F312549

General Info

Members Datasets Scaffolds Average Seq Length
204 133 201 126

Family's Representative Sequence

Representative Sequence 3300013306|Ga0163162_11705154|Ga0163162_117051542
Length 151
Sequence LFNHRHGVKFVKKNTFALNLKNHPMKKIIRTANAPAPIGPYSQAILVNQTLYVSGQIAIDPASGQLITINIIKETNQVMHNLMNILQEAEMDFSNVVKTTIFLTDMNNFSAVNEVYGSYFKNDFPARETVQVSRLPKDVNVEIAVVAVKNK

Samples

Sample ID Description Type Environment
1 2522125168 Dyadobacter beijingensis DSM 21582 Isolate Rhizosphere
2 2839989709 Pontibacter arcticus 2b14 Isolate Unclassified
3 2884634485 Algoriphagus kandeliae XY-J91 Isolate Unclassified
4 2919692658 Algoriphagus sp. 4150 Isolate Rhizosphere
5 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
6 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
9 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
10 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
11 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
12 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
20 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
21 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
22 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
23 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
24 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
25 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
26 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
27 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
28 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
29 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
30 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
31 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
32 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
33 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
34 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
35 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
36 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
37 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
38 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
39 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
40 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
41 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
42 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
43 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
44 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
45 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
46 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
47 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
48 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
49 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
50 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
51 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
52 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
53 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
54 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
65 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
66 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
67 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
68 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
69 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
70 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
71 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
72 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
73 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
74 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
75 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
76 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
77 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
78 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
79 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
80 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
81 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
82 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
83 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
84 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
85 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
86 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
87 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
88 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
89 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
90 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
91 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
92 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
93 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
94 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
95 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
96 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
97 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
98 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
99 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
100 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
101 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
102 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
103 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
104 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
105 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
106 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
107 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
108 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
109 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
110 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
111 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
112 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
113 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
114 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
115 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
116 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
117 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
118 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
119 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
120 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
121 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
122 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
123 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
124 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
125 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
126 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
127 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
128 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
129 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
130 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
131 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
132 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
133 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.04
Metatranscriptomes 0
Isolates 1.96

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.76
Nodule 0
Rhizoplane 1.96
Rhizosphere 70.1
Stem 0
Stem Tuber 0
Unclassified 16.18

