacteria 134979
90 Ga0207426_1010281 3300025302 Bacteria 3641
91 Ga0207426_1081299 3300025302 Bacteria 878
92 Ga0207656_10000170 3300025321 Bacteria 23964
93 Ga0207645_10663143 3300025907 Bacteria 709
94 Ga0207695_10016791 3300025913 Bacteria 8547
95 Ga0207694_10006741 3300025924 Bacteria 8725
96 Ga0207670_10032903 3300025936 Bacteria 3338
97 Ga0207689_10260347 3300025942 Bacteria 1435
98 Ga0207679_10068382 3300025945 Bacteria 2668
99 Ga0207679_10355995 3300025945 Bacteria 1277
100 Ga0207667_10081306 3300025949 Bacteria 3356
101 Ga0207651_11138967 3300025960 Bacteria 700
102 Ga0207712_10005300 3300025961 Bacteria 8143
103 Ga0207712_10156062 3300025961 Bacteria 1768
104 Ga0207668_10429668 3300025972 Bacteria 1123
105 Ga0207668_11076624 3300025972 Bacteria 720
106 Ga0207703_10461261 3300026035 Bacteria 1188
107 Ga0207639_11082215 3300026041 Unclassified 752
108 Ga0207708_10561941 3300026075 Bacteria 963
109 Ga0207702_10094387 3300026078 Bacteria 2626
110 Ga0207641_10327429 3300026088 Unclassified 1454
111 Ga0207648_10072738 3300026089 Bacteria 2996
112 Ga0207674_10237321 3300026116 Bacteria 1770
113 Ga0207674_11484884 3300026116 Bacteria 647
114 Ga0207675_101802466 3300026118 Bacteria 631
115 Ga0207698_10029870 3300026142 Bacteria 3911
116 Ga0268266_10332143 3300028379 Bacteria 1425
117 Ga0268266_10953482 3300028379 Unclassified 830
118 Ga0268265_10609257 3300028380 Bacteria 1045
119 Ga0268265_11191273 3300028380 Bacteria 759
120 Ga0268264_12360712 3300028381 Unclassified 538
121 Ga0307517_10351827 3300028786 Bacteria 800
122 Ga0307513_10534554 3300031456 Bacteria 886
123 Ga0307509_10045913 3300031507 Bacteria 4706
124 Ga0307416_103301460 3300032002 Unclassified 540
125 Ga0307414_10658111 3300032004 Bacteria 945
126 Ga0307414_10958966 3300032004 Bacteria 786
127 Ga0307414_12073149 3300032004 Unclassified 531
128 Ga0307415_101606595 3300032126 Bacteria 625
129 Ga0307510_10025719 3300033180 Bacteria 6782
130 Ga0439436_0067535 3300041404 Bacteria 998
131 Ga0439438_133832 3300041405 Bacteria 594
132 Ga0439453_0096269 3300041408 Bacteria 655
133 Ga0439461_0110678 3300041410 Bacteria 678
134 Ga0451800_0681597 3300041459 Bacteria 1331
135 Ga0451802_0976734 3300041460 Bacteria 919
136 Ga0451835_0936914 3300041492 Bacteria 551
137 Ga0451841_0972769 3300041498 Bacteria 1128
138 Ga0451849_0138664 3300041505 Bacteria 723
139 Ga0451851_0064845 3300041507 Bacteria 607
140 Ga0451853_1900087 3300041512 Unclassified 1089
141 Ga0451853_2310624 3300041512 Bacteria 2272
142 Ga0451853_3928541 3300041512 Bacteria 633
143 Ga0439451_074087 3300042009 Unclassified 682
144 Ga0439457_056695 3300042014 Bacteria 884
145 Ga0450897_002473 3300042128 Bacteria 1391
146 Ga0450898_085638 3300042134 Unclassified 645
147 Ga0450899_012905 3300042135 Bacteria 941
148 Ga0439464_0177946 3300042439 Bacteria 673
149 Ga0466972_0000006 3300044658 Bacteria 282264
150 Ga0466970_0092806 3300044765 Bacteria 1640
151 Ga0466960_0125273 3300044901 Bacteria 1350
152 Ga0495606_0005877 3300046507 Bacteria 11554
153 Ga0495668_0000526 3300046616 Bacteria 47711
154 Ga0495668_0000648 3300046616 Bacteria 41759
155 Ga0495625_0061721 3300046660 Unclassified 2652
156 Ga0495625_0260954 3300046660 Bacteria 1121
157 Ga0495625_0742751 3300046660 Bacteria 576
158 Ga0495686_0530594 3300047472 Bacteria 617
159 Ga0496104_0332326 3300048907 Bacteria 1433
160 Ga0496109_0707294 3300048912 Bacteria 945
161 Ga0496110_0149309 3300048913 Bacteria 2115
162 Ga0501043_0305763 3300049579 Bacteria 1214
163 Ga0501199_053000 3300049650 Bacteria 552
164 Ga0501217_085038 3300049661 Bacteria 881
165 Ga0501223_052120 3300049663 Unclassified 794
166 Ga0501235_026826 3300049669 Unclassified 1292
167 Ga0501240_072114 3300049673 Bacteria 627
168 Ga0501249_162051 3300049679 Bacteria 569
169 Ga0501221_088632 3300049704 Bacteria 754
170 Ga0501279_049010 3300049775 Bacteria 666
171 nmdc:mga0k408_287538_c1 3300050493 Bacteria 981
172 nmdc:mga0k408_288487_c1 3300050493 Unclassified 979
173 nmdc:mga0k408_678750_c1 3300050493 Bacteria 604
174 nmdc:mga05p37_303392_c1 3300050507 Bacteria 1896
175 nmdc:mga05p37_392701_c1 3300050507 Bacteria 1622
176 nmdc:mga09592_45780_c1 3300050508 Bacteria 3686
177 nmdc:mga0qj67_2368_c1 3300050509 Bacteria 13425
178 nmdc:mga06r32_388500_c1 3300050510 Bacteria 1378
179 nmdc:mga06r32_94509_c2 3300050510 Bacteria 2130
180 Ga0500646_0022346 3300053090 Bacteria 1692
181 Ga0500646_0059756 3300053090 Bacteria 1119
182 Ga0500583_0000138 3300053092 Bacteria 30714
183 Ga0500583_0000332 3300053092 Bacteria 15783
184 Ga0500651_0570134 3300053093 Bacteria 617
185 Ga0500556_0012507 3300053104 Bacteria 2539
186 Ga0500556_0197648 3300053104 Bacteria 795
187 Ga0500557_207062 3300053105 Bacteria 629
188 Ga0500562_225938 3300053108 Bacteria 506
189 Ga0500569_000405 3300053109 Bacteria 7030
190 Ga0500594_0094507 3300053118 Bacteria 912
191 Ga0500642_0165019 3300053130 Bacteria 1037
192 Ga0500652_073162 3300053131 Bacteria 1422
193 Ga0500652_118267 3300053131 Bacteria 1107
194 Ga0500658_0005779 3300053134 Bacteria 4609
195 Ga0500568_0023908 3300053139 Bacteria 2593
196 Ga0500568_0253783 3300053139 Unclassified 640
197 Ga0500577_0014428 3300053142 Unclassified 2442
198 Ga0500579_167912 3300053143 Bacteria 903
199 Ga0500589_039244 3300053147 Bacteria 2211
200 Ga0500604_0008352 3300053151 Bacteria 2747
201 Ga0500622_0000804 3300053156 Bacteria 26977
202 Ga0500622_0047774 3300053156 Unclassified 2209
203 Ga0500622_0352115 3300053156 Bacteria 611

