F313500

General Info

Members Datasets Scaffolds Average Seq Length
205 144 204 150

Family's Representative Sequence

Representative Sequence 3300005435|Ga0070714_100096418|Ga0070714_1000964183
Length 158
Sequence VSLVAAGSPAPDFKLRRGDGSKFTNADLAGQTTILVFYPFAFSPVCTDQLNLYEEVLEQFAAQGATLYGVSCDAVWSQTAFKEKLGVSIEQLSDFEPKGATCRAFGVYHEKGGMPQRALVMIGPDGIVEWSYMAPSPGDLPGANLIFDALAARDERAR

Samples

Sample ID Description Type Environment
1 2905999023 Chryseobacterium elymi KCTC 22547 Isolate Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
7 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
8 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
9 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
14 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
15 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
16 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
17 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
18 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
19 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
20 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
21 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
22 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
23 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
24 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
25 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
26 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
27 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
28 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
29 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
30 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
31 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
32 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
33 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
34 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
35 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
36 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
38 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
40 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
41 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
42 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
43 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
44 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
45 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
46 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
47 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
48 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
49 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
50 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
51 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
52 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
73 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
77 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
78 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
79 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
80 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
81 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
82 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
83 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
84 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
85 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
86 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
87 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
88 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
89 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
90 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
91 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
92 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
93 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
94 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
95 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
96 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
97 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
98 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
99 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
100 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
101 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
102 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
103 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
104 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
105 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
106 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
107 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
108 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
109 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
110 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
111 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
112 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
113 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
114 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
115 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
116 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
117 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
118 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
119 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
120 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
121 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
122 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
123 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
124 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
125 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
126 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
127 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
128 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
129 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
130 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
131 3300049757 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control Metagenome Rhizosphere
132 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
133 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
134 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
135 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
136 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
137 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
138 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
139 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
140 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
141 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
142 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
143 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
144 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.02
Metatranscriptomes 0.49
Isolates 0.49

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.49
Rhizosphere 99.02
Stem 0
Stem Tuber 0
Unclassified 0.49