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10002543 3300003316 Bacteria 1958
2 rootH1_10021846 3300003316 Bacteria 13505
3 rootH1_10021846 3300003323 Bacteria 2044
4 rootH2_10028760 3300003320 Bacteria 16971
5 rootH2_10052047 3300003320 Bacteria 2977
6 rootH2_10065075 3300003320 Bacteria 1128
7 rootH2_10128254 3300003320 Bacteria 5956
8 rootL2_10027139 3300003322 Bacteria 16580
9 rootL2_10157166 3300003322 Bacteria 6322
10 rootH1_10000951 3300003323 Bacteria 22236
11 rootH1_10004273 3300003323 Bacteria 31639
12 rootH1_10007412 3300003323 Bacteria 54111
13 rootH1_10012210 3300003323 Bacteria 61025
14 rootH1_10034555 3300003323 Bacteria 2723
15 rootH1_10039450 3300003323 Bacteria 3064
16 rootH1_10173044 3300003323 Bacteria 3068
17 rootH1_10185970 3300003323 Bacteria 1772
18 rootH1_10227919 3300003323 Bacteria 1181
19 Ga0055536_1023271 3300003781 Bacteria 1826
20 Ga0055530_10016423 3300003791 Bacteria 2365
21 Ga0065165_1000639 3300005262 Bacteria 50701
22 Ga0065165_1064016 3300005262 Bacteria 997
23 Ga0065714_10098887 3300005288 Bacteria 1688
24 Ga0065704_10124524 3300005289 Bacteria 1716
25 Ga0065704_10130559 3300005289 Bacteria 1635
26 Ga0070682_100207214 3300005337 Bacteria 1387
27 Ga0070682_101092051 3300005337 Bacteria 667
28 Ga0070689_100820756 3300005340 Bacteria 819
29 Ga0070659_100022811 3300005366 Bacteria 4782
30 Ga0070714_100381320 3300005435 Bacteria 1329
31 Ga0070713_100147993 3300005436 Bacteria 2086
32 Ga0070685_10006998 3300005466 Bacteria 5756
33 Ga0068857_101144318 3300005577 Unclassified 752
34 Ga0068857_102110916 3300005577 Bacteria 553
35 Ga0068854_102037068 3300005578 Bacteria 529
36 Ga0068856_100222418 3300005614 Bacteria 1903
37 Ga0068856_101294331 3300005614 Unclassified 744
38 Ga0068859_101944954 3300005617 Bacteria 649
39 Ga0068859_103175822 3300005617 Bacteria 500
40 Ga0068863_101046532 3300005841 Bacteria 820
41 Ga0068860_100178397 3300005843 Bacteria 2053
42 Ga0068862_100587926 3300005844 Bacteria 1067
43 Ga0070716_100032592 3300006173 Unclassified 2843
44 Ga0075370_10552892 3300006353 Bacteria 696
45 Ga0075428_100029255 3300006844 Bacteria 6096
46 Ga0075430_100444578 3300006846 Bacteria 1070
47 Ga0075434_101453077 3300006871 Bacteria 695
48 Ga0097620_101944646 3300006931 Bacteria 649
49 Ga0097620_103174762 3300006931 Bacteria 500
50 Ga0111539_10004881 3300009094 Bacteria 17464
51 Ga0111539_10024335 3300009094 Bacteria 7432
52 Ga0105245_11229737 3300009098 Bacteria 797
53 Ga0105242_11379059 3300009176 Bacteria 731
54 Ga0105237_10379384 3300009545 Unclassified 1418
55 Ga0105237_10813427 3300009545 Bacteria 941
56 Ga0157373_10142599 3300013100 Bacteria 1685
57 Ga0157371_10180764 3300013102 Bacteria 1509
58 Ga0157371_10576155 3300013102 Bacteria 836
59 Ga0157370_10001396 3300013104 Bacteria 29939
60 Ga0157370_10084354 3300013104 Bacteria 2986
61 Ga0157370_10103174 3300013104 Bacteria 2670
62 Ga0157370_10211617 3300013104 Bacteria 1797
63 Ga0157370_10482896 3300013104 Bacteria 1138
64 Ga0157370_10524125 3300013104 Bacteria 1087
65 Ga0157369_11093485 3300013105 Bacteria 815
66 Ga0157369_11534502 3300013105 Unclassified 677
67 Ga0157378_10063155 3300013297 Bacteria 3309
