F313705

General Info

Members Datasets Scaffolds Average Seq Length
205 155 410 122

Family's Representative Sequence

Representative Sequence 3300006880|Ga0075429_100053026|Ga0075429_1000530265
Length 131
Sequence MARIAGVDLPGRKHIVIALRYIFGVGPARSREICKRANIAETKRAEELDENEIKRVREIIDQLFKVEGDLRRETSMNIKRLMDLGCYRGLRHRRGLPVRGQRTHTNARTRKGPRRGLAVSRPAASSPPPKG

Samples

Sample ID Description Type Environment
1 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
2 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
7 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
8 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
11 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
12 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
13 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
14 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
15 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
16 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
17 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
18 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
19 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
20 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
21 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
22 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
23 3300012487 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.old.130510 Metagenome Rhizosphere
24 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
25 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
26 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
27 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
28 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
41 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
42 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
43 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
44 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
45 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
46 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
47 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
48 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
49 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
50 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
51 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
52 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
53 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
54 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
55 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
56 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
57 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
58 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
59 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
60 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
61 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
62 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
63 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
64 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
65 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
66 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
67 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
68 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
69 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
70 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
71 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
72 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
73 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
74 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
75 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
76 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
77 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
78 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
79 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
80 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
81 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
82 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
83 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
84 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
85 3300039145 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 Metagenome Unclassified
86 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
87 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
88 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
89 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
90 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
91 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
92 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
93 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
94 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
95 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
96 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
97 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
98 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
99 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
100 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
101 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
102 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
103 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
104 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
105 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
106 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
107 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
108 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
109 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
110 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
111 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
112 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
113 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
114 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
115 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
116 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
117 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
118 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
119 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
120 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
121 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
122 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
123 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
124 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
125 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
126 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
127 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
128 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
129 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
130 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
131 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
132 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
133 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
134 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
135 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
136 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
137 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
138 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
139 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
140 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
141 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
142 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
143 2524023250 Niveispirillum irakense DSM 11586 Isolate Unclassified
144 2558860983 Allorhizobium undicola ATCC 700741 Isolate Rhizoplane
145 2739367756 Asticcacaulis sp. CF398 Isolate Unclassified
146 2894817345 Aureimonas psammosilenae YIM DR1026 Isolate Unclassified
147 2917554339 Chthonobacter rhizosphaerae yh7-1 Isolate Rhizosphere
148 2928027323 Sphingomonas sp. 1185 Isolate Unclassified
149 2984555340 Sphingomonas sp. SORGH_AS789 Isolate Aerial Root
150 2984564862 Sphingomonas sp. SORGH_AS870 Isolate Aerial Root
151 2993356040 Sphingomonas sp. SORGH_AS742 Isolate Aerial Root
152 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
153 8045864390 Aurantimonas endophytica KCTC 52296 Isolate Unclassified
154 8054563764 Acuticoccus kalidii M5D2P5 Isolate Unclassified
155 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 84.88
Metatranscriptomes 8.78
Isolates 6.34

Biome Distribution

Category Percentage (%)
Aerial Root 1.46
Bulb 0
Endosphere 0.98
Nodule 0
Rhizoplane 2.93
Rhizosphere 87.32
Stem 0
Stem Tuber 0
Unclassified 1.95