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300003320 rootH2_10002436 rootH2_1000243621 118
2 3300003320 rootH2_10011373 rootH2_100113738 118
3 3300005457 Ga0070662_100281711 Ga0070662_1002817111 118
4 3300005471 Ga0070698_100034146 Ga0070698_1000341465 118
5 3300005530 Ga0070679_100792854 Ga0070679_1007928541 118
6 3300005614 Ga0068856_100002280 Ga0068856_10000228013 118
7 3300025913 Ga0207695_10016791 Ga0207695_100167913 118
8 3300025949 Ga0207667_10081306 Ga0207667_100813063 118
9 3300032126 Ga0307415_101606595 Ga0307415_1016065952 118
10 3300041492 Ga0451835_0936914 Ga0451835_0936914_155_511 118
11 3300042134 Ga0450898_085638 Ga0450898_085638_61_417 118
12 3300048907 Ga0496104_0332326 Ga0496104_0332326_658_1014 118
13 3300048913 Ga0496110_0149309 Ga0496110_0149309_1422_1778 118
14 3300053092 Ga0500583_0000332 Ga0500583_0000332_12619_12975 118
15 3300053139 Ga0500568_0023908 Ga0500568_0023908_1179_1535 118
16 3300005355 Ga0070671_101330554 Ga0070671_1013305541 119
17 iso_pu_bacteria 8003151029 8003151229 120
18 3300053156 Ga0500622_0000804 Ga0500622_0000804_2267_2632 121
19 3300005339 Ga0070660_100350842 Ga0070660_1003508421 122
20 3300032004 Ga0307414_10658111 Ga0307414_106581113 122
21 iso_pu_bacteria 2929921140 2929927346 122
22 3300005563 Ga0068855_101753358 Ga0068855_1017533582 123
23 3300002459 JGI24751J29686_10000732 JGI24751J29686_100007326 124
24 3300002738 JGI25154J39366_1000004 JGI25154J39366_1000004242 124
25 3300002741 JGI25157J39369_1003834 JGI25157J39369_10038344 124
26 3300003215 JGI25153J46596_10011565 JGI25153J46596_100115653 124
27 3300003354 JGI25160J50197_1004985 JGI25160J50197_10049858 124
28 3300005262 Ga0065165_1048926 Ga0065165_10489262 124
29 3300005290 Ga0065712_10071932 Ga0065712_100719323 124
30 3300005331 Ga0070670_100104819 Ga0070670_1001048194 124
31 3300005347 Ga0070668_101470557 Ga0070668_1014705572 124
32 3300005364 Ga0070673_102042793 Ga0070673_1020427931 124
33 3300005365 Ga0070688_100256127 Ga0070688_1002561271 124
34 3300005365 Ga0070688_100534583 Ga0070688_1005345832 124
35 3300005548 Ga0070665_100866145 Ga0070665_1008661452 124
36 3300005577 Ga0068857_101627430 Ga0068857_1016274301 124
37 3300005618 Ga0068864_100673352 Ga0068864_1006733522 124
38 3300005841 Ga0068863_100548956 Ga0068863_1005489562 124
39 3300005842 Ga0068858_100443094 Ga0068858_1004430942 124
40 3300006237 Ga0097621_100697239 Ga0097621_1006972392 124
41 3300006237 Ga0097621_100944125 Ga0097621_1009441252 124
42 3300006353 Ga0075370_10320872 Ga0075370_103208722 124
43 3300006358 Ga0068871_100093428 Ga0068871_1000934284 124
44 3300006847 Ga0075431_101515961 Ga0075431_1015159611 124
45 3300006880 Ga0075429_100890636 Ga0075429_1008906361 124
46 3300009094 Ga0111539_11810201 Ga0111539_118102011 124
47 3300009553 Ga0105249_10011702 Ga0105249_100117025 124
48 3300009553 Ga0105249_10248745 Ga0105249_102487452 124
49 3300013104 Ga0157370_10442532 Ga0157370_104425322 124
50 3300013297 Ga0157378_10159190 Ga0157378_101591903 124
51 3300013306 Ga0163162_11069894 Ga0163162_110698941 124
52 3300013308 Ga0157375_10058496 Ga0157375_100584964 124
