F312769

General Info

Members Datasets Scaffolds Average Seq Length
204 154 408 183

Family's Representative Sequence

Representative Sequence 3300036712|Ga0316584_0007409|Ga0316584_0007409_4398_5048
Length 216
Sequence VRAVWQHNASSTMLAPPEITNRRQHEGAGTMDVRATAIPEVRILRPKRFGDGRGFFSEVYNRRAFADVGIELDFVQDNQSWSALAGTLRGMHFQKPPAAQAKLVRVLRGRILDVVVDCRHGSPSHGRHVMVELDAERGEQIFCPHGFAHGFLTLEPDTEVLYKVDAHYAPDLDGGIRWDDSELAIPWPLPVGELILSDRDRTLPRFSELPVIFTYP

Samples

Sample ID Description Type Environment
1 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
7 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
8 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
11 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
15 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
16 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
17 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
18 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
21 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
22 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
23 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
24 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
25 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
26 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
27 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
28 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
29 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
30 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
31 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
32 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
33 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
34 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
35 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
37 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
39 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
40 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
41 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
42 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
43 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
44 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
45 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
46 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
47 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
48 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
72 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
73 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
74 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
75 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
76 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
77 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
78 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
79 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
80 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
81 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
82 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
83 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
84 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
85 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
86 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
87 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
88 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
89 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
90 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
91 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
92 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
93 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
94 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
95 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
96 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
97 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
98 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
99 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
100 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
101 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
102 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
103 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
104 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
105 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
106 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
107 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
108 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
109 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
110 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
111 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
112 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
113 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
114 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
115 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
116 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
117 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
118 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
119 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
120 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
121 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
122 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
123 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
124 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
125 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
126 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
127 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
128 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
129 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
130 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
131 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
132 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
133 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
134 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
135 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
136 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
137 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
138 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
139 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
140 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
141 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
142 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
143 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
144 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
145 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
146 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
147 2513237087 Azorhizobium doebereinerae UFLA1-100 Isolate Nodule
148 2671180139 Chelativorans sp. A52C2 Isolate Unclassified
149 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
150 2828305725 Xanthobacter tagetidis DSM 11105 Isolate Unclassified
151 2883577096 Roseococcus sp. SYP-B2431 Isolate Rhizosphere
152 2889306138 Methylobacterium sp. PvR107 Isolate Rhizosphere
153 2894772417 Roseomonas oryzicola KCTC 22478 Isolate Rhizosphere
154 2896384573 Ensifer sp. MPMI2T Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.08
Metatranscriptomes 0
Isolates 3.92

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.94
Nodule 0.98
Rhizoplane 0.98
Rhizosphere 93.63
Stem 0
Stem Tuber 0
Unclassified 2.94