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24751J29686_10024455 3300002459 Unclassified 1253
2 JGI25407J50210_10047737 3300003373 Bacteria 1088
3 JGI25407J50210_10050324 3300003373 Bacteria 1057
4 Ga0070683_100501506 3300005329 Bacteria 1159
5 Ga0070683_101105118 3300005329 Bacteria 761
6 Ga0070690_100827775 3300005330 Bacteria 720
7 Ga0070692_10004854 3300005345 Bacteria 5657
8 Ga0070692_10178588 3300005345 Unclassified 1229
9 Ga0070668_100032008 3300005347 Bacteria 4002
10 Ga0070674_101521294 3300005356 Bacteria 602
11 Ga0070673_100658854 3300005364 Bacteria 959
12 Ga0070659_100001291 3300005366 Bacteria 18154
13 Ga0070659_100246219 3300005366 Bacteria 1481
14 Ga0070659_100984441 3300005366 Bacteria 740
15 Ga0070714_100096418 3300005435 Bacteria 2599
16 Ga0070714_100121959 3300005435 Bacteria 2320
17 Ga0070713_100384773 3300005436 Bacteria 1308
18 Ga0070713_100582247 3300005436 Bacteria 1062
19 Ga0070701_10570946 3300005438 Bacteria 745
20 Ga0070700_100264494 3300005441 Bacteria 1240
21 Ga0070700_101587213 3300005441 Bacteria 559
22 Ga0070678_100515757 3300005456 Bacteria 1057
23 Ga0070662_100002010 3300005457 Bacteria 12457
24 Ga0070684_100520410 3300005535 Bacteria 1102
25 Ga0070684_100672124 3300005535 Bacteria 965
26 Ga0070684_101000247 3300005535 Bacteria 785
27 Ga0070665_100811679 3300005548 Bacteria 948
28 Ga0070665_100878108 3300005548 Bacteria 910
29 Ga0070664_100165430 3300005564 Bacteria 1960
30 Ga0070702_101046394 3300005615 Bacteria 649
31 Ga0068852_100302732 3300005616 Unclassified 1548
32 Ga0068852_100728946 3300005616 Bacteria 1003
33 Ga0068866_10243783 3300005718 Bacteria 1096
34 Ga0068861_100091518 3300005719 Bacteria 2401
35 Ga0068861_100283390 3300005719 Bacteria 1428
36 Ga0068870_11006818 3300005840 Bacteria 594
37 Ga0068858_100831996 3300005842 Unclassified 901
38 Ga0068862_100391923 3300005844 Bacteria 1298
39 Ga0068862_102170762 3300005844 Bacteria 567
40 Ga0081538_10009337 3300005981 Bacteria 8200
41 Ga0081538_10014727 3300005981 Bacteria 6102
42 Ga0081538_10035003 3300005981 Bacteria 3308
43 Ga0081538_10088382 3300005981 Bacteria 1613
44 Ga0070717_10107618 3300006028 Bacteria 2374
45 Ga0075428_100385449 3300006844 Bacteria 1503
46 Ga0075430_100029183 3300006846 Bacteria 4682
47 Ga0075430_100370349 3300006846 Unclassified 1183
48 Ga0075430_101099348 3300006846 Bacteria 655
49 Ga0075431_100323088 3300006847 Bacteria 1556
50 Ga0075433_10020062 3300006852 Bacteria 5582
51 Ga0068865_100440233 3300006881 Bacteria 1075
52 Ga0075435_100208977 3300007076 Bacteria 1655
53 Ga0105240_10084580 3300009093 Bacteria 3889
54 Ga0105240_12264519 3300009093 Bacteria 563
55 Ga0111539_10034630 3300009094 Bacteria 6119
56 Ga0111539_13280866 3300009094 Unclassified 521
57 Ga0105245_10000728 3300009098 Bacteria 29647
58 Ga0105245_12757396 3300009098 Bacteria 544
59 Ga0114129_11005216 3300009147 Bacteria 1050
60 Ga0105242_10473956 3300009176 Bacteria 1185
61 Ga0105249_10003343 3300009553 Bacteria 13883
62 Ga0105249_11640740 3300009553 Bacteria 715
63 Ga0105239_10038799 3300010375 Bacteria 5218
64 Ga0105239_10098837 3300010375 Bacteria 3226
65 Ga0157371_11401070 3300013102 Bacteria 543
66 Ga0157370_10028047 3300013104 Bacteria 5544
67 Ga0157369_11192214 3300013105 Bacteria 777