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075429_100053026 3300006880 Bacteria 3529
2 Ga0058863_11931364 3300004799 Bacteria 1202
3 Ga0058861_11916138 3300004800 Bacteria 628
4 Ga0070683_100082095 3300005329 Bacteria 3018
5 Ga0070660_100309281 3300005339 Bacteria 1296
6 Ga0070671_100685110 3300005355 Bacteria 888
7 Ga0070674_100398718 3300005356 Bacteria 1124
8 Ga0070659_100172088 3300005366 Bacteria 1774
9 Ga0070714_101053747 3300005435 Bacteria 792
10 Ga0070701_10596470 3300005438 Bacteria 731
11 Ga0070711_101037575 3300005439 Bacteria 705
12 Ga0070662_100207106 3300005457 Bacteria 1559
13 Ga0068867_100085757 3300005459 Bacteria 2381
14 Ga0070684_100061474 3300005535 Bacteria 3287
15 Ga0068854_100361147 3300005578 Bacteria 1191
16 Ga0068862_100399253 3300005844 Bacteria 1286
17 Ga0081455_10003850 3300005937 Bacteria 17117
18 Ga0081455_10719319 3300005937 Bacteria 634
19 Ga0081455_11023916 3300005937 Bacteria 511
20 Ga0070717_10591967 3300006028 Bacteria 1006
21 Ga0075428_100171097 3300006844 Bacteria 2354
22 Ga0075431_100102642 3300006847 Bacteria 2951
23 Ga0075429_100078886 3300006880 Bacteria 2870
24 Ga0111539_10382497 3300009094 Bacteria 1639
25 Ga0105238_10788732 3300009551 Bacteria 965
26 Ga0157321_1012245 3300012487 Bacteria 682
27 Ga0157371_10046001 3300013102 Bacteria 3104
28 Ga0157375_11512652 3300013308 Bacteria 792
29 Ga0157379_10940404 3300014968 Bacteria 821
30 Ga0213875_10076031 3300021388 Bacteria 1567
31 Ga0207688_10076169 3300025901 Bacteria 1910
32 Ga0207705_10065219 3300025909 Bacteria 2632
33 Ga0207700_10598383 3300025928 Bacteria 981
34 Ga0207664_10640565 3300025929 Bacteria 955
35 Ga0207690_10054240 3300025932 Bacteria 2694
36 Ga0207706_10308838 3300025933 Bacteria 1377
37 Ga0207669_10601950 3300025937 Bacteria 893
38 Ga0207691_10318944 3300025940 Bacteria 1333
39 Ga0207661_10034989 3300025944 Bacteria 3911
40 Ga0207679_11065832 3300025945 Bacteria 741
41 Ga0207708_10405834 3300026075 Bacteria 1128
42 Ga0207641_11032001 3300026088 Bacteria 820
43 Ga0210000_1025669 3300027462 Bacteria 911
44 Ga0265338_10009193 3300028800 Bacteria 11839
45 Ga0307511_10056243 3300030521 Bacteria 3079
46 Ga0265332_10104902 3300031238 Bacteria 1192
47 Ga0265329_10053645 3300031242 Bacteria 1281
48 Ga0265316_10013594 3300031344 Bacteria 7222
49 Ga0265316_10412175 3300031344 Bacteria 972
50 Ga0307408_100395178 3300031548 Bacteria 1186
51 Ga0307408_100412715 3300031548 Bacteria 1162
52 Ga0307408_101101312 3300031548 Bacteria 737
53 Ga0307408_101354224 3300031548 Bacteria 669
54 Ga0316579_10250666 3300031691 Bacteria 856
55 Ga0265342_10008211 3300031712 Bacteria 7520
56 Ga0316576_10000348 3300031727 Bacteria 20800
57 Ga0316576_10041082 3300031727 Bacteria 3327
58 Ga0316578_10010231 3300031728 Bacteria 4860
59 Ga0307405_10598540 3300031731 Bacteria 899
60 Ga0316577_10000261 3300031733 Bacteria 18660
