F311720

General Info

Members Datasets Scaffolds Average Seq Length
203 146 406 204

Family's Representative Sequence

Representative Sequence 3300049513|Ga0501290_009209|Ga0501290_009209_74_766
Length 230
Sequence VGFSSQEEFYRDARELFSCRDATPGDIESLMIKLYDFLPSGNGYKVRLLLTQLGIAYELIEVDVGRRETRTPEFLKKNPNGRIPCVQLEDGTYLWESNAIQFYFADGSPLLPDDRLARAQVLQWLFFEQYSHEPYIAVVRAWHHFGVVEQNRAQLADRIERGYAALGVMESHLTDRRFFVAERYTIADIALYAYTHVAPEGNFDLAPYPAVRAWLERVCEQDRHIPITHP

Samples

Sample ID Description Type Environment
1 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
9 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
23 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
24 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
25 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
26 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
27 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
28 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
29 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
32 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
33 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
34 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
35 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
36 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
37 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
38 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
39 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
40 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
41 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
42 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
43 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
44 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
45 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
46 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
47 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
49 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
51 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
52 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
53 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
54 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
55 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
56 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
57 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
58 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
59 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
60 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
91 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
92 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
93 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
94 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
95 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
96 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
97 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
98 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
99 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
100 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
101 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
102 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
103 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
104 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
105 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
106 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
107 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
108 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
109 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
110 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
111 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
112 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
113 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
114 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
115 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
116 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
117 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
118 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
119 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
120 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
121 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
122 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
123 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
124 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
125 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
126 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
127 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
128 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
129 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
130 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
131 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
132 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
133 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
134 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
135 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
136 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
137 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
138 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
139 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
140 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
141 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
142 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
143 3300053097 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere Metagenome Endosphere
144 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
145 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
146 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.46
Nodule 0
Rhizoplane 0.99
Rhizosphere 95.07
Stem 0
Stem Tuber 0
Unclassified 0.99