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0316584_0007409 3300036712 Bacteria 7500
2 JGI25407J50210_10007387 3300003373 Bacteria 2752
3 JGI25407J50210_10008601 3300003373 Bacteria 2575
4 Ga0070683_101149452 3300005329 Bacteria 746
5 Ga0070670_100199238 3300005331 Bacteria 1739
6 Ga0070666_10006085 3300005335 Bacteria 7416
7 Ga0070661_100907489 3300005344 Bacteria 727
8 Ga0070669_100422505 3300005353 Bacteria 1094
9 Ga0070675_100068265 3300005354 Bacteria 2944
10 Ga0070675_100204623 3300005354 Bacteria 1714
11 Ga0070671_100143088 3300005355 Bacteria 2018
12 Ga0070673_100025434 3300005364 Bacteria 4357
13 Ga0070688_100000899 3300005365 Bacteria 14826
14 Ga0070667_100337295 3300005367 Bacteria 1363
15 Ga0070667_100828562 3300005367 Bacteria 860
16 Ga0070713_100791783 3300005436 Bacteria 909
17 Ga0070678_100053606 3300005456 Bacteria 2934
18 Ga0070685_10268952 3300005466 Bacteria 1137
19 Ga0070706_100239817 3300005467 Bacteria 1693
20 Ga0070698_100000002 3300005471 Bacteria 139184
21 Ga0070699_100357787 3300005518 Bacteria 1316
22 Ga0070679_100005565 3300005530 Bacteria 11677
23 Ga0070697_100271433 3300005536 Bacteria 1454
24 Ga0070665_100480292 3300005548 Bacteria 1253
25 Ga0070665_100665025 3300005548 Bacteria 1055
26 Ga0070664_100008988 3300005564 Bacteria 8102
27 Ga0070664_100869809 3300005564 Bacteria 844
28 Ga0068859_100034861 3300005617 Bacteria 5049
29 Ga0068864_100421762 3300005618 Bacteria 1271
30 Ga0068864_100603563 3300005618 Bacteria 1065
31 Ga0068851_10293175 3300005834 Bacteria 933
32 Ga0068863_100037794 3300005841 Bacteria 4594
33 Ga0068858_100039984 3300005842 Bacteria 4349
34 Ga0081538_10000244 3300005981 Bacteria 61457
35 Ga0081538_10000783 3300005981 Bacteria 34707
36 Ga0081539_10003969 3300005985 Bacteria 17115
37 Ga0075364_10151686 3300006051 Bacteria 1562
38 Ga0075364_10341668 3300006051 Bacteria 1020
39 Ga0070716_100410985 3300006173 Bacteria 976
40 Ga0068871_100109673 3300006358 Bacteria 2320
41 Ga0075428_100320119 3300006844 Bacteria 1667
42 Ga0075431_100319846 3300006847 Bacteria 1565
43 Ga0075431_100519021 3300006847 Bacteria 1181
44 Ga0097620_100034866 3300006931 Bacteria 5049
45 Ga0105240_10001003 3300009093 Bacteria 50390
46 Ga0114129_10057331 3300009147 Bacteria 5452
47 Ga0114129_10070367 3300009147 Bacteria 4878
48 Ga0105248_10041897 3300009177 Bacteria 5134
49 Ga0105248_10478610 3300009177 Bacteria 1403
50 Ga0105239_10049661 3300010375 Bacteria 4600
51 Ga0157374_10052838 3300013296 Bacteria 3786
52 Ga0157378_10136680 3300013297 Bacteria 2273
53 Ga0163162_10964184 3300013306 Bacteria 963
54 Ga0157375_10054077 3300013308 Bacteria 3953
55 Ga0157375_10540517 3300013308 Bacteria 1327
56 Ga0163163_10050903 3300014325 Bacteria 4081
57 Ga0163163_11466884 3300014325 Unclassified 744
58 Ga0157379_10307339 3300014968 Bacteria 1446
59 Ga0157376_11119924 3300014969 Bacteria 813
60 Ga0213872_10002520 3300021361 Bacteria 10677
61 Ga0207643_10348363 3300025908 Bacteria 929
62 Ga0207705_10121682 3300025909 Bacteria 1937
63 Ga0207705_10203086 3300025909 Bacteria 1502
64 Ga0207707_10528282 3300025912 Unclassified 1004
65 Ga0207695_10003329 3300025913 Bacteria 22777
66 Ga0207693_10149030 3300025915 Bacteria 1840
67 Ga0207660_10029659 3300025917 Bacteria 3755
68 Ga0207657_10036385 3300025919 Bacteria 4406
69 Ga0207649_10056606 3300025920 Bacteria 2449
70 Ga0207652_10112640 3300025921 Bacteria 2414
71 Ga0207650_10007065 3300025925 Bacteria 7653
72 Ga0207659_10272550 3300025926 Bacteria 1381
73 Ga0207659_10305447 3300025926 Bacteria 1308
74 Ga0207644_10081909 3300025931 Bacteria 2386