61 Ga0307416_100778170 3300032002 Bacteria 1051
62 Ga0307416_101520262 3300032002 Bacteria 775
63 Ga0307416_102148187 3300032002 Bacteria 660
64 Ga0307415_100168087 3300032126 Bacteria 1707
65 Ga0316583_10000484 3300032133 Bacteria 11841
66 Ga0316580_10001702 3300032139 Bacteria 5852
67 Ga0316593_10015313 3300032168 Bacteria 2304
68 Ga0316593_10018838 3300032168 Bacteria 2127
69 Ga0316593_10109683 3300032168 Bacteria 985
70 Ga0316593_10134172 3300032168 Bacteria 894
71 Ga0316593_10151511 3300032168 Bacteria 844
72 Ga0316593_10370256 3300032168 Unclassified 550
73 Ga0316593_10400694 3300032168 Bacteria 530
74 Ga0316592_1019420 3300033524 Bacteria 1437
75 Ga0316586_1030524 3300033527 Bacteria 922
76 Ga0316588_1013916 3300033528 Unclassified 1754
77 Ga0316588_1094842 3300033528 Bacteria 745
78 Ga0316587_1006300 3300033529 Unclassified 1808
79 Ga0316596_1011638 3300033541 Bacteria 2154
80 Ga0316596_1119964 3300033541 Bacteria 716
81 Ga0316596_1151806 3300033541 Bacteria 636
82 Ga0373944_0210829 3300035089 Bacteria 706
83 Ga0373953_0039605 3300035117 Bacteria 1868
84 Ga0373954_0079158 3300035118 Bacteria 1569
85 Ga0373957_0162861 3300035120 Bacteria 919
86 Ga0373955_0184335 3300035172 Bacteria 1239
87 Ga0316574_0356891 3300035398 Bacteria 924
88 Ga0373924_0461683 3300035410 Bacteria 570
89 Ga0373935_0086207 3300035692 Bacteria 2049
90 Ga0373927_0028727 3300035695 Bacteria 3628
91 Ga0373947_0043635 3300035725 Bacteria 2679
92 Ga0373937_0051996 3300036401 Bacteria 3755
93 Ga0316582_0143990 3300036647 Bacteria 1608
94 Ga0316584_0001628 3300036712 Bacteria 13707
95 Ga0373925_0013826 3300037068 Bacteria 5843
96 Ga0395899_0248066 3300037312 Unclassified 1223
97 Ga0395900_0988970 3300037418 Bacteria 761
98 Ga0395898_0189639 3300037466 Bacteria 1964
99 Ga0395905_0379367 3300037471 Bacteria 1307
100 Ga0316581_0049497 3300037588 Bacteria 1287
101 Ga0436364_0052810 3300037853 Bacteria 1772
102 Ga0395901_0498104 3300038443 Bacteria 1240
103 Ga0395901_1455288 3300038443 Bacteria 642
104 Ga0237819_00478 3300038705 Bacteria 13587
105 Ga0237816_01489 3300039145 Bacteria 1888
106 Ga0436363_0246938 3300039450 Bacteria 1627
107 Ga0436363_0444327 3300039450 Bacteria 3265
108 Ga0436362_0212689 3300039453 Bacteria 1863
109 Ga0439434_0065370 3300042435 Bacteria 1141
110 Ga0451577_0537906 3300042876 Bacteria 1061
111 Ga0451577_0850021 3300042876 Bacteria 823
112 Ga0453683_0043820 3300044673 Bacteria 2808
113 Ga0453683_0332767 3300044673 Bacteria 974
114 Ga0453683_0698459 3300044673 Bacteria 665
115 Ga0453684_0006155 3300044712 Bacteria 23081
116 Ga0453684_0041859 3300044712 Bacteria 6185
117 Ga0453684_0072448 3300044712 Bacteria 4349
118 Ga0453684_0100808 3300044712 Bacteria 3534
119 Ga0453684_0282064 3300044712 Bacteria 1894
120 Ga0453684_0648308 3300044712 Bacteria 1153
121 Ga0453684_2261188 3300044712 Bacteria 542