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501290_009209 3300049513 Bacteria 1254
2 rootL2_10039662 3300003322 Bacteria 1088
3 Ga0070676_10004091 3300005328 Bacteria 7666
4 Ga0070690_100007925 3300005330 Bacteria 6096
5 Ga0070690_100493436 3300005330 Bacteria 915
6 Ga0070666_10040801 3300005335 Bacteria 3099
7 Ga0068868_100162707 3300005338 Bacteria 1844
8 Ga0070689_100035379 3300005340 Bacteria 3816
9 Ga0070689_100057586 3300005340 Bacteria 3017
10 Ga0070689_100173893 3300005340 Bacteria 1746
11 Ga0070689_100395427 3300005340 Bacteria 1167
12 Ga0070687_100197850 3300005343 Bacteria 1216
13 Ga0070692_10026277 3300005345 Bacteria 2876
14 Ga0070692_10035780 3300005345 Bacteria 2516
15 Ga0070668_100032236 3300005347 Bacteria 3987
16 Ga0070669_100091494 3300005353 Bacteria 2281
17 Ga0070675_100036819 3300005354 Bacteria 3983
18 Ga0070671_100005840 3300005355 Bacteria 9804
19 Ga0070674_100020587 3300005356 Bacteria 4219
20 Ga0070673_100138719 3300005364 Bacteria 2049
21 Ga0070673_100217821 3300005364 Bacteria 1651
22 Ga0070688_100037357 3300005365 Bacteria 2959
23 Ga0070709_10032253 3300005434 Bacteria 3157
24 Ga0070700_100001315 3300005441 Bacteria 12317
25 Ga0070700_100175170 3300005441 Bacteria 1488
26 Ga0070700_100373579 3300005441 Bacteria 1064
27 Ga0070678_100243739 3300005456 Bacteria 1504
28 Ga0070662_100415623 3300005457 Bacteria 1112
29 Ga0068867_100116330 3300005459 Bacteria 2060
30 Ga0068867_100448880 3300005459 Bacteria 1098
31 Ga0070706_100342067 3300005467 Bacteria 1395
32 Ga0070698_100015649 3300005471 Bacteria 8011
33 Ga0070699_100003382 3300005518 Bacteria 14110
34 Ga0070697_100527775 3300005536 Bacteria 1034
35 Ga0070672_100038258 3300005543 Bacteria 3665
36 Ga0070686_100001292 3300005544 Bacteria 14156
37 Ga0070695_100901571 3300005545 Bacteria 714
38 Ga0070704_100044124 3300005549 Bacteria 3096
39 Ga0070704_100467267 3300005549 Bacteria 1089
40 Ga0070704_100773630 3300005549 Bacteria 856
41 Ga0068856_100402326 3300005614 Bacteria 1389
42 Ga0068852_100908182 3300005616 Bacteria 898
43 Ga0068859_100034474 3300005617 Bacteria 5080
44 Ga0068859_100095882 3300005617 Bacteria 3019
45 Ga0068864_100082222 3300005618 Bacteria 2825
46 Ga0068864_100406731 3300005618 Bacteria 1294
47 Ga0068861_100040874 3300005719 Bacteria 3470
48 Ga0068861_100431683 3300005719 Bacteria 1176
49 Ga0068863_100368234 3300005841 Unclassified 1402
50 Ga0068858_100168293 3300005842 Bacteria 2066
51 Ga0068862_100032868 3300005844 Bacteria 4382
52 Ga0068862_100629819 3300005844 Bacteria 1033
53 Ga0081455_10002632 3300005937 Bacteria 21273
54 Ga0081455_10089000 3300005937 Bacteria 2506
55 Ga0081539_10059709 3300005985 Bacteria 2097
56 Ga0068871_100858682 3300006358 Bacteria 839
57 Ga0075428_100101802 3300006844 Bacteria 3132
58 Ga0075428_100230887 3300006844 Bacteria 1997
59 Ga0075430_100080600 3300006846 Bacteria 2727
60 Ga0075430_100269308 3300006846 Bacteria 1410
61 Ga0075433_10438298 3300006852 Bacteria 1152
62 Ga0075434_100021596 3300006871 Bacteria 6259
63 Ga0075434_100440808 3300006871 Bacteria 1324
64 Ga0075429_100594382 3300006880 Bacteria 970
65 Ga0068865_100035965 3300006881 Bacteria 3335
66 Ga0068865_100729534 3300006881 Bacteria 849
67 Ga0097620_100034475 3300006931 Bacteria 5080
68 Ga0097620_100095885 3300006931 Bacteria 3019
69 Ga0105240_10056730 3300009093 Bacteria 4899
70 Ga0111539_10188561 3300009094 Bacteria 2407
71 Ga0111539_10460661 3300009094 Bacteria 1481
72 Ga0111539_10564428 3300009094 Bacteria 1326
73 Ga0111539_10927504 3300009094 Bacteria 1013
74 Ga0105245_10287535 3300009098 Bacteria 1609
75 Ga0105243_10009578 3300009148 Bacteria 7377