75 Ga0207711_10021932 3300025941 Bacteria 5335
76 Ga0207679_10584052 3300025945 Bacteria 1005
77 Ga0207679_10988330 3300025945 Bacteria 771
78 Ga0207651_10024407 3300025960 Bacteria 3740
79 Ga0207668_10651644 3300025972 Bacteria 922
80 Ga0207658_10441048 3300025986 Bacteria 1151
81 Ga0207658_10480193 3300025986 Bacteria 1104
82 Ga0207677_11074968 3300026023 Bacteria 732
83 Ga0207703_10089822 3300026035 Bacteria 2581
84 Ga0207641_10022454 3300026088 Bacteria 5194
85 Ga0207648_10393962 3300026089 Unclassified 1254
86 Ga0207676_10032454 3300026095 Bacteria 3935
87 Ga0207676_10661879 3300026095 Bacteria 1009
88 Ga0207683_10002971 3300026121 Bacteria 14792
89 Ga0265318_10000031 3300028577 Bacteria 146035
90 Ga0265340_10001710 3300031247 Bacteria 12588
91 Ga0265340_10086521 3300031247 Bacteria 1470
92 Ga0265339_10014447 3300031249 Bacteria 4756
93 Ga0265316_10074203 3300031344 Bacteria 2618
94 Ga0265313_10000847 3300031595 Bacteria 30816
95 Ga0265313_10017796 3300031595 Bacteria 4019
96 Ga0265314_10261509 3300031711 Bacteria 988
97 Ga0265342_10011544 3300031712 Bacteria 6037
98 Ga0316576_10068846 3300031727 Bacteria 2609
99 Ga0316578_10033760 3300031728 Bacteria 2934
100 Ga0307410_10100520 3300031852 Bacteria 2072
101 Ga0307412_10643010 3300031911 Bacteria 904
102 Ga0307409_100060691 3300031995 Bacteria 2950
103 Ga0307416_100006262 3300032002 Bacteria 7432
104 Ga0307414_11527226 3300032004 Bacteria 622
105 Ga0307415_100000108 3300032126 Bacteria 35307
106 Ga0373940_0181808 3300035088 Bacteria 684
107 Ga0373931_0250261 3300035691 Bacteria 1077
108 Ga0395905_0010178 3300037471 Bacteria 9165
109 Ga0395901_1126064 3300038443 Bacteria 754
110 Ga0436361_0013090 3300039447 Bacteria 976
111 Ga0436361_0027182 3300039447 Bacteria 2394
112 Ga0436361_0594293 3300039447 Bacteria 13903
113 Ga0436361_1104035 3300039447 Bacteria 3323
114 Ga0439450_086658 3300042008 Bacteria 783
115 Ga0439463_029804 3300042016 Bacteria 1375
116 Ga0451577_0230149 3300042876 Bacteria 1676
117 Ga0451577_0562471 3300042876 Bacteria 1035
118 Ga0453683_0053720 3300044673 Bacteria 2521
119 Ga0466965_0355597 3300044683 Bacteria 803
120 Ga0453684_0108609 3300044712 Bacteria 3376
121 Ga0453684_0110683 3300044712 Bacteria 3337
122 Ga0466970_0081009 3300044765 Bacteria 1755
123 Ga0466970_0281239 3300044765 Bacteria 936
124 Ga0451576_0053793 3300045051 Bacteria 4216
125 Ga0451576_0236319 3300045051 Bacteria 1909
126 Ga0495654_0021912 3300046530 Bacteria 3322
127 Ga0495668_0173807 3300046616 Bacteria 1180
128 Ga0495669_0000014 3300046684 Bacteria 140832
129 Ga0495589_0291800 3300046794 Bacteria 757
130 Ga0495677_0009259 3300047445 Bacteria 3639
131 Ga0496109_0823845 3300048912 Bacteria 866
132 Ga0496112_0534212 3300048915 Bacteria 1107
133 Ga0501031_0002603 3300049568 Bacteria 11490
134 Ga0501032_0024269 3300049569 Bacteria 4188
135 Ga0501033_0005927 3300049570 Bacteria 9593
136 Ga0501033_0332460 3300049570 Bacteria 1066
137 Ga0501034_0566463 3300049571 Bacteria 1044
138 Ga0501034_0844478 3300049571 Unclassified 806
139 Ga0501036_0006465 3300049572 Bacteria 9521
140 Ga0501037_0009848 3300049573 Bacteria 7015
141 Ga0501037_0145272 3300049573 Bacteria 1697
142 Ga0501038_0013425 3300049574 Bacteria 7466
143 Ga0501038_0107465 3300049574 Bacteria 2315
144 Ga0501038_0285622 3300049574 Bacteria 1298
145 Ga0501039_0000676 3300049575 Bacteria 24615
146 Ga0501040_0001477 3300049576 Bacteria 14918
147 Ga0501041_0000229 3300049577 Bacteria 26123
148 Ga0501042_0000814 3300049578 Bacteria 17228
149 Ga0501043_0014454 3300049579 Bacteria 6179
150 Ga0501043_0255278 3300049579 Bacteria 1350