68 Ga0163162_10013834 3300013306 Bacteria 7883
69 Ga0157372_10236632 3300013307 Bacteria 2118
70 Ga0157372_11597327 3300013307 Bacteria 751
71 Ga0157375_10267160 3300013308 Bacteria 1872
72 Ga0157375_10404612 3300013308 Bacteria 1531
73 Ga0163163_10613975 3300014325 Bacteria 1151
74 Ga0157380_10191816 3300014326 Bacteria 1805
75 Ga0157376_10038470 3300014969 Bacteria 3893
76 Ga0206353_11154832 3300020082 Bacteria 2336
77 Ga0207656_10599222 3300025321 Unclassified 562
78 Ga0207695_10035094 3300025913 Bacteria 5444
79 Ga0207687_10035559 3300025927 Bacteria 3389
80 Ga0207700_10453711 3300025928 Bacteria 1130
81 Ga0207664_10022140 3300025929 Bacteria 4741
82 Ga0207690_10000061 3300025932 Bacteria 98910
83 Ga0207690_10183814 3300025932 Bacteria 1576
84 Ga0207690_10924013 3300025932 Bacteria 724
85 Ga0207706_10045950 3300025933 Bacteria 3867
86 Ga0207706_10049986 3300025933 Bacteria 3694
87 Ga0207706_10417920 3300025933 Bacteria 1162
88 Ga0207686_10124975 3300025934 Bacteria 1757
89 Ga0207709_10054229 3300025935 Bacteria 2471
90 Ga0207669_10431341 3300025937 Bacteria 1040
91 Ga0207704_10422776 3300025938 Bacteria 1057
92 Ga0207661_10259436 3300025944 Bacteria 1548
93 Ga0207661_11492752 3300025944 Bacteria 619
94 Ga0207661_11515091 3300025944 Bacteria 614
95 Ga0207679_10105850 3300025945 Bacteria 2209
96 Ga0207712_10039946 3300025961 Bacteria 3217
97 Ga0207668_10372840 3300025972 Bacteria 1199
98 Ga0207678_10508772 3300026067 Bacteria 1050
99 Ga0207678_10697691 3300026067 Bacteria 893
100 Ga0207708_10008883 3300026075 Bacteria 7437
101 Ga0207708_10923925 3300026075 Bacteria 756
102 Ga0207648_10360420 3300026089 Bacteria 1312
103 Ga0207675_100015701 3300026118 Bacteria 7063
104 Ga0207675_100306173 3300026118 Bacteria 1549
105 Ga0207698_10100412 3300026142 Bacteria 2397
106 Ga0207698_10315380 3300026142 Bacteria 1462
107 Ga0207698_11200022 3300026142 Unclassified 773
108 Ga0207428_10017889 3300027907 Bacteria 6075
109 Ga0207428_10800140 3300027907 Bacteria 670
110 Ga0268266_10333684 3300028379 Bacteria 1422
111 Ga0268265_10326169 3300028380 Bacteria 1393
112 Ga0268264_10685057 3300028381 Bacteria 1017
113 Ga0265326_10000032 3300028558 Bacteria 94371
114 Ga0265326_10134589 3300028558 Bacteria 704
115 Ga0265319_1000517 3300028563 Bacteria 26603
116 Ga0265334_10000002 3300028573 Bacteria 325014
117 Ga0265322_10026397 3300028654 Bacteria 1660
118 Ga0265338_10100680 3300028800 Bacteria 2355
119 Ga0265338_10268337 3300028800 Bacteria 1251
120 Ga0265324_10010539 3300029957 Bacteria 3556
121 Ga0265327_10066428 3300031251 Bacteria 1820
122 Ga0307405_10257319 3300031731 Bacteria 1302
123 Ga0307405_10601122 3300031731 Bacteria 898
124 Ga0307410_10157117 3300031852 Bacteria 1700
125 Ga0307410_11005972 3300031852 Bacteria 719
126 Ga0326468_10029899 3300031889 Bacteria 715
127 Ga0307406_10176049 3300031901 Bacteria 1553
128 Ga0307406_10325202 3300031901 Bacteria 1191
129 Ga0307406_11320873 3300031901 Bacteria 630
130 Ga0307409_100231589 3300031995 Bacteria 1675
131 Ga0307409_100253556 3300031995 Bacteria 1610
132 Ga0307409_100621793 3300031995 Bacteria 1070
133 Ga0307416_100383771 3300032002 Bacteria 1436
134 Ga0307416_100567756 3300032002 Bacteria 1210
135 Ga0307416_101368984 3300032002 Bacteria 813
136 Ga0307414_11438994 3300032004 Bacteria 641