68 Ga0157378_12610443 3300013297 Unclassified 557
69 Ga0163162_11705154 3300013306 Unclassified 720
70 Ga0157372_10044073 3300013307 Bacteria 4943
71 Ga0157372_10773822 3300013307 Bacteria 1116
72 Ga0157375_12161717 3300013308 Bacteria 663
73 Ga0163163_10157819 3300014325 Bacteria 2313
74 Ga0163163_12256310 3300014325 Unclassified 603
75 Ga0157380_10000466 3300014326 Bacteria 24697
76 Ga0157380_10006725 3300014326 Bacteria 8124
77 Ga0157380_10285374 3300014326 Bacteria 1513
78 Ga0157380_10482648 3300014326 Bacteria 1199
79 Ga0157380_11605412 3300014326 Bacteria 706
80 Ga0157380_12232919 3300014326 Bacteria 611
81 Ga0157376_11872956 3300014969 Bacteria 637
82 Ga0163161_10006523 3300017792 Bacteria 8079
83 Ga0163161_10701946 3300017792 Bacteria 842
84 Ga0213872_10392521 3300021361 Bacteria 564
85 Ga0209676_1002969 3300025292 Bacteria 11038
86 Ga0209050_1001313 3300025298 Bacteria 27883
87 Ga0209050_1042072 3300025298 Bacteria 1252
88 Ga0209050_1114493 3300025298 Bacteria 512
89 Ga0207426_1088682 3300025302 Bacteria 823
90 Ga0209257_1042946 3300025304 Bacteria 1329
91 Ga0207707_11205411 3300025912 Unclassified 612
92 Ga0207671_10647284 3300025914 Bacteria 842
93 Ga0207700_10178825 3300025928 Bacteria 1775
94 Ga0207664_10339061 3300025929 Bacteria 1329
95 Ga0207690_10042836 3300025932 Bacteria 2976
96 Ga0207686_10780718 3300025934 Bacteria 764
97 Ga0207665_11665758 3300025939 Unclassified 505
98 Ga0207702_10024880 3300026078 Bacteria 4968
99 Ga0207702_10188696 3300026078 Bacteria 1903
100 Ga0207674_10712106 3300026116 Bacteria 969
101 Ga0268264_10397378 3300028381 Bacteria 1324
102 Ga0265334_10046972 3300028573 Bacteria 1667
103 Ga0265318_10015380 3300028577 Bacteria 3185
104 Ga0307515_10000012 3300028794 Bacteria 582232
105 Ga0307515_10179572 3300028794 Bacteria 2073
106 Ga0265327_10002594 3300031251 Bacteria 18703
107 Ga0307513_10110807 3300031456 Bacteria 2739
108 Ga0307408_100038239 3300031548 Bacteria 3384
109 Ga0307514_10060580 3300031649 Bacteria 2887
110 Ga0316575_10312712 3300031665 Unclassified 665
111 Ga0316578_10340629 3300031728 Bacteria 893
112 Ga0307516_10463178 3300031730 Bacteria 923
113 Ga0307413_10203122 3300031824 Bacteria 1433
114 Ga0307406_11200243 3300031901 Bacteria 659
115 Ga0307412_10418060 3300031911 Unclassified 1096
116 Ga0307414_10013620 3300032004 Bacteria 4847
117 Ga0307414_10023048 3300032004 Bacteria 3940
118 Ga0307414_10389788 3300032004 Bacteria 1207
119 Ga0307414_11543896 3300032004 Bacteria 618
120 Ga0307414_12149464 3300032004 Bacteria 521
121 Ga0316583_10000768 3300032133 Bacteria 10069
122 Ga0316583_10193743 3300032133 Unclassified 706
123 Ga0316574_0120240 3300035398 Bacteria 1687
124 Ga0316574_0365746 3300035398 Bacteria 911
125 Ga0316582_0112810 3300036647 Bacteria 1811
126 Ga0316584_0030465 3300036712 Bacteria 3985
127 Ga0395899_0843561 3300037312 Unclassified 563
128 Ga0395900_0375698 3300037418 Unclassified 1390
129 Ga0395901_0155770 3300038443 Bacteria 2399
130 Ga0395901_0197244 3300038443 Bacteria 2111
131 Ga0400484_19763 3300038725 Bacteria 1511
132 Ga0400483_036011 3300039062 Bacteria 1247
133 Ga0400483_080478 3300039062 Bacteria 2300
134 Ga0400483_211166 3300039062 Unclassified 1760