151 Ga0501046_0000525 3300049580 Bacteria 38015
152 Ga0501047_0079013 3300049581 Bacteria 3164
153 Ga0501047_0138305 3300049581 Bacteria 2315
154 Ga0501048_0002770 3300049582 Bacteria 13375
155 Ga0501067_0018380 3300049583 Bacteria 3873
156 Ga0501067_0162214 3300049583 Bacteria 1245
157 Ga0501068_0015517 3300049584 Bacteria 4376
158 Ga0501069_0027297 3300049585 Bacteria 3129
159 Ga0501070_0035552 3300049586 Bacteria 4163
160 Ga0501071_0001060 3300049587 Bacteria 15229
161 Ga0501073_0015424 3300049589 Bacteria 5542
162 Ga0501073_0034805 3300049589 Bacteria 3582
163 Ga0501073_0095361 3300049589 Bacteria 2066
164 Ga0501073_0941523 3300049589 Unclassified 595
165 Ga0501074_0004833 3300049590 Bacteria 9655
166 Ga0501075_0002038 3300049591 Bacteria 13369
167 Ga0501076_0008372 3300049592 Bacteria 7579
168 Ga0501076_0142938 3300049592 Bacteria 1945
169 Ga0501077_0006704 3300049593 Bacteria 7082
170 Ga0501077_0430268 3300049593 Bacteria 845
171 Ga0501079_0002470 3300049741 Bacteria 13423
172 Ga0501079_0303734 3300049741 Bacteria 1249
173 Ga0501080_0043220 3300049742 Bacteria 4196
174 Ga0501080_0064842 3300049742 Bacteria 3398
175 Ga0501080_1042736 3300049742 Unclassified 708
176 Ga0501081_0001722 3300049743 Bacteria 13581
177 Ga0501083_0000809 3300049744 Bacteria 20519
178 Ga0501035_0120833 3300049822 Bacteria 2290
179 Ga0501035_0168705 3300049822 Bacteria 1892
180 Ga0501035_0451026 3300049822 Bacteria 1064
181 Ga0501044_0041527 3300049823 Bacteria 4789
182 Ga0501045_0001055 3300049824 Bacteria 18154
183 nmdc:mga00v17_295957_c1 3300050491 Bacteria 1051
184 nmdc:mga00v17_496080_c1 3300050491 Bacteria 792
185 nmdc:mga05p37_17692_c1 3300050507 Bacteria 8599
186 nmdc:mga06r32_702386_c1 3300050510 Bacteria 977
187 Ga0495619_0295644 3300053085 Bacteria 1122
188 Ga0500616_0094373 3300053153 Bacteria 1474
189 Ga0500627_0004584 3300053158 Bacteria 4465
190 Ga0501084_0006984 3300054114 Bacteria 9303
191 Ga0501084_0125878 3300054114 Bacteria 2156
192 Ga0501084_0341308 3300054114 Bacteria 1265
193 Ga0501082_0000751 3300060353 Bacteria 28467
194 Ga0501082_0012135 3300060353 Bacteria 7402
195 Ga0530510_0003857 3300061734 Bacteria 10333
196 Ga0530510_0473619 3300061734 Bacteria 948
197 2513589243 2513237087 Bacteria 5817514
198 2671692813 2671180139 Bacteria 4196045
199 2802748806 2802428863 Bacteria 6410669
200 2828305949 2828305725 Bacteria 4916900
201 2883577398 2883577096 Bacteria 4709178
202 2889311344 2889306138 Bacteria 6358934
203 2894773513 2894772417 Bacteria 5305674
204 2896386279 2896384573 Bacteria 7700774
205 Ga0316584_0007409
206 JGI25407J50210_10007387
207 JGI25407J50210_10008601
208 Ga0070683_101149452
209 Ga0070670_100199238
210 Ga0070666_10006085
211 Ga0070661_100907489
212 Ga0070669_100422505
213 Ga0070675_100068265
214 Ga0070675_100204623
215 Ga0070671_100143088
216 Ga0070673_100025434
217 Ga0070688_100000899
218 Ga0070667_100337295
219 Ga0070667_100828562
220 Ga0070713_100791783
221 Ga0070678_100053606
222 Ga0070685_10268952
223 Ga0070706_100239817
224 Ga0070698_100000002
225 Ga0070699_100357787
226 Ga0070679_100005565
227 Ga0070697_100271433
228 Ga0070665_100480292
229 Ga0070665_100665025
230 Ga0070664_100008988
231 Ga0070664_100869809
232 Ga0068859_100034861
233 Ga0068864_100421762
234 Ga0068864_100603563
235 Ga0068851_10293175
236 Ga0068863_100037794
237 Ga0068858_100039984
238 Ga0081538_10000244
239 Ga0081538_10000783
240 Ga0081539_10003969
241 Ga0075364_10151686
242 Ga0075364_10341668
243 Ga0070716_100410985
244 Ga0068871_100109673
245 Ga0075428_100320119
246 Ga0075431_100319846
247 Ga0075431_100519021