76 Ga0105238_10636892 3300009551 Bacteria 1076
77 Ga0157378_10064646 3300013297 Bacteria 3273
78 Ga0163162_10711709 3300013306 Bacteria 1125
79 Ga0157375_11484176 3300013308 Bacteria 800
80 Ga0157380_10354458 3300014326 Bacteria 1374
81 Ga0157377_10226373 3300014745 Bacteria 1200
82 Ga0157376_10006721 3300014969 Bacteria 8142
83 Ga0157376_10112105 3300014969 Bacteria 2403
84 Ga0209675_1001154 3300025291 Bacteria 16072
85 Ga0207642_10141083 3300025899 Bacteria 1271
86 Ga0207680_10031658 3300025903 Bacteria 2998
87 Ga0207699_10047528 3300025906 Bacteria 2517
88 Ga0207699_10196884 3300025906 Bacteria 1363
89 Ga0207645_10121491 3300025907 Bacteria 1695
90 Ga0207684_10201906 3300025910 Bacteria 1715
91 Ga0207662_10637383 3300025918 Bacteria 744
92 Ga0207646_10337489 3300025922 Bacteria 1361
93 Ga0207681_10000987 3300025923 Bacteria 18621
94 Ga0207659_10163736 3300025926 Bacteria 1749
95 Ga0207664_10419195 3300025929 Bacteria 1192
96 Ga0207706_10407449 3300025933 Bacteria 1179
97 Ga0207706_10491720 3300025933 Bacteria 1059
98 Ga0207709_10121793 3300025935 Bacteria 1762
99 Ga0207670_10277419 3300025936 Bacteria 1305
100 Ga0207704_10003947 3300025938 Bacteria 6744
101 Ga0207665_10337532 3300025939 Bacteria 1135
102 Ga0207691_10008619 3300025940 Bacteria 9787
103 Ga0207691_10025618 3300025940 Bacteria 5537
104 Ga0207711_11321057 3300025941 Bacteria 663
105 Ga0207679_10331068 3300025945 Bacteria 1322
106 Ga0207651_10007470 3300025960 Bacteria 5825
107 Ga0207668_10001461 3300025972 Bacteria 13869
108 Ga0207677_10328333 3300026023 Bacteria 1274
109 Ga0207677_10818515 3300026023 Bacteria 835
110 Ga0207703_10557824 3300026035 Bacteria 1080
111 Ga0207703_11025652 3300026035 Bacteria 792
112 Ga0207703_11408600 3300026035 Bacteria 670
113 Ga0207708_10006416 3300026075 Bacteria 8715
114 Ga0207702_10107726 3300026078 Bacteria 2472
115 Ga0207641_10643740 3300026088 Bacteria 1041
116 Ga0207641_10752322 3300026088 Bacteria 962
117 Ga0207641_11263348 3300026088 Bacteria 739
118 Ga0207648_10173736 3300026089 Bacteria 1905
119 Ga0207648_10702457 3300026089 Bacteria 937
120 Ga0207676_11004905 3300026095 Bacteria 822
121 Ga0207675_100009024 3300026118 Bacteria 9354
122 Ga0268265_10042229 3300028380 Bacteria 3382
123 Ga0268265_10061653 3300028380 Bacteria 2879
124 Ga0268264_10055209 3300028381 Bacteria 3318
125 Ga0265337_1003361 3300028556 Bacteria 6958
126 Ga0265336_10022510 3300028666 Bacteria 2006
127 Ga0265338_10031050 3300028800 Bacteria 5246
128 Ga0265327_10016039 3300031251 Bacteria 4790
129 Ga0265327_10093981 3300031251 Bacteria 1458
130 Ga0307513_10001504 3300031456 Bacteria 33537
131 Ga0307509_10003803 3300031507 Bacteria 22373
132 Ga0307408_101149182 3300031548 Bacteria 722
133 Ga0265313_10047069 3300031595 Bacteria 2090
134 Ga0265314_10181782 3300031711 Bacteria 1259
135 Ga0307410_10520027 3300031852 Bacteria 982
136 Ga0307409_100900856 3300031995 Bacteria 898
137 Ga0307409_101226132 3300031995 Bacteria 774
138 Ga0307415_100052107 3300032126 Bacteria 2781
139 Ga0373949_0008422 3300035090 Bacteria 2256
140 Ga0373936_0004956 3300035113 Bacteria 5013
141 Ga0373961_0106755 3300035241 Bacteria 913
142 Ga0373933_0004320 3300035724 Bacteria 7800
143 Ga0373937_0208225 3300036401 Bacteria 1839
144 Ga0373925_0703564 3300037068 Bacteria 833
145 Ga0373925_0852487 3300037068 Bacteria 751
146 Ga0395899_0113969 3300037312 Bacteria 1941
147 Ga0395899_0142168 3300037312 Bacteria 1707
148 Ga0395899_0324497 3300037312 Bacteria 1036
149 Ga0395900_0096813 3300037418 Bacteria 3032
150 Ga0395898_0050415 3300037466 Bacteria 4074
151 Ga0395898_0153442 3300037466 Bacteria 2203