135 Ga0400483_251337 3300039062 Unclassified 3263
136 Ga0400489_65130 3300039093 Bacteria 1319
137 Ga0436361_0794339 3300039447 Bacteria 1265
138 Ga0451791_1326699 3300041451 Bacteria 680
139 Ga0451791_1400193 3300041451 Bacteria 619
140 Ga0451802_0990343 3300041460 Unclassified 586
141 Ga0451802_1018838 3300041460 Bacteria 574
142 Ga0451837_1262949 3300041494 Unclassified 516
143 Ga0451837_1537834 3300041494 Bacteria 1143
144 Ga0451853_3203361 3300041512 Unclassified 718
145 Ga0450894_061323 3300042131 Bacteria 566
146 Ga0451577_0006420 3300042876 Bacteria 11731
147 Ga0451577_0255866 3300042876 Unclassified 1585
148 Ga0453684_0001190 3300044712 Bacteria 80396
149 Ga0453684_0001753 3300044712 Bacteria 58019
150 Ga0453684_0510173 3300044712 Bacteria 1330
151 Ga0453684_0849247 3300044712 Bacteria 981
152 Ga0453684_1434296 3300044712 Bacteria 715
153 Ga0451576_0000015 3300045051 Bacteria 579908
154 Ga0451576_0010596 3300045051 Bacteria 10558
155 Ga0451576_0050131 3300045051 Bacteria 4380
156 Ga0451576_0349316 3300045051 Unclassified 1548
157 Ga0451576_0685383 3300045051 Bacteria 1077
158 Ga0495638_0000004 3300046460 Bacteria 700795
159 Ga0495651_0313290 3300046462 Bacteria 1049
160 Ga0495607_0023009 3300046501 Bacteria 3906
161 Ga0495616_0199313 3300046513 Bacteria 880
162 Ga0495631_0081758 3300046518 Bacteria 1393
163 Ga0495643_0000392 3300046522 Bacteria 57744
164 Ga0495634_0018578 3300046642 Bacteria 4947
165 Ga0495625_0016112 3300046660 Bacteria 5890
166 Ga0495625_0133627 3300046660 Bacteria 1679
167 Ga0495625_0136279 3300046660 Bacteria 1659
168 Ga0495657_0206394 3300046675 Bacteria 1196
169 Ga0495680_0612430 3300047322 Bacteria 727
170 Ga0495684_0053313 3300047471 Bacteria 3086
171 Ga0501294_003777 3300049517 Unclassified 1428
172 Ga0501300_006772 3300049523 Bacteria 1682
173 Ga0501034_0178599 3300049571 Bacteria 2088
174 Ga0501199_002728 3300049650 Unclassified 1667
175 Ga0501202_007230 3300049652 Unclassified 2003
176 Ga0501202_069694 3300049652 Bacteria 808
177 Ga0501206_062894 3300049653 Bacteria 613
178 Ga0501227_013475 3300049665 Bacteria 1801
179 Ga0501236_000053 3300049670 Bacteria 10054
180 Ga0501257_000562 3300049686 Bacteria 7366
181 Ga0501259_000466 3300049688 Bacteria 6464
182 Ga0501221_030304 3300049704 Unclassified 1124
183 Ga0501225_0030798 3300049705 Bacteria 1476
184 Ga0501264_003912 3300049761 Bacteria 1353
185 nmdc:mga07m45_621979_c1 3300050496 Bacteria 623
186 nmdc:mga0qj67_425638_c1 3300050509 Bacteria 1070
187 nmdc:mga06r32_1229812_c1 3300050510 Unclassified 694
188 nmdc:mga08y16_21390_c1 3300050511 Bacteria 6832
189 Ga0500557_007322 3300053105 Bacteria 2570
190 Ga0500562_121040 3300053108 Unclassified 713
191 Ga0500652_198509 3300053131 Bacteria 815
192 Ga0500568_0034638 3300053139 Bacteria 2065
193 Ga0500604_0044163 3300053151 Bacteria 1356
194 Ga0500604_0194694 3300053151 Bacteria 697
195 Ga0500616_0000015 3300053153 Bacteria 633259
196 Ga0500616_0087882 3300053153 Bacteria 1546
197 Ga0500622_0000182 3300053156 Bacteria 67645
198 Ga0500622_0000271 3300053156 Bacteria 53232
199 Ga0500622_0000579 3300053156 Bacteria 33147
200 Ga0500627_0064221 3300053158 Bacteria 1619
201 Ga0501082_0497408 3300060353 Bacteria 1066