53 3300013308 Ga0157375_12020056 Ga0157375_120200562 124
54 3300014325 Ga0163163_10347464 Ga0163163_103474642 124
55 3300014326 Ga0157380_10019087 Ga0157380_100190872 124
56 3300025246 Ga0209646_1000025 Ga0209646_100002593 124
57 3300025250 Ga0209026_1000097 Ga0209026_100009773 124
58 3300025297 Ga0209758_1027081 Ga0209758_10270812 124
59 3300025302 Ga0207426_1000220 Ga0207426_100022036 124
60 3300025936 Ga0207670_10032903 Ga0207670_100329034 124
61 3300025961 Ga0207712_10005300 Ga0207712_100053007 124
62 3300025961 Ga0207712_10156062 Ga0207712_101560623 124
63 3300025972 Ga0207668_11076624 Ga0207668_110766242 124
64 3300026075 Ga0207708_10561941 Ga0207708_105619411 124
65 3300026088 Ga0207641_10327429 Ga0207641_103274292 124
66 3300026116 Ga0207674_11484884 Ga0207674_114848841 124
67 3300028786 Ga0307517_10351827 Ga0307517_103518273 124
68 3300046660 Ga0495625_0061721 Ga0495625_0061721_1581_2021 124
69 3300047472 Ga0495686_0530594 Ga0495686_0530594_144_518 124
70 3300048912 Ga0496109_0707294 Ga0496109_0707294_436_810 124
71 3300049579 Ga0501043_0305763 Ga0501043_0305763_205_579 124
72 3300003322 rootL2_10138862 rootL2_101388623 125
73 3300003323 rootH1_10099200 rootH1_100992007 125
74 3300005295 Ga0065707_10457298 Ga0065707_104572982 125
75 3300005471 Ga0070698_100541084 Ga0070698_1005410841 125
76 3300005535 Ga0070684_101276531 Ga0070684_1012765312 125
77 3300005834 Ga0068851_10000105 Ga0068851_100001053 125
78 3300005983 Ga0081540_1150720 Ga0081540_11507202 125
79 3300006195 Ga0075366_10199079 Ga0075366_101990792 125
80 3300006844 Ga0075428_100222008 Ga0075428_1002220083 125
81 3300006846 Ga0075430_100011618 Ga0075430_1000116188 125
82 3300006847 Ga0075431_100082642 Ga0075431_1000826422 125
83 3300009147 Ga0114129_10037103 Ga0114129_100371033 125
84 3300014968 Ga0157379_10459701 Ga0157379_104597012 125
85 3300025321 Ga0207656_10000170 Ga0207656_1000017017 125
86 3300025972 Ga0207668_10429668 Ga0207668_104296682 125
87 3300026118 Ga0207675_101802466 Ga0207675_1018024661 125
88 3300028379 Ga0268266_10332143 Ga0268266_103321432 125
89 3300032002 Ga0307416_103301460 Ga0307416_1033014601 125
90 3300032004 Ga0307414_10958966 Ga0307414_109589662 125
91 3300041404 Ga0439436_0067535 Ga0439436_0067535_455_832 125
92 3300041405 Ga0439438_133832 Ga0439438_133832_67_444 125
93 3300041408 Ga0439453_0096269 Ga0439453_0096269_264_641 125
94 3300041410 Ga0439461_0110678 Ga0439461_0110678_150_527 125
95 3300041459 Ga0451800_0681597 Ga0451800_0681597_691_1068 125
96 3300041460 Ga0451802_0976734 Ga0451802_0976734_377_754 125
97 3300041505 Ga0451849_0138664 Ga0451849_0138664_11_388 125
98 3300041512 Ga0451853_1900087 Ga0451853_1900087_67_444 125
99 3300042009 Ga0439451_074087 Ga0439451_074087_292_669 125
100 3300042014 Ga0439457_056695 Ga0439457_056695_461_838 125
101 3300042128 Ga0450897_002473 Ga0450897_002473_30_407 125
102 3300042135 Ga0450899_012905 Ga0450899_012905_236_613 125
103 3300042439 Ga0439464_0177946 Ga0439464_0177946_221_598 125
104 3300046616 Ga0495668_0000648 Ga0495668_0000648_23701_24084 125
105 3300049661 Ga0501217_085038 Ga0501217_085038_310_687 125