122 Ga0466959_1212402 3300045049 Bacteria 501
123 Ga0451576_0031820 3300045051 Bacteria 5623
124 Ga0451576_0111662 3300045051 Bacteria 2845
125 Ga0451576_0167887 3300045051 Bacteria 2290
126 Ga0451576_0342454 3300045051 Bacteria 1565
127 Ga0451576_2547696 3300045051 Bacteria 522
128 Ga0451576_2690855 3300045051 Bacteria 506
129 Ga0495582_0526336 3300046473 Bacteria 684
130 Ga0495662_0069401 3300046476 Bacteria 1707
131 Ga0495664_0235690 3300046477 Bacteria 1107
132 Ga0495596_0000553 3300046500 Bacteria 23415
133 Ga0495610_0020808 3300046512 Bacteria 3630
134 Ga0495630_0370985 3300046517 Bacteria 1096
135 Ga0495643_0299120 3300046522 Bacteria 734
136 Ga0495648_0132866 3300046524 Bacteria 1321
137 Ga0495640_0001806 3300046533 Bacteria 16965
138 Ga0495656_0116198 3300046615 Bacteria 1257
139 Ga0495656_0694103 3300046615 Bacteria 547
140 Ga0495634_0063355 3300046642 Bacteria 2454
141 Ga0495658_0333346 3300046683 Bacteria 963
142 Ga0495624_0398207 3300046690 Bacteria 827
143 Ga0495581_0509123 3300047315 Bacteria 700
144 Ga0495674_0099319 3300047319 Bacteria 2478
145 Ga0495684_0512989 3300047471 Bacteria 822
146 Ga0495626_0000356 3300048091 Bacteria 47831
147 Ga0496104_0050643 3300048907 Bacteria 3919
148 Ga0496105_0536180 3300048908 Bacteria 915
149 Ga0496105_1423157 3300048908 Bacteria 501
150 Ga0496114_0043476 3300048917 Bacteria 3725
151 Ga0496114_0949757 3300048917 Bacteria 742
152 Ga0501031_0307055 3300049568 Bacteria 1028
153 Ga0501032_1001525 3300049569 Bacteria 525
154 Ga0501036_0074441 3300049572 Bacteria 2872
155 Ga0501036_0340246 3300049572 Bacteria 1253
156 Ga0501037_0901510 3300049573 Bacteria 580
157 Ga0501039_0072239 3300049575 Bacteria 2681
158 Ga0501039_0665069 3300049575 Bacteria 815
159 Ga0501040_0120821 3300049576 Bacteria 1838
160 Ga0501040_0473480 3300049576 Bacteria 902
161 Ga0501042_0718640 3300049578 Bacteria 726
162 Ga0501046_0680153 3300049580 Bacteria 726
163 Ga0501047_0786281 3300049581 Bacteria 767
164 Ga0501048_0386109 3300049582 Bacteria 1000
165 Ga0501048_0910625 3300049582 Bacteria 632
166 Ga0501048_0979845 3300049582 Bacteria 608
167 Ga0501070_0935676 3300049586 Bacteria 675
168 Ga0501071_0023881 3300049587 Bacteria 4273
169 Ga0501071_1305995 3300049587 Bacteria 560
170 Ga0501072_0769094 3300049588 Bacteria 755
171 Ga0501073_1069636 3300049589 Bacteria 555
172 Ga0501075_0025657 3300049591 Bacteria 4330
173 Ga0501075_0121937 3300049591 Bacteria 1984
174 Ga0501076_0105670 3300049592 Bacteria 2272
175 Ga0501079_0041070 3300049741 Bacteria 3570
176 Ga0501079_0097445 3300049741 Bacteria 2280
177 Ga0501080_0756903 3300049742 Bacteria 854
178 Ga0501081_0072231 3300049743 Bacteria 2406
179 Ga0501081_0616428 3300049743 Bacteria 813
180 Ga0501083_0353090 3300049744 Bacteria 956
181 Ga0501035_0247190 3300049822 Bacteria 1516
182 Ga0501044_0558548 3300049823 Bacteria 1041