152 Ga0395901_0152255 3300038443 Bacteria 2430
153 Ga0395901_0714052 3300038443 Bacteria 999
154 Ga0451577_0016126 3300042876 Bacteria 6927
155 Ga0451577_0085427 3300042876 Bacteria 2815
156 Ga0451577_0725508 3300042876 Bacteria 899
157 Ga0453684_0122026 3300044712 Bacteria 3144
158 Ga0453684_1170950 3300044712 Bacteria 808
159 Ga0466957_0050229 3300044842 Bacteria 2538
160 Ga0466960_0315895 3300044901 Bacteria 884
161 Ga0451576_0008172 3300045051 Bacteria 12318
162 Ga0466967_0061715 3300045976 Bacteria 3326
163 Ga0495613_0295435 3300046689 Bacteria 1122
164 Ga0495676_0248614 3300047321 Bacteria 1214
165 Ga0496104_0504022 3300048907 Bacteria 1122
166 Ga0496114_0048049 3300048917 Bacteria 3549
167 Ga0501031_0005326 3300049568 Bacteria 8376
168 Ga0501032_0154076 3300049569 Bacteria 1510
169 Ga0501033_0007328 3300049570 Bacteria 8597
170 Ga0501033_0297188 3300049570 Bacteria 1137
171 Ga0501034_0012174 3300049571 Bacteria 8895
172 Ga0501036_0294909 3300049572 Bacteria 1356
173 Ga0501037_0360677 3300049573 Bacteria 1001
174 Ga0501038_0033324 3300049574 Bacteria 4538
175 Ga0501038_0256387 3300049574 Bacteria 1384
176 Ga0501047_0066247 3300049581 Bacteria 3481
177 Ga0501047_0081863 3300049581 Bacteria 3103
178 Ga0501047_0563804 3300049581 Bacteria 962
179 Ga0501048_0782303 3300049582 Bacteria 685
180 Ga0501070_0101847 3300049586 Bacteria 2375
181 Ga0501070_0139809 3300049586 Bacteria 1999
182 Ga0501070_0372570 3300049586 Bacteria 1157
183 Ga0501080_0081404 3300049742 Bacteria 3008
184 Ga0501080_0161972 3300049742 Bacteria 2066
185 Ga0501044_0037857 3300049823 Bacteria 5040
186 Ga0501044_0408512 3300049823 Bacteria 1269
187 Ga0501044_0463183 3300049823 Bacteria 1173
188 nmdc:mga05p37_701677_c1 3300050507 Bacteria 827
189 nmdc:mga09592_436558_c1 3300050508 Bacteria 1130
190 nmdc:mga0qj67_27613_c1 3300050509 Bacteria 4401
191 nmdc:mga0qj67_86774_c1 3300050509 Bacteria 2511
192 nmdc:mga06r32_397217_c1 3300050510 Bacteria 1361
193 nmdc:mga08y16_131193_c1 3300050511 Bacteria 2605
194 nmdc:mga08y16_549316_c1 3300050511 Bacteria 1169
195 nmdc:mga0n895_80385_c1 3300050512 Bacteria 3248
196 nmdc:mga08x19_47886_c1 3300050514 Bacteria 2737
197 nmdc:mga08x19_516371_c1 3300050514 Bacteria 844
198 nmdc:mga0a205_408663_c1 3300050515 Bacteria 1221
199 Ga0500646_0143537 3300053090 Unclassified 785
200 Ga0500648_154621 3300053097 Bacteria 1215
201 Ga0500591_064576 3300053115 Bacteria 1677
202 Ga0500639_159604 3300053163 Bacteria 1028
203 Ga0530510_0232993 3300061734 Bacteria 1370
204 Ga0501290_009209
205 rootL2_10039662
206 Ga0070676_10004091
207 Ga0070690_100007925
208 Ga0070690_100493436
209 Ga0070666_10040801
210 Ga0068868_100162707
211 Ga0070689_100035379
212 Ga0070689_100057586
213 Ga0070689_100173893
214 Ga0070689_100395427
215 Ga0070687_100197850
216 Ga0070692_10026277
217 Ga0070692_10035780
218 Ga0070668_100032236
219 Ga0070669_100091494
220 Ga0070675_100036819
221 Ga0070671_100005840
222 Ga0070674_100020587
223 Ga0070673_100138719
224 Ga0070673_100217821
225 Ga0070688_100037357
226 Ga0070709_10032253
227 Ga0070700_100001315
228 Ga0070700_100175170
229 Ga0070700_100373579
230 Ga0070678_100243739
231 Ga0070662_100415623
232 Ga0068867_100116330
233 Ga0068867_100448880
234 Ga0070706_100342067
235 Ga0070698_100015649
236 Ga0070699_100003382
237 Ga0070697_100527775
238 Ga0070672_100038258
239 Ga0070686_100001292
240 Ga0070695_100901571
241 Ga0070704_100044124
242 Ga0070704_100467267
243 Ga0070704_100773630
244 Ga0068856_100402326
245 Ga0068852_100908182
246 Ga0068859_100034474
247 Ga0068859_100095882
248 Ga0068864_100082222
249 Ga0068864_100406731
250 Ga0068861_100040874