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300017792 Ga0163161_10701946 Ga0163161_107019461 114
2 iso_pu_bacteria 2522125168 2522549328 118
3 3300003323 rootH1_10034555 rootH1_100345554 122
4 3300003781 Ga0055536_1023271 Ga0055536_10232712 122
5 3300005262 Ga0065165_1000639 Ga0065165_100063945 122
6 3300005289 Ga0065704_10124524 Ga0065704_101245242 122
7 3300005289 Ga0065704_10130559 Ga0065704_101305591 122
8 3300005577 Ga0068857_101144318 Ga0068857_1011443181 122
9 3300006353 Ga0075370_10552892 Ga0075370_105528921 122
10 3300013100 Ga0157373_10142599 Ga0157373_101425993 122
11 3300013102 Ga0157371_10180764 Ga0157371_101807642 122
12 3300013102 Ga0157371_10576155 Ga0157371_105761552 122
13 3300013104 Ga0157370_10084354 Ga0157370_100843545 122
14 3300013104 Ga0157370_10103174 Ga0157370_101031742 122
15 3300013104 Ga0157370_10211617 Ga0157370_102116171 122
16 3300013104 Ga0157370_10482896 Ga0157370_104828962 122
17 3300013104 Ga0157370_10524125 Ga0157370_105241252 122
18 3300013105 Ga0157369_11093485 Ga0157369_110934852 122
19 3300013307 Ga0157372_10773822 Ga0157372_107738222 122
20 3300025292 Ga0209676_1002969 Ga0209676_10029696 122
21 3300025298 Ga0209050_1042072 Ga0209050_10420721 122
22 3300025302 Ga0207426_1088682 Ga0207426_10886822 122
23 3300032004 Ga0307414_10023048 Ga0307414_100230483 122
24 3300041451 Ga0451791_1326699 Ga0451791_1326699_245_613 122
25 3300041460 Ga0451802_1018838 Ga0451802_1018838_31_399 122
26 3300042131 Ga0450894_061323 Ga0450894_061323_166_534 122
27 3300049665 Ga0501227_013475 Ga0501227_013475_270_638 122
28 3300049705 Ga0501225_0030798 Ga0501225_0030798_695_1063 122
29 3300050496 nmdc:mga07m45_621979_c1 nmdc:mga07m45_621979_c1_16_417 122
30 iso_pu_bacteria 2839989709 2839990524 122
31 iso_pu_bacteria 2884634485 2884635747 122
32 iso_pu_bacteria 2919692658 2919694890 122
33 3300003320 rootH2_10065075 rootH2_100650752 124
34 3300003322 rootL2_10157166 rootL2_101571661 124
35 3300003791 Ga0055530_10016423 Ga0055530_100164234 124
36 3300005262 Ga0065165_1064016 Ga0065165_10640161 124
37 3300006173 Ga0070716_100032592 Ga0070716_1000325922 124
38 3300017792 Ga0163161_10006523 Ga0163161_100065233 124
39 3300025298 Ga0209050_1001313 Ga0209050_10013139 124
40 3300025304 Ga0209257_1042946 Ga0209257_10429463 124
41 3300028573 Ga0265334_10046972 Ga0265334_100469722 124
42 3300031456 Ga0307513_10110807 Ga0307513_101108072 124
43 3300044712 Ga0453684_0510173 Ga0453684_0510173_158_532 124
44 3300046460 Ga0495638_0000004 Ga0495638_0000004_492187_492564 124
45 3300053105 Ga0500557_007322 Ga0500557_007322_600_977 124
46 3300053131 Ga0500652_198509 Ga0500652_198509_166_543 124
47 3300053151 Ga0500604_0194694 Ga0500604_0194694_41_418 124
48 3300053153 Ga0500616_0000015 Ga0500616_0000015_337096_337473 124
49 3300003316 rootH1_10021846 rootH1_1002184613 125
50 3300003320 rootH2_10052047 rootH2_100520474 125
51 3300003323 rootH1_10000951 rootH1_1000095115 125
52 3300003323 rootH1_10012210 rootH1_1001221043 125
53 3300003323 rootH1_10173044 rootH1_101730442 125
54 3300005340 Ga0070689_100820756 Ga0070689_1008207562 125
55 3300005435 Ga0070714_100381320 Ga0070714_1003813201 125
56 3300005436 Ga0070713_100147993 Ga0070713_1001479932 125
57 3300005466 Ga0070685_10006998 Ga0070685_100069982 125
58 3300005577 Ga0068857_102110916 Ga0068857_1021109161 125
59 3300005578 Ga0068854_102037068 Ga0068854_1020370682 125
60 3300005614 Ga0068856_100222418 Ga0068856_1002224184 125
61 3300005614 Ga0068856_101294331 Ga0068856_1012943312 125
62 3300005617 Ga0068859_103175822 Ga0068859_1031758222 125
63 3300005843 Ga0068860_100178397 Ga0068860_1001783972 125
64 3300005844 Ga0068862_100587926 Ga0068862_1005879261 125
65 3300006871 Ga0075434_101453077 Ga0075434_1014530771 125
66 3300006931 Ga0097620_103174762 Ga0097620_1031747622 125
67 3300009098 Ga0105245_11229737 Ga0105245_112297371 125
68 3300009176 Ga0105242_11379059 Ga0105242_113790591 125
69 3300009545 Ga0105237_10813427 Ga0105237_108134272 125
70 3300013104 Ga0157370_10001396 Ga0157370_100013966 125