183 nmdc:mga09592_21071_c1 3300050508 Bacteria 5368
184 Ga0495601_0350149 3300053077 Bacteria 960
185 Ga0500556_0006985 3300053104 Bacteria 3220
186 Ga0500645_006189 3300053730 Bacteria 4299
187 Ga0501084_0104651 3300054114 Bacteria 2377
188 Ga0501084_0156124 3300054114 Bacteria 1924
189 Ga0587062_050762 3300059639 Bacteria 701
190 Ga0530510_0015081 3300061734 Bacteria 5459
191 Ga0530510_0185621 3300061734 Bacteria 1543
192 Ga0530510_0264110 3300061734 Bacteria 1284
193 2524609955 2524023250 Bacteria 5457705
194 2561468213 2558860983 Bacteria 4133860
195 2739792119 2739367756 Bacteria 4553612
196 2894818647 2894817345 Bacteria 4892941
197 2917555121 2917554339 Bacteria 4987857
198 2928031188 2928027323 Bacteria 4382488
199 2984557409 2984555340 Bacteria 4247089
200 2984568194 2984564862 Bacteria 4339992
201 2993359274 2993356040 Bacteria 4247105
202 8005659714 8005658619 Bacteria 4500593
203 8045865485 8045864390 Bacteria 5043873
204 8054566733 8054563764 Bacteria 5592885
205 8055435793 8055431914 Bacteria 4551896
206 Ga0075429_100053026
207 Ga0058863_11931364
208 Ga0058861_11916138
209 Ga0070683_100082095
210 Ga0070660_100309281
211 Ga0070671_100685110
212 Ga0070674_100398718
213 Ga0070659_100172088
214 Ga0070714_101053747
215 Ga0070701_10596470
216 Ga0070711_101037575
217 Ga0070662_100207106
218 Ga0068867_100085757
219 Ga0070684_100061474
220 Ga0068854_100361147
221 Ga0068862_100399253
222 Ga0081455_10003850
223 Ga0081455_10719319
224 Ga0081455_11023916
225 Ga0070717_10591967
226 Ga0075428_100171097
227 Ga0075431_100102642
228 Ga0075429_100078886
229 Ga0111539_10382497
230 Ga0105238_10788732
231 Ga0157321_1012245
232 Ga0157371_10046001
233 Ga0157375_11512652
234 Ga0157379_10940404
235 Ga0213875_10076031
236 Ga0207688_10076169
237 Ga0207705_10065219
238 Ga0207700_10598383
239 Ga0207664_10640565
240 Ga0207690_10054240
241 Ga0207706_10308838
242 Ga0207669_10601950
243 Ga0207691_10318944
244 Ga0207661_10034989
245 Ga0207679_11065832
246 Ga0207708_10405834
247 Ga0207641_11032001
248 Ga0210000_1025669
249 Ga0265338_10009193
250 Ga0307511_10056243
251 Ga0265332_10104902
252 Ga0265329_10053645
253 Ga0265316_10013594
254 Ga0265316_10412175
255 Ga0307408_100395178
256 Ga0307408_100412715
257 Ga0307408_101101312
258 Ga0307408_101354224
259 Ga0316579_10250666
260 Ga0265342_10008211
261 Ga0316576_10000348
262 Ga0316576_10041082
263 Ga0316578_10010231
264 Ga0307405_10598540
265 Ga0316577_10000261
266 Ga0307416_100778170
267 Ga0307416_101520262
268 Ga0307416_102148187
269 Ga0307415_100168087
270 Ga0316583_10000484
271 Ga0316580_10001702
272 Ga0316593_10015313
273 Ga0316593_10018838
274 Ga0316593_10109683
275 Ga0316593_10134172
276 Ga0316593_10151511
277 Ga0316593_10370256
278 Ga0316593_10400694
279 Ga0316592_1019420
280 Ga0316586_1030524
281 Ga0316588_1013916
282 Ga0316588_1094842