248 Ga0097620_100034866
249 Ga0105240_10001003
250 Ga0114129_10057331
251 Ga0114129_10070367
252 Ga0105248_10041897
253 Ga0105248_10478610
254 Ga0105239_10049661
255 Ga0157374_10052838
256 Ga0157378_10136680
257 Ga0163162_10964184
258 Ga0157375_10054077
259 Ga0157375_10540517
260 Ga0163163_10050903
261 Ga0163163_11466884
262 Ga0157379_10307339
263 Ga0157376_11119924
264 Ga0213872_10002520
265 Ga0207643_10348363
266 Ga0207705_10121682
267 Ga0207705_10203086
268 Ga0207707_10528282
269 Ga0207695_10003329
270 Ga0207693_10149030
271 Ga0207660_10029659
272 Ga0207657_10036385
273 Ga0207649_10056606
274 Ga0207652_10112640
275 Ga0207650_10007065
276 Ga0207659_10272550
277 Ga0207659_10305447
278 Ga0207644_10081909
279 Ga0207711_10021932
280 Ga0207679_10584052
281 Ga0207679_10988330
282 Ga0207651_10024407
283 Ga0207668_10651644
284 Ga0207658_10441048
285 Ga0207658_10480193
286 Ga0207677_11074968
287 Ga0207703_10089822
288 Ga0207641_10022454
289 Ga0207648_10393962
290 Ga0207676_10032454
291 Ga0207676_10661879
292 Ga0207683_10002971
293 Ga0265318_10000031
294 Ga0265340_10001710
295 Ga0265340_10086521
296 Ga0265339_10014447
297 Ga0265316_10074203
298 Ga0265313_10000847
299 Ga0265313_10017796
300 Ga0265314_10261509
301 Ga0265342_10011544
302 Ga0316576_10068846
303 Ga0316578_10033760
304 Ga0307410_10100520
305 Ga0307412_10643010
306 Ga0307409_100060691
307 Ga0307416_100006262
308 Ga0307414_11527226
309 Ga0307415_100000108
310 Ga0373940_0181808
311 Ga0373931_0250261
312 Ga0395905_0010178
313 Ga0395901_1126064
314 Ga0436361_0013090
315 Ga0436361_0027182
316 Ga0436361_0594293
317 Ga0436361_1104035
318 Ga0439450_086658
319 Ga0439463_029804
320 Ga0451577_0230149
321 Ga0451577_0562471
322 Ga0453683_0053720
323 Ga0466965_0355597
324 Ga0453684_0108609
325 Ga0453684_0110683
326 Ga0466970_0081009
327 Ga0466970_0281239
328 Ga0451576_0053793
329 Ga0451576_0236319
330 Ga0495654_0021912
331 Ga0495668_0173807
332 Ga0495669_0000014
333 Ga0495589_0291800
334 Ga0495677_0009259
335 Ga0496109_0823845
336 Ga0496112_0534212
337 Ga0501031_0002603
338 Ga0501032_0024269
339 Ga0501033_0005927
340 Ga0501033_0332460
341 Ga0501034_0566463
342 Ga0501034_0844478
343 Ga0501036_0006465
344 Ga0501037_0009848
345 Ga0501037_0145272
346 Ga0501038_0013425
347 Ga0501038_0107465
348 Ga0501038_0285622
349 Ga0501039_0000676
350 Ga0501040_0001477
351 Ga0501041_0000229
352 Ga0501042_0000814
353 Ga0501043_0014454
354 Ga0501043_0255278
355 Ga0501046_0000525
356 Ga0501047_0079013
357 Ga0501047_0138305
358 Ga0501048_0002770
359 Ga0501067_0018380
360 Ga0501067_0162214
361 Ga0501068_0015517
362 Ga0501069_0027297
363 Ga0501070_0035552
364 Ga0501071_0001060
365 Ga0501073_0015424
366 Ga0501073_0034805
367 Ga0501073_0095361
368 Ga0501073_0941523
369 Ga0501074_0004833
370 Ga0501075_0002038
371 Ga0501076_0008372
372 Ga0501076_0142938
373 Ga0501077_0006704
374 Ga0501077_0430268
375 Ga0501079_0002470
376 Ga0501079_0303734
377 Ga0501080_0043220
378 Ga0501080_0064842
379 Ga0501080_1042736
380 Ga0501081_0001722
381 Ga0501083_0000809
382 Ga0501035_0120833
383 Ga0501035_0168705
384 Ga0501035_0451026
385 Ga0501044_0041527
386 Ga0501045_0001055
387 nmdc:mga00v17_295957_c1
388 nmdc:mga00v17_496080_c1
389 nmdc:mga05p37_17692_c1
390 nmdc:mga06r32_702386_c1
391 Ga0495619_0295644
392 Ga0500616_0094373
393 Ga0500627_0004584
394 Ga0501084_0006984
395 Ga0501084_0125878
396 Ga0501084_0341308
397 Ga0501082_0000751
398 Ga0501082_0012135
399 Ga0530510_0003857
400 Ga0530510_0473619
401 2513589243
402 2671692813
403 2802748806
404 2828305949
405 2883577398
406 2889311344
407 2894773513
408 2896386279