106 3300049663 Ga0501223_052120 Ga0501223_052120_99_476 125
107 3300049669 Ga0501235_026826 Ga0501235_026826_663_1040 125
108 3300049673 Ga0501240_072114 Ga0501240_072114_128_505 125
109 3300049679 Ga0501249_162051 Ga0501249_162051_138_515 125
110 3300049775 Ga0501279_049010 Ga0501279_049010_123_500 125
111 3300050493 nmdc:mga0k408_287538_c1 nmdc:mga0k408_287538_c1_548_925 125
112 3300050493 nmdc:mga0k408_678750_c1 nmdc:mga0k408_678750_c1_43_420 125
113 3300050507 nmdc:mga05p37_303392_c1 nmdc:mga05p37_303392_c1_1000_1377 125
114 3300050509 nmdc:mga0qj67_2368_c1 nmdc:mga0qj67_2368_c1_11277_11654 125
115 3300050510 nmdc:mga06r32_388500_c1 nmdc:mga06r32_388500_c1_854_1231 125
116 3300053092 Ga0500583_0000138 Ga0500583_0000138_10545_10922 125
117 3300053108 Ga0500562_225938 Ga0500562_225938_77_454 125
118 3300053118 Ga0500594_0094507 Ga0500594_0094507_445_822 125
119 3300053147 Ga0500589_039244 Ga0500589_039244_436_813 125
120 3300053151 Ga0500604_0008352 Ga0500604_0008352_1174_1551 125
121 3300053156 Ga0500622_0352115 Ga0500622_0352115_198_575 125
122 3300001989 JGI24739J22299_10037678 JGI24739J22299_100376782 126
123 3300003771 Ga0055526_1039245 Ga0055526_10392452 126
124 3300003771 Ga0055526_1040998 Ga0055526_10409981 126
125 3300005328 Ga0070676_10861803 Ga0070676_108618031 126
126 3300005331 Ga0070670_101123779 Ga0070670_1011237791 126
127 3300005334 Ga0068869_100240651 Ga0068869_1002406512 126
128 3300005367 Ga0070667_101111823 Ga0070667_1011118232 126
129 3300005455 Ga0070663_100240798 Ga0070663_1002407982 126
130 3300005535 Ga0070684_100523870 Ga0070684_1005238702 126
131 3300005539 Ga0068853_100957737 Ga0068853_1009577371 126
132 3300005548 Ga0070665_101099019 Ga0070665_1010990192 126
133 3300005564 Ga0070664_100409069 Ga0070664_1004090692 126
134 3300005577 Ga0068857_101596085 Ga0068857_1015960852 126
135 3300005614 Ga0068856_100166832 Ga0068856_1001668322 126
136 3300006844 Ga0075428_100142938 Ga0075428_1001429382 126
137 3300006846 Ga0075430_100042029 Ga0075430_1000420294 126
138 3300006847 Ga0075431_100160255 Ga0075431_1001602553 126
139 3300006880 Ga0075429_100042167 Ga0075429_1000421672 126
140 3300009093 Ga0105240_10000723 Ga0105240_1000072317 126
141 3300009101 Ga0105247_10254710 Ga0105247_102547101 126
142 3300009147 Ga0114129_12130427 Ga0114129_121304272 126
143 3300009553 Ga0105249_10574979 Ga0105249_105749792 126
144 3300013296 Ga0157374_10143561 Ga0157374_101435614 126
145 3300013307 Ga0157372_10007957 Ga0157372_100079577 126
146 3300014745 Ga0157377_10115996 Ga0157377_101159963 126
147 3300014968 Ga0157379_10035008 Ga0157379_100350084 126
148 3300014968 Ga0157379_10174581 Ga0157379_101745811 126
149 3300025295 Ga0209564_1005373 Ga0209564_10053734 126
150 3300025295 Ga0209564_1007248 Ga0209564_10072482 126
151 3300025297 Ga0209758_1010198 Ga0209758_10101982 126
152 3300025302 Ga0207426_1010281 Ga0207426_10102812 126
153 3300025302 Ga0207426_1081299 Ga0207426_10812992 126
154 3300025907 Ga0207645_10663143 Ga0207645_106631432 126
155 3300025924 Ga0207694_10006741 Ga0207694_100067413 126