71 3300013105 Ga0157369_11534502 Ga0157369_115345022 125
72 3300013297 Ga0157378_10063155 Ga0157378_100631552 125
73 3300013307 Ga0157372_10044073 Ga0157372_100440733 125
74 3300014325 Ga0163163_10157819 Ga0163163_101578192 125
75 3300014326 Ga0157380_10000466 Ga0157380_100004669 125
76 3300014326 Ga0157380_12232919 Ga0157380_122329191 125
77 3300014969 Ga0157376_11872956 Ga0157376_118729562 125
78 3300025928 Ga0207700_10178825 Ga0207700_101788252 125
79 3300025929 Ga0207664_10339061 Ga0207664_103390611 125
80 3300025934 Ga0207686_10780718 Ga0207686_107807181 125
81 3300026078 Ga0207702_10024880 Ga0207702_100248806 125
82 3300026078 Ga0207702_10188696 Ga0207702_101886963 125
83 3300026116 Ga0207674_10712106 Ga0207674_107121062 125
84 3300028381 Ga0268264_10397378 Ga0268264_103973782 125
85 3300028577 Ga0265318_10015380 Ga0265318_100153803 125
86 3300031665 Ga0316575_10312712 Ga0316575_103127121 125
87 3300031728 Ga0316578_10340629 Ga0316578_103406292 125
88 3300032004 Ga0307414_10013620 Ga0307414_100136204 125
89 3300032133 Ga0316583_10193743 Ga0316583_101937432 125
90 3300035398 Ga0316574_0120240 Ga0316574_0120240_661_1041 125
91 3300035398 Ga0316574_0365746 Ga0316574_0365746_31_408 125
92 3300036712 Ga0316584_0030465 Ga0316584_0030465_232_609 125
93 3300038443 Ga0395901_0155770 Ga0395901_0155770_1542_1922 125
94 3300041494 Ga0451837_1537834 Ga0451837_1537834_317_697 125
95 3300042876 Ga0451577_0006420 Ga0451577_0006420_8502_8879 125
96 3300044712 Ga0453684_0001190 Ga0453684_0001190_74092_74469 125
97 3300044712 Ga0453684_0849247 Ga0453684_0849247_193_570 125
98 3300045051 Ga0451576_0000015 Ga0451576_0000015_241262_241642 125
99 3300046462 Ga0495651_0313290 Ga0495651_0313290_411_788 125
100 3300046501 Ga0495607_0023009 Ga0495607_0023009_2059_2439 125
101 3300046513 Ga0495616_0199313 Ga0495616_0199313_317_697 125
102 3300046522 Ga0495643_0000392 Ga0495643_0000392_55557_55937 125
103 3300046642 Ga0495634_0018578 Ga0495634_0018578_4040_4426 125
104 3300046660 Ga0495625_0016112 Ga0495625_0016112_305_685 125
105 3300046660 Ga0495625_0133627 Ga0495625_0133627_1101_1478 125
106 3300046660 Ga0495625_0136279 Ga0495625_0136279_69_449 125
107 3300047322 Ga0495680_0612430 Ga0495680_0612430_160_546 125
108 3300047471 Ga0495684_0053313 Ga0495684_0053313_261_647 125
109 3300049571 Ga0501034_0178599 Ga0501034_0178599_1410_1790 125
110 3300050510 nmdc:mga06r32_1229812_c1 nmdc:mga06r32_1229812_c1_41_424 125
111 3300060353 Ga0501082_0497408 Ga0501082_0497408_284_664 125
112 3300003316 rootH1_10002543 rootH1_100025433 126
113 3300003320 rootH2_10028760 rootH2_1002876011 126
114 3300003320 rootH2_10128254 rootH2_101282542 126
115 3300003322 rootL2_10027139 rootL2_1002713912 126
116 3300003323 rootH1_10004273 rootH1_1000427310 126
117 3300003323 rootH1_10007412 rootH1_100074122 126
118 3300003323 rootH1_10039450 rootH1_100394503 126
119 3300003323 rootH1_10185970 rootH1_101859702 126
120 3300003323 rootH1_10227919 rootH1_102279191 126
121 3300005288 Ga0065714_10098887 Ga0065714_100988872 126
122 3300005337 Ga0070682_100207214 Ga0070682_1002072142 126
123 3300005337 Ga0070682_101092051 Ga0070682_1010920511 126
124 3300005366 Ga0070659_100022811 Ga0070659_1000228112 126
125 3300005617 Ga0068859_101944954 Ga0068859_1019449541 126
126 3300005841 Ga0068863_101046532 Ga0068863_1010465322 126
127 3300006844 Ga0075428_100029255 Ga0075428_1000292555 126
128 3300006846 Ga0075430_100444578 Ga0075430_1004445782 126
129 3300006931 Ga0097620_101944646 Ga0097620_1019446461 126
130 3300009094 Ga0111539_10004881 Ga0111539_100048819 126
131 3300009094 Ga0111539_10024335 Ga0111539_100243356 126
132 3300009545 Ga0105237_10379384 Ga0105237_103793842 126
133 3300013297 Ga0157378_12610443 Ga0157378_126104431 126
134 3300013306 Ga0163162_11705154 Ga0163162_117051542 126
135 3300013308 Ga0157375_12161717 Ga0157375_121617172 126
136 3300014325 Ga0163163_12256310 Ga0163163_122563101 126
137 3300014326 Ga0157380_10006725 Ga0157380_100067253 126
138 3300014326 Ga0157380_10285374 Ga0157380_102853742 126
139 3300014326 Ga0157380_10482648 Ga0157380_104826484 126