251 Ga0068861_100431683
252 Ga0068863_100368234
253 Ga0068858_100168293
254 Ga0068862_100032868
255 Ga0068862_100629819
256 Ga0081455_10002632
257 Ga0081455_10089000
258 Ga0081539_10059709
259 Ga0068871_100858682
260 Ga0075428_100101802
261 Ga0075428_100230887
262 Ga0075430_100080600
263 Ga0075430_100269308
264 Ga0075433_10438298
265 Ga0075434_100021596
266 Ga0075434_100440808
267 Ga0075429_100594382
268 Ga0068865_100035965
269 Ga0068865_100729534
270 Ga0097620_100034475
271 Ga0097620_100095885
272 Ga0105240_10056730
273 Ga0111539_10188561
274 Ga0111539_10460661
275 Ga0111539_10564428
276 Ga0111539_10927504
277 Ga0105245_10287535
278 Ga0105243_10009578
279 Ga0105238_10636892
280 Ga0157378_10064646
281 Ga0163162_10711709
282 Ga0157375_11484176
283 Ga0157380_10354458
284 Ga0157377_10226373
285 Ga0157376_10006721
286 Ga0157376_10112105
287 Ga0209675_1001154
288 Ga0207642_10141083
289 Ga0207680_10031658
290 Ga0207699_10047528
291 Ga0207699_10196884
292 Ga0207645_10121491
293 Ga0207684_10201906
294 Ga0207662_10637383
295 Ga0207646_10337489
296 Ga0207681_10000987
297 Ga0207659_10163736
298 Ga0207664_10419195
299 Ga0207706_10407449
300 Ga0207706_10491720
301 Ga0207709_10121793
302 Ga0207670_10277419
303 Ga0207704_10003947
304 Ga0207665_10337532
305 Ga0207691_10008619
306 Ga0207691_10025618
307 Ga0207711_11321057
308 Ga0207679_10331068
309 Ga0207651_10007470
310 Ga0207668_10001461
311 Ga0207677_10328333
312 Ga0207677_10818515
313 Ga0207703_10557824
314 Ga0207703_11025652
315 Ga0207703_11408600
316 Ga0207708_10006416
317 Ga0207702_10107726
318 Ga0207641_10643740
319 Ga0207641_10752322
320 Ga0207641_11263348
321 Ga0207648_10173736
322 Ga0207648_10702457
323 Ga0207676_11004905
324 Ga0207675_100009024
325 Ga0268265_10042229
326 Ga0268265_10061653
327 Ga0268264_10055209
328 Ga0265337_1003361
329 Ga0265336_10022510
330 Ga0265338_10031050
331 Ga0265327_10016039
332 Ga0265327_10093981
333 Ga0307513_10001504
334 Ga0307509_10003803
335 Ga0307408_101149182
336 Ga0265313_10047069
337 Ga0265314_10181782
338 Ga0307410_10520027
339 Ga0307409_100900856
340 Ga0307409_101226132
341 Ga0307415_100052107
342 Ga0373949_0008422
343 Ga0373936_0004956
344 Ga0373961_0106755
345 Ga0373933_0004320
346 Ga0373937_0208225
347 Ga0373925_0703564
348 Ga0373925_0852487
349 Ga0395899_0113969
350 Ga0395899_0142168
351 Ga0395899_0324497
352 Ga0395900_0096813
353 Ga0395898_0050415
354 Ga0395898_0153442
355 Ga0395901_0152255
356 Ga0395901_0714052
357 Ga0451577_0016126
358 Ga0451577_0085427
359 Ga0451577_0725508
360 Ga0453684_0122026
361 Ga0453684_1170950
362 Ga0466957_0050229
363 Ga0466960_0315895
364 Ga0451576_0008172
365 Ga0466967_0061715
366 Ga0495613_0295435
367 Ga0495676_0248614
368 Ga0496104_0504022
369 Ga0496114_0048049
370 Ga0501031_0005326
371 Ga0501032_0154076
372 Ga0501033_0007328
373 Ga0501033_0297188
374 Ga0501034_0012174
375 Ga0501036_0294909
376 Ga0501037_0360677
377 Ga0501038_0033324
378 Ga0501038_0256387
379 Ga0501047_0066247
380 Ga0501047_0081863
381 Ga0501047_0563804
382 Ga0501048_0782303
383 Ga0501070_0101847
384 Ga0501070_0139809
385 Ga0501070_0372570
386 Ga0501080_0081404
387 Ga0501080_0161972
388 Ga0501044_0037857
389 Ga0501044_0408512
390 Ga0501044_0463183
391 nmdc:mga05p37_701677_c1
392 nmdc:mga09592_436558_c1
393 nmdc:mga0qj67_27613_c1
394 nmdc:mga0qj67_86774_c1
395 nmdc:mga06r32_397217_c1
396 nmdc:mga08y16_131193_c1
397 nmdc:mga08y16_549316_c1
398 nmdc:mga0n895_80385_c1
399 nmdc:mga08x19_47886_c1
400 nmdc:mga08x19_516371_c1
401 nmdc:mga0a205_408663_c1
402 Ga0500646_0143537
403 Ga0500648_154621
404 Ga0500591_064576
405 Ga0500639_159604
406 Ga0530510_0232993