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00908

dTDP_sugar_isom

dTDP-4-dehydrorhamnose 3,5-epimerase

35

208

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
6c46-assembly3.cif.gz_E-2 crystal structure of dtdp-4-dehydrorhamnose 3,5-epimerase from elizabethkingia anophelis nuhp1 0.9745 2 173
6c46-assembly2.cif.gz_C crystal structure of dtdp-4-dehydrorhamnose 3,5-epimerase from elizabethkingia anophelis nuhp1 0.9622 2 173
7pvi-assembly1.cif.gz_BBB dtdp-sugar epimerase 0.9584 2 174
3ryk-assembly1.cif.gz_B 1.63 angstrom resolution crystal structure of dtdp-4-dehydrorhamnose 3,5-epimerase (rfbc) from bacillus anthracis str. ames with tdp and ppi bound 0.9496 2 174
1upi-assembly1.cif.gz_A mycobacterium tuberculosis rmlc epimerase (rv3465) 0.9487 1 173
ID Description Score Start End Superfamily
1epzA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9459 2 173 2.60.120.10
2ixcB00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9442 1 173 2.60.120.10
5buvB00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9407 2 174 2.60.120.10
2c0zA01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9368 1 173 2.60.120.10
2b9uD00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9286 2 173 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A536SWI1-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (Thymidine diphospho-4-keto-rhamnose 3,5-epimerase) 0.9975 1 173 GO:0005829
GO:0008830
GO:0019305
GO:0045226
AF-A0A1Q6VP32-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase 0.9938 1 145 GO:0005829
GO:0008830
GO:0019305
GO:0045226
AF-A0A383T4G5-F1-model_v4 deleted 0.9936 45 175
AF-W4SGX0-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (Thymidine diphospho-4-keto-rhamnose 3,5-epimerase) (dTDP-4-keto-6-deoxyglucose 3,5-epimerase) (dTDP-6-deoxy-D-xylo-4-hexulose 3,5-epimerase) 0.9935 45 175 GO:0005829
GO:0008830
GO:0019305
GO:0045226
AF-A0A831U845-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (Thymidine diphospho-4-keto-rhamnose 3,5-epimerase) 0.9924 48 173 GO:0000271
GO:0005829
GO:0008830
GO:0019305

Map