137 Ga0307415_101420442 3300032126 Bacteria 661
138 Ga0373929_0075263 3300035085 Bacteria 814
139 Ga0373941_0052879 3300035115 Bacteria 1297
140 Ga0373962_0227498 3300035242 Bacteria 640
141 Ga0373931_0044296 3300035691 Bacteria 2346
142 Ga0395900_0402966 3300037418 Bacteria 1332
143 Ga0395898_1189835 3300037466 Bacteria 694
144 Ga0451798_0180539 3300041458 Bacteria 829
145 Ga0451851_0613652 3300041507 Unclassified 544
146 Ga0439450_135677 3300042008 Bacteria 640
147 Ga0466966_0292708 3300044684 Bacteria 979
148 Ga0466963_0072479 3300044694 Bacteria 2320
149 Ga0466963_0118315 3300044694 Bacteria 1822
150 Ga0466964_0051362 3300044706 Bacteria 1693
151 Ga0466971_0245908 3300044719 Bacteria 851
152 Ga0466968_0050351 3300044735 Bacteria 1777
153 Ga0466959_0043410 3300045049 Bacteria 3314
154 Ga0466959_0328899 3300045049 Bacteria 1044
155 Ga0466967_0305565 3300045976 Bacteria 1531
156 Ga0466967_1500967 3300045976 Bacteria 671
157 Ga0466967_1961966 3300045976 Bacteria 582
158 Ga0495664_0187595 3300046477 Bacteria 1254
159 Ga0495584_0596469 3300046491 Unclassified 563
160 Ga0495620_0169537 3300046515 Bacteria 847
161 Ga0495631_0167767 3300046518 Bacteria 942
162 Ga0495644_0108071 3300046523 Bacteria 1055
163 Ga0495645_0432072 3300046543 Bacteria 834
164 Ga0495661_0349192 3300046665 Bacteria 729
165 Ga0495669_0361728 3300046684 Bacteria 702
166 Ga0495672_0055774 3300047320 Bacteria 2304
167 Ga0495677_0135280 3300047445 Bacteria 945
168 Ga0501031_0132120 3300049568 Bacteria 1631
169 Ga0501036_0116666 3300049572 Bacteria 2255
170 Ga0501036_1558524 3300049572 Bacteria 534
171 Ga0501040_0125568 3300049576 Bacteria 1802
172 Ga0501041_0073575 3300049577 Bacteria 2100
173 Ga0501046_0064879 3300049580 Bacteria 2850
174 Ga0501048_0722766 3300049582 Bacteria 715
175 Ga0501067_0384473 3300049583 Unclassified 783
176 Ga0501068_0271036 3300049584 Bacteria 1084
177 Ga0501069_0636582 3300049585 Unclassified 641
178 Ga0501071_0247828 3300049587 Bacteria 1344
179 Ga0501075_0120356 3300049591 Bacteria 1998
180 Ga0501075_0214167 3300049591 Bacteria 1469
181 Ga0501077_0137747 3300049593 Bacteria 1548
182 Ga0501079_1186719 3300049741 Bacteria 601
183 Ga0501080_0433941 3300049742 Bacteria 1179
184 Ga0501232_065953 3300049757 Bacteria 589
185 Ga0501044_1196245 3300049823 Bacteria 628
186 Ga0501045_0132484 3300049824 Bacteria 1853
187 nmdc:mga05p37_136592_c1 3300050507 Bacteria 3006
188 nmdc:mga05p37_406850_c1 3300050507 Bacteria 1587
189 nmdc:mga09592_1174279_c1 3300050508 Bacteria 635
190 nmdc:mga09592_53880_c1 3300050508 Bacteria 3397
191 nmdc:mga0qj67_102915_c1 3300050509 Bacteria 2303
192 nmdc:mga0qj67_209024_c1 3300050509 Bacteria 1585
193 nmdc:mga0qj67_432293_c1 3300050509 Bacteria 1061
194 nmdc:mga06r32_1544068_c1 3300050510 Bacteria 603
195 nmdc:mga06r32_1891436_c1 3300050510 Bacteria 531
196 nmdc:mga06r32_62988_c1 3300050510 Bacteria 3573
197 nmdc:mga08y16_27344_c1 3300050511 Bacteria 6009
198 nmdc:mga0rr50_437326_c1 3300050513 Bacteria 1108
199 nmdc:mga0a205_110310_c1 3300050515 Bacteria 2650
200 Ga0495601_0435770 3300053077 Bacteria 848
201 Ga0501082_0310688 3300060353 Bacteria 1373
202 Ga0466962_0074683 3300061719 Bacteria 1620
203 Ga0530510_0137760 3300061734 Bacteria 1797
204 Ga0530510_0719585 3300061734 Bacteria 761