156 3300025942 Ga0207689_10260347 Ga0207689_102603472 126
157 3300025945 Ga0207679_10068382 Ga0207679_100683823 126
158 3300025945 Ga0207679_10355995 Ga0207679_103559952 126
159 3300025960 Ga0207651_11138967 Ga0207651_111389672 126
160 3300026035 Ga0207703_10461261 Ga0207703_104612612 126
161 3300026041 Ga0207639_11082215 Ga0207639_110822152 126
162 3300026078 Ga0207702_10094387 Ga0207702_100943872 126
163 3300026089 Ga0207648_10072738 Ga0207648_100727385 126
164 3300026116 Ga0207674_10237321 Ga0207674_102373212 126
165 3300026142 Ga0207698_10029870 Ga0207698_100298706 126
166 3300028379 Ga0268266_10953482 Ga0268266_109534822 126
167 3300028380 Ga0268265_10609257 Ga0268265_106092572 126
168 3300028380 Ga0268265_11191273 Ga0268265_111912731 126
169 3300028381 Ga0268264_12360712 Ga0268264_123607121 126
170 3300031456 Ga0307513_10534554 Ga0307513_105345542 126
171 3300031507 Ga0307509_10045913 Ga0307509_100459132 126
172 3300032004 Ga0307414_12073149 Ga0307414_120731491 126
173 3300033180 Ga0307510_10025719 Ga0307510_100257198 126
174 3300041498 Ga0451841_0972769 Ga0451841_0972769_163_546 126
175 3300041507 Ga0451851_0064845 Ga0451851_0064845_114_494 126
176 3300041512 Ga0451853_2310624 Ga0451853_2310624_1264_1644 126
177 3300041512 Ga0451853_3928541 Ga0451853_3928541_148_528 126
178 3300044658 Ga0466972_0000006 Ga0466972_0000006_216408_216788 126
179 3300044765 Ga0466970_0092806 Ga0466970_0092806_595_975 126
180 3300044901 Ga0466960_0125273 Ga0466960_0125273_457_837 126
181 3300046507 Ga0495606_0005877 Ga0495606_0005877_2494_2877 126
182 3300046616 Ga0495668_0000526 Ga0495668_0000526_4093_4476 126
183 3300046660 Ga0495625_0260954 Ga0495625_0260954_371_793 126
184 3300046660 Ga0495625_0742751 Ga0495625_0742751_108_491 126
185 3300049650 Ga0501199_053000 Ga0501199_053000_20_400 126
186 3300049704 Ga0501221_088632 Ga0501221_088632_105_485 126
187 3300050493 nmdc:mga0k408_288487_c1 nmdc:mga0k408_288487_c1_102_488 126
188 3300050507 nmdc:mga05p37_392701_c1 nmdc:mga05p37_392701_c1_135_518 126
189 3300050508 nmdc:mga09592_45780_c1 nmdc:mga09592_45780_c1_212_595 126
190 3300050510 nmdc:mga06r32_94509_c2 nmdc:mga06r32_94509_c2_986_1369 126
191 3300053090 Ga0500646_0022346 Ga0500646_0022346_1024_1404 126
192 3300053090 Ga0500646_0059756 Ga0500646_0059756_650_1030 126
193 3300053093 Ga0500651_0570134 Ga0500651_0570134_56_436 126
194 3300053104 Ga0500556_0012507 Ga0500556_0012507_88_513 126
195 3300053104 Ga0500556_0197648 Ga0500556_0197648_93_473 126
196 3300053105 Ga0500557_207062 Ga0500557_207062_79_459 126
197 3300053109 Ga0500569_000405 Ga0500569_000405_3234_3614 126
198 3300053130 Ga0500642_0165019 Ga0500642_0165019_572_955 126
199 3300053131 Ga0500652_073162 Ga0500652_073162_52_432 126
200 3300053131 Ga0500652_118267 Ga0500652_118267_641_1021 126
201 3300053134 Ga0500658_0005779 Ga0500658_0005779_1170_1550 126
202 3300053139 Ga0500568_0253783 Ga0500568_0253783_12_392 126
203 3300053142 Ga0500577_0014428 Ga0500577_0014428_1877_2257 126
204 3300053143 Ga0500579_167912 Ga0500579_167912_90_470 126
205 3300053156 Ga0500622_0047774 Ga0500622_0047774_628_1008 126