140 3300014326 Ga0157380_11605412 Ga0157380_116054122 126
141 3300021361 Ga0213872_10392521 Ga0213872_103925211 126
142 3300025298 Ga0209050_1114493 Ga0209050_11144932 126
143 3300025912 Ga0207707_11205411 Ga0207707_112054112 126
144 3300025914 Ga0207671_10647284 Ga0207671_106472842 126
145 3300025932 Ga0207690_10042836 Ga0207690_100428362 126
146 3300025939 Ga0207665_11665758 Ga0207665_116657581 126
147 3300028794 Ga0307515_10000012 Ga0307515_10000012215 126
148 3300028794 Ga0307515_10179572 Ga0307515_101795722 126
149 3300031251 Ga0265327_10002594 Ga0265327_100025948 126
150 3300031548 Ga0307408_100038239 Ga0307408_1000382394 126
151 3300031649 Ga0307514_10060580 Ga0307514_100605802 126
152 3300031730 Ga0307516_10463178 Ga0307516_104631782 126
153 3300031824 Ga0307413_10203122 Ga0307413_102031221 126
154 3300031901 Ga0307406_11200243 Ga0307406_112002431 126
155 3300031911 Ga0307412_10418060 Ga0307412_104180602 126
156 3300032004 Ga0307414_10389788 Ga0307414_103897881 126
157 3300032004 Ga0307414_11543896 Ga0307414_115438961 126
158 3300032004 Ga0307414_12149464 Ga0307414_121494641 126
159 3300032133 Ga0316583_10000768 Ga0316583_100007682 126
160 3300036647 Ga0316582_0112810 Ga0316582_0112810_798_1181 126
161 3300037312 Ga0395899_0843561 Ga0395899_0843561_61_441 126
162 3300037418 Ga0395900_0375698 Ga0395900_0375698_177_557 126
163 3300038443 Ga0395901_0197244 Ga0395901_0197244_384_764 126
164 3300038725 Ga0400484_19763 Ga0400484_19763_511_894 126
165 3300039062 Ga0400483_036011 Ga0400483_036011_61_444 126
166 3300039062 Ga0400483_080478 Ga0400483_080478_162_542 126
167 3300039062 Ga0400483_211166 Ga0400483_211166_751_1131 126
168 3300039062 Ga0400483_251337 Ga0400483_251337_714_1097 126
169 3300039093 Ga0400489_65130 Ga0400489_65130_19_489 126
170 3300039447 Ga0436361_0794339 Ga0436361_0794339_269_649 126
171 3300041451 Ga0451791_1400193 Ga0451791_1400193_16_396 126
172 3300041460 Ga0451802_0990343 Ga0451802_0990343_169_552 126
173 3300041494 Ga0451837_1262949 Ga0451837_1262949_103_483 126
174 3300041512 Ga0451853_3203361 Ga0451853_3203361_142_522 126
175 3300042876 Ga0451577_0255866 Ga0451577_0255866_459_839 126
176 3300044712 Ga0453684_0001753 Ga0453684_0001753_38192_38572 126
177 3300044712 Ga0453684_1434296 Ga0453684_1434296_225_605 126
178 3300045051 Ga0451576_0010596 Ga0451576_0010596_9741_10121 126
179 3300045051 Ga0451576_0050131 Ga0451576_0050131_1546_1926 126
180 3300045051 Ga0451576_0349316 Ga0451576_0349316_901_1281 126
181 3300045051 Ga0451576_0685383 Ga0451576_0685383_40_420 126
182 3300046518 Ga0495631_0081758 Ga0495631_0081758_362_742 126
183 3300046675 Ga0495657_0206394 Ga0495657_0206394_510_890 126
184 3300049517 Ga0501294_003777 Ga0501294_003777_464_880 126
185 3300049523 Ga0501300_006772 Ga0501300_006772_304_684 126
186 3300049650 Ga0501199_002728 Ga0501199_002728_1120_1536 126
187 3300049652 Ga0501202_007230 Ga0501202_007230_267_683 126
188 3300049652 Ga0501202_069694 Ga0501202_069694_23_403 126
189 3300049653 Ga0501206_062894 Ga0501206_062894_89_469 126
190 3300049670 Ga0501236_000053 Ga0501236_000053_5270_5650 126
191 3300049686 Ga0501257_000562 Ga0501257_000562_1671_2087 126
192 3300049688 Ga0501259_000466 Ga0501259_000466_2034_2450 126
193 3300049704 Ga0501221_030304 Ga0501221_030304_718_1101 126
194 3300049761 Ga0501264_003912 Ga0501264_003912_727_1107 126
195 3300050509 nmdc:mga0qj67_425638_c1 nmdc:mga0qj67_425638_c1_255_635 126
196 3300050511 nmdc:mga08y16_21390_c1 nmdc:mga08y16_21390_c1_4961_5341 126
197 3300053108 Ga0500562_121040 Ga0500562_121040_117_497 126
198 3300053139 Ga0500568_0034638 Ga0500568_0034638_626_1006 126
199 3300053151 Ga0500604_0044163 Ga0500604_0044163_930_1310 126
200 3300053153 Ga0500616_0087882 Ga0500616_0087882_1152_1532 126
201 3300053156 Ga0500622_0000182 Ga0500622_0000182_45271_45651 126
202 3300053156 Ga0500622_0000271 Ga0500622_0000271_30894_31274 126
203 3300053156 Ga0500622_0000579 Ga0500622_0000579_14020_14400 126
204 3300053158 Ga0500627_0064221 Ga0500627_0064221_1053_1433 126