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005364 Ga0070673_100658854 Ga0070673_1006588543 128
2 3300005535 Ga0070684_100672124 Ga0070684_1006721242 128
3 3300005616 Ga0068852_100728946 Ga0068852_1007289462 128
4 3300005719 Ga0068861_100283390 Ga0068861_1002833901 128
5 3300009553 Ga0105249_11640740 Ga0105249_116407402 128
6 3300013308 Ga0157375_10267160 Ga0157375_102671602 128
7 3300025932 Ga0207690_10924013 Ga0207690_109240131 128
8 3300025933 Ga0207706_10417920 Ga0207706_104179202 128
9 3300025935 Ga0207709_10054229 Ga0207709_100542293 128
10 3300025944 Ga0207661_10259436 Ga0207661_102594363 128
11 3300026118 Ga0207675_100306173 Ga0207675_1003061731 128
12 3300028381 Ga0268264_10685057 Ga0268264_106850572 128
13 3300013105 Ga0157369_11192214 Ga0157369_111922142 129
14 3300026142 Ga0207698_11200022 Ga0207698_112000222 129
15 3300044735 Ga0466968_0050351 Ga0466968_0050351_530_1009 129
16 3300031901 Ga0307406_10325202 Ga0307406_103252022 131
17 3300031995 Ga0307409_100231589 Ga0307409_1002315893 131
18 3300025972 Ga0207668_10372840 Ga0207668_103728403 132
19 3300042008 Ga0439450_135677 Ga0439450_135677_116_580 132
20 3300003373 JGI25407J50210_10050324 JGI25407J50210_100503242 133
21 3300005981 Ga0081538_10014727 Ga0081538_100147274 133
22 3300005981 Ga0081538_10035003 Ga0081538_100350035 133
23 3300032002 Ga0307416_100567756 Ga0307416_1005677562 133
24 3300014325 Ga0163163_10613975 Ga0163163_106139752 134
25 3300005436 Ga0070713_100384773 Ga0070713_1003847733 147
26 3300009093 Ga0105240_12264519 Ga0105240_122645191 147
27 3300044684 Ga0466966_0292708 Ga0466966_0292708_229_675 147
28 3300044694 Ga0466963_0072479 Ga0466963_0072479_87_533 147
29 3300044706 Ga0466964_0051362 Ga0466964_0051362_689_1135 147
30 3300044719 Ga0466971_0245908 Ga0466971_0245908_299_745 147
31 3300045049 Ga0466959_0043410 Ga0466959_0043410_972_1418 147
32 3300045976 Ga0466967_1961966 Ga0466967_1961966_71_517 147
33 3300061719 Ga0466962_0074683 Ga0466962_0074683_1008_1454 147
34 3300005330 Ga0070690_100827775 Ga0070690_1008277752 148
35 3300005435 Ga0070714_100121959 Ga0070714_1001219592 148
36 3300005436 Ga0070713_100582247 Ga0070713_1005822471 148
37 3300006028 Ga0070717_10107618 Ga0070717_101076182 148
38 3300025928 Ga0207700_10453711 Ga0207700_104537112 148
39 3300041507 Ga0451851_0613652 Ga0451851_0613652_33_485 148
40 3300046477 Ga0495664_0187595 Ga0495664_0187595_151_600 148
41 3300046543 Ga0495645_0432072 Ga0495645_0432072_305_754 148
42 3300053077 Ga0495601_0435770 Ga0495601_0435770_53_502 148
43 3300005438 Ga0070701_10570946 Ga0070701_105709462 149
44 3300005535 Ga0070684_101000247 Ga0070684_1010002471 149
45 3300005564 Ga0070664_100165430 Ga0070664_1001654303 149
46 3300005615 Ga0070702_101046394 Ga0070702_1010463942 149
47 3300006881 Ga0068865_100440233 Ga0068865_1004402333 149
48 3300013307 Ga0157372_11597327 Ga0157372_115973272 149
49 3300025321 Ga0207656_10599222 Ga0207656_105992221 149
50 3300025933 Ga0207706_10045950 Ga0207706_100459502 149
51 3300025938 Ga0207704_10422776 Ga0207704_104227762 149
52 3300025945 Ga0207679_10105850 Ga0207679_101058504 149
53 3300026142 Ga0207698_10100412 Ga0207698_101004123 149
54 3300049823 Ga0501044_1196245 Ga0501044_1196245_146_601 149
55 iso_pu_bacteria 2905999023 2905999739 149
56 3300005456 Ga0070678_100515757 Ga0070678_1005157572 150
57 3300005548 Ga0070665_100878108 Ga0070665_1008781081 150
58 3300005840 Ga0068870_11006818 Ga0068870_110068181 150
59 3300005844 Ga0068862_102170762 Ga0068862_1021707622 150
60 3300014326 Ga0157380_10191816 Ga0157380_101918163 150
61 3300025934 Ga0207686_10124975 Ga0207686_101249752 150
62 3300028379 Ga0268266_10333684 Ga0268266_103336843 150
63 3300044694 Ga0466963_0118315 Ga0466963_0118315_1180_1638 150
64 3300005535 Ga0070684_100520410 Ga0070684_1005204102 151
65 3300007076 Ga0075435_100208977 Ga0075435_1002089773 151
66 3300013308 Ga0157375_10404612 Ga0157375_104046122 151
67 3300028558 Ga0265326_10000032 Ga0265326_10000032103 151
68 3300028558 Ga0265326_10134589 Ga0265326_101345892 151
69 3300028563 Ga0265319_1000517 Ga0265319_100051720 151
70 3300028573 Ga0265334_10000002 Ga0265334_10000002118 151