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF20409

SnoaL_5

SnoaL-like domain

29

146

1

Structural Annotation

Top 5 Hits

ID Description Score Start End
3hk4-assembly2.cif.gz_D crystal structure of a putative snoal-like polyketide cyclase [carbohydrate phosphatase] (mlr7391) from mesorhizobium loti at 1.96 a resolution 0.9416 9 126
3hk4-assembly2.cif.gz_D crystal structure of a putative snoal-like polyketide cyclase [carbohydrate phosphatase] (mlr7391) from mesorhizobium loti at 1.96 a resolution 0.9339 9 126
5u35-assembly1.cif.gz_B crystal structure of a de novo designed protein with curved beta-sheet 0.8876 11 125
5tph-assembly1.cif.gz_A crystal structure of a de novo designed protein homodimer with curved beta-sheet 0.8827 11 124
6a5f-assembly1.cif.gz_B-2 the structure of [4+2] and [6+4] cyclase in the biosynthetic pathway of nargenicin 0.8391 29 125
ID Description Score Start End Superfamily
3hk4D00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.9451 10 126 3.10.450.50
3hk4D00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.9371 10 126 3.10.450.50
af_Q54WJ8_4_110_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8916 24 125 3.10.450.50
af_Q6ID84_103_213_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8595 33 121 3.10.450.50
af_Q55DR3_11_130_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8489 11 125 3.10.450.50
ID Description Score Start End GO Terms
AF-A0A537K939-F1-model_v4 Nuclear transport factor 2 family protein 0.9971 9 126
AF-A0A7K0EKB8-F1-model_v4 SRPBCC domain-containing protein 0.9967 6 126
AF-A0A537K939-F1-model_v4 Nuclear transport factor 2 family protein 0.9887 9 126
AF-A0A3D2SBG4-F1-model_v4 SnoaL-like domain-containing protein 0.9816 9 126
AF-A0A7W1EDJ0-F1-model_v4 Nuclear transport factor 2 family protein 0.9809 9 126

Feature Viewer

pLDDT pTM Quality
94.08 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map