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01042

Ribonuc_L-PSP

Endoribonuclease L-PSP

31

149

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1jd1-assembly1.cif.gz_F crystal structure of yeo7_yeast 0.9799 2 126
2dyy-assembly4.cif.gz_K crystal structure of putative translation initiation inhibitor ph0854 from pyrococcus horikoshii 0.9779 5 126
2dyy-assembly3.cif.gz_G crystal structure of putative translation initiation inhibitor ph0854 from pyrococcus horikoshii 0.9771 4 126
2dyy-assembly1.cif.gz_A crystal structure of putative translation initiation inhibitor ph0854 from pyrococcus horikoshii 0.977 2 126
2b33-assembly1.cif.gz_A crystal structure of a putative endoribonuclease (tm0215) from thermotoga maritima msb8 at 2.30 a resolution 0.9758 4 126
ID Description Score Start End Superfamily
1jd1F00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.9799 2 126 3.30.1330.40
2dyyG00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.9771 4 126 3.30.1330.40
1nq3C00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.9748 2 126 3.30.1330.40
af_Q86KR5_2_129_3.30.1330.40 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.9711 1 125 3.30.1330.40
3m1xA00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.9687 1 126 3.30.1330.40
ID Description Score Start End GO Terms
AF-A0A519YRL5-F1-model_v4 RidA family protein 0.9989 18 126 GO:0005829
GO:0019239
AF-A0A2D6B202-F1-model_v4 Reactive intermediate/imine deaminase 0.9978 2 126 GO:0005829
GO:0019239
AF-A0A3B8WCA0-F1-model_v4 Reactive intermediate/imine deaminase 0.9966 1 126 GO:0005829
GO:0019239
AF-A0A2E1CHB7-F1-model_v4 deleted 0.995 2 126
AF-A0A7Y3V5G6-F1-model_v4 RidA family protein 0.9945 2 126 GO:0005829
GO:0019239

Feature Viewer

pLDDT pTM Quality
96.27 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map