71 3300028654 Ga0265322_10026397 Ga0265322_100263973 151
72 3300028800 Ga0265338_10100680 Ga0265338_101006803 151
73 3300028800 Ga0265338_10268337 Ga0265338_102683372 151
74 3300029957 Ga0265324_10010539 Ga0265324_100105393 151
75 3300031251 Ga0265327_10066428 Ga0265327_100664282 151
76 3300050513 nmdc:mga0rr50_437326_c1 nmdc:mga0rr50_437326_c1_479_940 151
77 3300005329 Ga0070683_100501506 Ga0070683_1005015063 152
78 3300005345 Ga0070692_10004854 Ga0070692_100048544 152
79 3300005366 Ga0070659_100001291 Ga0070659_10000129111 152
80 3300005366 Ga0070659_100246219 Ga0070659_1002462193 152
81 3300009093 Ga0105240_10084580 Ga0105240_100845803 152
82 3300009098 Ga0105245_12757396 Ga0105245_127573961 152
83 3300010375 Ga0105239_10098837 Ga0105239_100988373 152
84 3300020082 Ga0206353_11154832 Ga0206353_111548322 152
85 3300025913 Ga0207695_10035094 Ga0207695_100350946 152
86 3300025932 Ga0207690_10000061 Ga0207690_10000061103 152
87 3300025944 Ga0207661_11515091 Ga0207661_115150911 152
88 3300026067 Ga0207678_10697691 Ga0207678_106976912 152
89 3300026089 Ga0207648_10360420 Ga0207648_103604202 152
90 3300045049 Ga0466959_0328899 Ga0466959_0328899_356_847 152
91 3300045976 Ga0466967_0305565 Ga0466967_0305565_1057_1518 152
92 3300045976 Ga0466967_1500967 Ga0466967_1500967_155_616 152
93 3300003373 JGI25407J50210_10047737 JGI25407J50210_100477372 153
94 3300005345 Ga0070692_10178588 Ga0070692_101785882 153
95 3300005347 Ga0070668_100032008 Ga0070668_1000320083 153
96 3300005356 Ga0070674_101521294 Ga0070674_1015212941 153
97 3300005366 Ga0070659_100984441 Ga0070659_1009844411 153
98 3300005441 Ga0070700_100264494 Ga0070700_1002644942 153
99 3300005441 Ga0070700_101587213 Ga0070700_1015872131 153
100 3300005457 Ga0070662_100002010 Ga0070662_10000201017 153
101 3300005616 Ga0068852_100302732 Ga0068852_1003027323 153
102 3300005718 Ga0068866_10243783 Ga0068866_102437832 153
103 3300005719 Ga0068861_100091518 Ga0068861_1000915185 153
104 3300005842 Ga0068858_100831996 Ga0068858_1008319962 153
105 3300005844 Ga0068862_100391923 Ga0068862_1003919233 153
106 3300005981 Ga0081538_10009337 Ga0081538_100093378 153
107 3300005981 Ga0081538_10088382 Ga0081538_100883823 153
108 3300006844 Ga0075428_100385449 Ga0075428_1003854493 153
109 3300006846 Ga0075430_100029183 Ga0075430_1000291834 153
110 3300006846 Ga0075430_100370349 Ga0075430_1003703492 153
111 3300006846 Ga0075430_101099348 Ga0075430_1010993481 153
112 3300006847 Ga0075431_100323088 Ga0075431_1003230883 153
113 3300006852 Ga0075433_10020062 Ga0075433_100200624 153
114 3300009094 Ga0111539_10034630 Ga0111539_100346304 153
115 3300009094 Ga0111539_13280866 Ga0111539_132808661 153
116 3300009098 Ga0105245_10000728 Ga0105245_1000072825 153
117 3300009147 Ga0114129_11005216 Ga0114129_110052162 153
118 3300009176 Ga0105242_10473956 Ga0105242_104739562 153
119 3300009553 Ga0105249_10003343 Ga0105249_1000334311 153
120 3300010375 Ga0105239_10038799 Ga0105239_100387998 153
121 3300013306 Ga0163162_10013834 Ga0163162_1001383412 153
122 3300013307 Ga0157372_10236632 Ga0157372_102366323 153
123 3300025927 Ga0207687_10035559 Ga0207687_100355593 153
124 3300025932 Ga0207690_10183814 Ga0207690_101838142 153
125 3300025933 Ga0207706_10049986 Ga0207706_100499864 153
126 3300025937 Ga0207669_10431341 Ga0207669_104313412 153
127 3300025961 Ga0207712_10039946 Ga0207712_100399463 153
128 3300026067 Ga0207678_10508772 Ga0207678_105087723 153
129 3300026075 Ga0207708_10008883 Ga0207708_100088833 153
130 3300026075 Ga0207708_10923925 Ga0207708_109239252 153
131 3300026118 Ga0207675_100015701 Ga0207675_1000157015 153
132 3300026142 Ga0207698_10315380 Ga0207698_103153802 153
133 3300027907 Ga0207428_10017889 Ga0207428_100178894 153
134 3300027907 Ga0207428_10800140 Ga0207428_108001402 153
135 3300028380 Ga0268265_10326169 Ga0268265_103261693 153
136 3300031731 Ga0307405_10257319 Ga0307405_102573193 153
137 3300031731 Ga0307405_10601122 Ga0307405_106011221 153
138 3300031852 Ga0307410_10157117 Ga0307410_101571172 153
139 3300031852 Ga0307410_11005972 Ga0307410_110059722 153
140 3300031901 Ga0307406_10176049 Ga0307406_101760493 153
141 3300031901 Ga0307406_11320873 Ga0307406_113208731 153