283 Ga0316587_1006300
284 Ga0316596_1011638
285 Ga0316596_1119964
286 Ga0316596_1151806
287 Ga0373944_0210829
288 Ga0373953_0039605
289 Ga0373954_0079158
290 Ga0373957_0162861
291 Ga0373955_0184335
292 Ga0316574_0356891
293 Ga0373924_0461683
294 Ga0373935_0086207
295 Ga0373927_0028727
296 Ga0373947_0043635
297 Ga0373937_0051996
298 Ga0316582_0143990
299 Ga0316584_0001628
300 Ga0373925_0013826
301 Ga0395899_0248066
302 Ga0395900_0988970
303 Ga0395898_0189639
304 Ga0395905_0379367
305 Ga0316581_0049497
306 Ga0436364_0052810
307 Ga0395901_0498104
308 Ga0395901_1455288
309 Ga0237819_00478
310 Ga0237816_01489
311 Ga0436363_0246938
312 Ga0436363_0444327
313 Ga0436362_0212689
314 Ga0439434_0065370
315 Ga0451577_0537906
316 Ga0451577_0850021
317 Ga0453683_0043820
318 Ga0453683_0332767
319 Ga0453683_0698459
320 Ga0453684_0006155
321 Ga0453684_0041859
322 Ga0453684_0072448
323 Ga0453684_0100808
324 Ga0453684_0282064
325 Ga0453684_0648308
326 Ga0453684_2261188
327 Ga0466959_1212402
328 Ga0451576_0031820
329 Ga0451576_0111662
330 Ga0451576_0167887
331 Ga0451576_0342454
332 Ga0451576_2547696
333 Ga0451576_2690855
334 Ga0495582_0526336
335 Ga0495662_0069401
336 Ga0495664_0235690
337 Ga0495596_0000553
338 Ga0495610_0020808
339 Ga0495630_0370985
340 Ga0495643_0299120
341 Ga0495648_0132866
342 Ga0495640_0001806
343 Ga0495656_0116198
344 Ga0495656_0694103
345 Ga0495634_0063355
346 Ga0495658_0333346
347 Ga0495624_0398207
348 Ga0495581_0509123
349 Ga0495674_0099319
350 Ga0495684_0512989
351 Ga0495626_0000356
352 Ga0496104_0050643
353 Ga0496105_0536180
354 Ga0496105_1423157
355 Ga0496114_0043476
356 Ga0496114_0949757
357 Ga0501031_0307055
358 Ga0501032_1001525
359 Ga0501036_0074441
360 Ga0501036_0340246
361 Ga0501037_0901510
362 Ga0501039_0072239
363 Ga0501039_0665069
364 Ga0501040_0120821
365 Ga0501040_0473480
366 Ga0501042_0718640
367 Ga0501046_0680153
368 Ga0501047_0786281
369 Ga0501048_0386109
370 Ga0501048_0910625
371 Ga0501048_0979845
372 Ga0501070_0935676
373 Ga0501071_0023881
374 Ga0501071_1305995
375 Ga0501072_0769094
376 Ga0501073_1069636
377 Ga0501075_0025657
378 Ga0501075_0121937
379 Ga0501076_0105670
380 Ga0501079_0041070
381 Ga0501079_0097445
382 Ga0501080_0756903
383 Ga0501081_0072231
384 Ga0501081_0616428
385 Ga0501083_0353090
386 Ga0501035_0247190
387 Ga0501044_0558548
388 nmdc:mga09592_21071_c1
389 Ga0495601_0350149
390 Ga0500556_0006985
391 Ga0500645_006189
392 Ga0501084_0104651
393 Ga0501084_0156124
394 Ga0587062_050762
395 Ga0530510_0015081
396 Ga0530510_0185621
397 Ga0530510_0264110
398 2524609955
399 2561468213
400 2739792119
401 2894818647
402 2917555121
403 2928031188
404 2984557409
405 2984568194
406 2993359274
407 8005659714
408 8045865485
409 8054566733
410 8055435793

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00416

Ribosomal_S13

Ribosomal protein S13/S18

3

109

0.99

Map