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02798

GST_N

Glutathione S-transferase, N-terminal domain

30

106

0.96

PF13417

GST_N_3

Glutathione S-transferase, N-terminal domain

34

110

0.93

PF13409

GST_N_2

Glutathione S-transferase, N-terminal domain

39

106

0.89

PF14497

GST_C_3

Glutathione S-transferase, C-terminal domain

143

223

0.84

PF00043

GST_C

Glutathione S-transferase, C-terminal domain

120

222

0.83

PF13410

GST_C_2

Glutathione S-transferase, C-terminal domain

149

217

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
3m3m-assembly1.cif.gz_A crystal structure of glutathione s-transferase from pseudomonas fluorescens [pf-5] 0.9762 2 204
3m3m-assembly1.cif.gz_A crystal structure of glutathione s-transferase from pseudomonas fluorescens [pf-5] 0.9619 2 204
3m8n-assembly1.cif.gz_A crystal structure of a possible gutathione s-tranferase from rhodopseudomonas palustris 0.9553 2 202
3m8n-assembly2.cif.gz_D crystal structure of a possible gutathione s-tranferase from rhodopseudomonas palustris 0.9544 1 202
3m8n-assembly1.cif.gz_B crystal structure of a possible gutathione s-tranferase from rhodopseudomonas palustris 0.9541 2 202
ID Description Score Start End Superfamily
3m3mA02 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.9651 86 201 1.20.1050.10
4yh2C01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9582 1 80 3.40.30.10
3m3mA02 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.9569 86 201 1.20.1050.10
4hz2B02 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.9532 86 201 1.20.1050.10
4hz2B02 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.9453 86 201 1.20.1050.10
ID Description Score Start End GO Terms
AF-A0A091ARS2-F1-model_v4 Glutathione S-transferase 0.9833 8 204
AF-A0A523LCV1-F1-model_v4 deleted 0.98 1 202
AF-A0A6M0S6M3-F1-model_v4 Glutathione S-transferase family protein 0.9794 1 203 GO:0016740
AF-Q9I370-F1-model_v4 Probable glutathione S-transferase 0.9793 1 204 GO:0004364
GO:0005737
AF-A0A3M5VYQ6-F1-model_v4 Glutathione S-transferase 0.979 1 204

Map