142 3300031995 Ga0307409_100253556 Ga0307409_1002535563 153
143 3300031995 Ga0307409_100621793 Ga0307409_1006217932 153
144 3300032002 Ga0307416_100383771 Ga0307416_1003837712 153
145 3300032002 Ga0307416_101368984 Ga0307416_1013689842 153
146 3300032004 Ga0307414_11438994 Ga0307414_114389941 153
147 3300032126 Ga0307415_101420442 Ga0307415_1014204421 153
148 3300035085 Ga0373929_0075263 Ga0373929_0075263_313_774 153
149 3300035115 Ga0373941_0052879 Ga0373941_0052879_126_587 153
150 3300035242 Ga0373962_0227498 Ga0373962_0227498_10_471 153
151 3300035691 Ga0373931_0044296 Ga0373931_0044296_1829_2290 153
152 3300037418 Ga0395900_0402966 Ga0395900_0402966_271_732 153
153 3300037466 Ga0395898_1189835 Ga0395898_1189835_24_485 153
154 3300041458 Ga0451798_0180539 Ga0451798_0180539_80_541 153
155 3300046491 Ga0495584_0596469 Ga0495584_0596469_53_514 153
156 3300046515 Ga0495620_0169537 Ga0495620_0169537_99_560 153
157 3300046518 Ga0495631_0167767 Ga0495631_0167767_159_620 153
158 3300046523 Ga0495644_0108071 Ga0495644_0108071_482_943 153
159 3300046665 Ga0495661_0349192 Ga0495661_0349192_85_546 153
160 3300046684 Ga0495669_0361728 Ga0495669_0361728_128_589 153
161 3300047320 Ga0495672_0055774 Ga0495672_0055774_675_1136 153
162 3300047445 Ga0495677_0135280 Ga0495677_0135280_291_752 153
163 3300049568 Ga0501031_0132120 Ga0501031_0132120_1018_1479 153
164 3300049572 Ga0501036_0116666 Ga0501036_0116666_1255_1716 153
165 3300049572 Ga0501036_1558524 Ga0501036_1558524_37_498 153
166 3300049576 Ga0501040_0125568 Ga0501040_0125568_936_1397 153
167 3300049577 Ga0501041_0073575 Ga0501041_0073575_1180_1641 153
168 3300049580 Ga0501046_0064879 Ga0501046_0064879_106_567 153
169 3300049582 Ga0501048_0722766 Ga0501048_0722766_205_666 153
170 3300049583 Ga0501067_0384473 Ga0501067_0384473_73_534 153
171 3300049584 Ga0501068_0271036 Ga0501068_0271036_133_594 153
172 3300049585 Ga0501069_0636582 Ga0501069_0636582_81_542 153
173 3300049587 Ga0501071_0247828 Ga0501071_0247828_54_515 153
174 3300049591 Ga0501075_0120356 Ga0501075_0120356_1323_1784 153
175 3300049591 Ga0501075_0214167 Ga0501075_0214167_551_1012 153
176 3300049593 Ga0501077_0137747 Ga0501077_0137747_956_1417 153
177 3300049741 Ga0501079_1186719 Ga0501079_1186719_105_566 153
178 3300049742 Ga0501080_0433941 Ga0501080_0433941_205_666 153
179 3300049757 Ga0501232_065953 Ga0501232_065953_61_522 153
180 3300049824 Ga0501045_0132484 Ga0501045_0132484_960_1421 153
181 3300050507 nmdc:mga05p37_136592_c1 nmdc:mga05p37_136592_c1_1833_2294 153
182 3300050507 nmdc:mga05p37_406850_c1 nmdc:mga05p37_406850_c1_615_1076 153
183 3300050508 nmdc:mga09592_1174279_c1 nmdc:mga09592_1174279_c1_61_522 153
184 3300050508 nmdc:mga09592_53880_c1 nmdc:mga09592_53880_c1_788_1249 153
185 3300050509 nmdc:mga0qj67_102915_c1 nmdc:mga0qj67_102915_c1_797_1258 153
186 3300050509 nmdc:mga0qj67_209024_c1 nmdc:mga0qj67_209024_c1_822_1283 153
187 3300050509 nmdc:mga0qj67_432293_c1 nmdc:mga0qj67_432293_c1_558_1019 153
188 3300050510 nmdc:mga06r32_1544068_c1 nmdc:mga06r32_1544068_c1_120_581 153
189 3300050510 nmdc:mga06r32_1891436_c1 nmdc:mga06r32_1891436_c1_37_498 153
190 3300050510 nmdc:mga06r32_62988_c1 nmdc:mga06r32_62988_c1_2496_2957 153
191 3300050511 nmdc:mga08y16_27344_c1 nmdc:mga08y16_27344_c1_561_1022 153
192 3300050515 nmdc:mga0a205_110310_c1 nmdc:mga0a205_110310_c1_829_1290 153
193 3300060353 Ga0501082_0310688 Ga0501082_0310688_492_953 153
194 3300061734 Ga0530510_0137760 Ga0530510_0137760_756_1217 153
195 3300061734 Ga0530510_0719585 Ga0530510_0719585_202_663 153
196 3300005329 Ga0070683_101105118 Ga0070683_1011051181 154
197 3300013104 Ga0157370_10028047 Ga0157370_100280475 154
198 3300014969 Ga0157376_10038470 Ga0157376_100384704 154
199 3300031889 Ga0326468_10029899 Ga0326468_100298991 154
200 3300013102 Ga0157371_11401070 Ga0157371_114010701 155
201 3300002459 JGI24751J29686_10024455 JGI24751J29686_100244551 156
202 3300005435 Ga0070714_100096418 Ga0070714_1000964183 156
203 3300005548 Ga0070665_100811679 Ga0070665_1008116792 156
204 3300025929 Ga0207664_10022140 Ga0207664_100221405 156
205 3300025944 Ga0207661_11492752 Ga0207661_114927522 156

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00578

AhpC-TSA

AhpC/TSA family

6

131

0.99

PF08534

Redoxin

Redoxin

5

146

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
5c04-assembly1.cif.gz_B crystal structure of the f37h mutant ahpe from mycobacterium tuberculosis 0.9615 1 150
4xih-assembly1.cif.gz_B-2 crystal structure of the r116a mutant ahpe from mycobacterium tuberculosis 0.9576 1 150
5id2-assembly1.cif.gz_B asymmetry in the active site of mycobacterium tuberculosis ahpe upon exposure to mycothiol 0.9571 1 150
1xvw-assembly1.cif.gz_B crystal structure of ahpe from mycobacterium tuberculosis, a 1-cys peroxiredoxin 0.9521 2 152
5c04-assembly1.cif.gz_B crystal structure of the f37h mutant ahpe from mycobacterium tuberculosis 0.9372 1 150
ID Description Score Start End Superfamily
5id2B00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9571 1 150 3.40.30.10
3drnB00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9282 3 155 3.40.30.10
af_Q559T9_1_157_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9251 3 153 3.40.30.10
af_I1MS47_66_213_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.923 3 150 3.40.30.10
3drnB00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9223 3 155 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A1G5NQ05-F1-model_v4 deleted 0.9994 33 152
AF-A0A2V7MEF8-F1-model_v4 thioredoxin-dependent peroxiredoxin (EC 1.11.1.24) (Thioredoxin peroxidase) 0.9991 14 153 GO:0005737
GO:0008379
GO:0034599
GO:0045454
AF-A0A090E3V1-F1-model_v4 Putative peroxyredoxin (EC 1.11.1.15) 0.9989 1 150 GO:0004601
AF-A0A1Q7MPG3-F1-model_v4 Peroxiredoxin 0.9985 1 123 GO:0016209
GO:0016491
AF-A0A4Q0SXK5-F1-model_v4 Alkyl hydroperoxide reductase subunit C-like protein 0.9984 1 149 GO:0016209
GO:0016491

Feature Viewer

pLDDT pTM Quality
94.64 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map